Query         psy18230
Match_columns 112
No_of_seqs    107 out of 248
Neff          5.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:02:15 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy18230.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/18230hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2308|consensus               99.9   2E-27 4.4E-32  205.8   7.0  112    1-112   270-386 (741)
  2 KOG2308|consensus               91.3   0.017 3.6E-07   51.7  -3.4   94   18-111   333-455 (741)
  3 PF03959 FSH1:  Serine hydrolas  72.9     3.2   7E-05   30.9   2.5   27   26-54      7-33  (212)
  4 PF12146 Hydrolase_4:  Putative  68.8     8.7 0.00019   24.6   3.5   39   22-76     15-53  (79)
  5 PF05057 DUF676:  Putative seri  66.9     4.3 9.3E-05   30.5   2.0   15   21-35      2-16  (217)
  6 KOG2551|consensus               56.9      12 0.00026   29.5   2.9   35   26-62      8-42  (230)
  7 KOG1455|consensus               53.8      32 0.00069   28.3   5.0   47   20-81     51-97  (313)
  8 PRK13562 acetolactate synthase  46.8      36 0.00078   22.7   3.6   26    5-30     24-51  (84)
  9 PF10137 TIR-like:  Predicted n  35.7      63  0.0014   22.7   3.7   14   68-81     24-37  (125)
 10 COG2840 Uncharacterized protei  35.3      34 0.00073   26.0   2.3   19   25-43    127-145 (184)
 11 PF01713 Smr:  Smr domain;  Int  35.2      53  0.0011   20.6   3.0   15   24-38     28-42  (83)
 12 PRK11152 ilvM acetolactate syn  35.2      47   0.001   21.5   2.7   25    6-30     26-52  (76)
 13 PRK04946 hypothetical protein;  35.1      22 0.00047   26.8   1.3   11   24-34    125-135 (181)
 14 COG2087 CobU Adenosyl cobinami  32.5     5.6 0.00012   30.1  -2.3   34    4-37    139-174 (175)
 15 COG1219 ClpX ATP-dependent pro  32.1      28 0.00061   29.4   1.5   19   92-110   352-370 (408)
 16 PF07521 RMMBL:  RNA-metabolisi  31.4      27 0.00059   19.8   1.0    8   24-31     33-40  (43)
 17 PF12697 Abhydrolase_6:  Alpha/  28.3 1.2E+02  0.0027   20.3   4.1   35   26-77      1-35  (228)
 18 PF02230 Abhydrolase_2:  Phosph  28.2      47   0.001   24.2   2.1   18   19-36     10-27  (216)
 19 PF01674 Lipase_2:  Lipase (cla  26.6      60  0.0013   24.9   2.5   67   25-104     3-70  (219)
 20 PRK12418 cysteinyl-tRNA synthe  24.3      67  0.0015   26.8   2.5   46   33-86    259-306 (384)
 21 PF11798 IMS_HHH:  IMS family H  23.6     9.2  0.0002   20.7  -1.9   10   29-38     16-25  (32)
 22 PF03944 Endotoxin_C:  delta en  23.5      36 0.00078   24.0   0.7    8   66-73    136-143 (143)
 23 PRK06737 acetolactate synthase  23.3      75  0.0016   20.6   2.1   27    5-31     24-52  (76)
 24 PRK00409 recombination and DNA  22.2      83  0.0018   28.6   2.8   24   24-58    734-757 (782)
 25 PRK11460 putative hydrolase; P  22.1      80  0.0017   23.6   2.4   17   21-37     14-30  (232)
 26 PF00975 Thioesterase:  Thioest  21.9      51  0.0011   23.6   1.2   10   26-35      3-12  (229)
 27 PF10503 Esterase_phd:  Esteras  21.5      61  0.0013   24.8   1.6   12   25-36     18-29  (220)
 28 smart00463 SMR Small MutS-rela  21.2      70  0.0015   19.9   1.6   14   24-37     32-45  (80)
 29 KOG2541|consensus               21.2 1.1E+02  0.0024   25.0   3.1   13   26-38     26-38  (296)
 30 PF09600 Cyd_oper_YbgE:  Cyd op  21.1      27  0.0006   23.1  -0.3   10   27-36     46-55  (82)
 31 TIGR01738 bioH putative pimelo  20.4      68  0.0015   22.1   1.6   13   25-37      6-18  (245)
 32 COG2088 SpoVG Uncharacterized   20.4      51  0.0011   22.5   0.9   29   26-54     28-74  (95)

No 1  
>KOG2308|consensus
Probab=99.94  E-value=2e-27  Score=205.80  Aligned_cols=112  Identities=37%  Similarity=0.599  Sum_probs=103.4

Q ss_pred             CCceeccccCccCCCCCCCCCCCeEEEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccC---CCCceEEEeeeec--
Q psy18230          1 TGYRLARGYKDQALETDRPEDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFAS---SKLRAEFFPVEWR--   75 (112)
Q Consensus         1 ~g~~l~RG~~~~~~~~d~~~~idHLVfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~---~~~rvefLPI~Wr--   75 (112)
                      .|+.|+|+|.+++.+.+++.+++||||+||||||++..+++++|++.||....++.++|+.+   +..||+||||+||  
T Consensus       270 ~~~~l~~~~~ee~~~~~k~~~v~hllf~vhgig~~~~~~~i~~n~~~~r~~~~~~~~sh~~~~~~r~v~v~fLpv~w~~~  349 (741)
T KOG2308|consen  270 VGRGLRRFLEEENDLASKPVPVDHLLFVVHGIGQKMKDNSIIENVDSFRELPKALGESHLKNSSDRPVRVLFLPVEWRKG  349 (741)
T ss_pred             cccccchhhhhhccccCCCccchheeeeeeccccCccccchhhcchhHHHHHHHHHHhhhccccCCccceeEEEeeeeEc
Confidence            37789999999999999999999999999999999999999999999999999999999987   4557999999999  


Q ss_pred             cccccCCCccccccccchHHHHHHHhhhhhhhccccC
Q psy18230         76 SSLALDGDIVESITQLNVLNLRHMLNASAMDIMYYTD  112 (112)
Q Consensus        76 ~~l~~d~~~l~~ITl~~i~~lR~~~nd~~lDvl~Y~S  112 (112)
                      +....+...+++||+++|+.+|.|+|+|+||||||||
T Consensus       350 ~~~~~~~~~v~~Itl~~i~~~R~~lnst~lDilyY~S  386 (741)
T KOG2308|consen  350 GEKTEDVNFVDDITLDSIPRKRIFLNSTALDILYYMS  386 (741)
T ss_pred             cchhccccchhhcccccchhHHhhccchhhhhcccCC
Confidence            5555566789999999999999999999999999998


No 2  
>KOG2308|consensus
Probab=91.33  E-value=0.017  Score=51.69  Aligned_cols=94  Identities=12%  Similarity=0.022  Sum_probs=55.6

Q ss_pred             CCCCCCeEEEEEeCC--CccCCchhHHHHhHHHHHHH-----HHH-HHhcccC-----CCCceEEEeeeeccccccCC--
Q psy18230         18 RPEDISHLVFVVHGM--GQKMDSGRIIKNATQFRESV-----MWL-KKKYFAS-----SKLRAEFFPVEWRSSLALDG--   82 (112)
Q Consensus        18 ~~~~idHLVfvVHGI--Gq~~~~~~iv~~~~~~r~~~-----~~l-~~~~~~~-----~~~rvefLPI~Wr~~l~~d~--   82 (112)
                      ..+++++|+|+|||+  |...+..+++++++.++...     ..- .+--|..     ......+.+.-||.-+.|.+  
T Consensus       333 ~~r~v~v~fLpv~w~~~~~~~~~~~~v~~Itl~~i~~~R~~lnst~lDilyY~Splyrq~Iv~~V~~elNr~y~lf~~rn  412 (741)
T KOG2308|consen  333 SDRPVRVLFLPVEWRKGGEKTEDVNFVDDITLDSIPRKRIFLNSTALDILYYMSPLYRQEIVKGVARELNRLYALFKDRN  412 (741)
T ss_pred             cCCccceeEEEeeeeEccchhccccchhhcccccchhHHhhccchhhhhcccCChHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            356899999999999  67666666666654333332     211 1100111     23344555555665555532  


Q ss_pred             -----------Ccc-ccccccchHHH--HHHHhhhhhhhcccc
Q psy18230         83 -----------DIV-ESITQLNVLNL--RHMLNASAMDIMYYT  111 (112)
Q Consensus        83 -----------~~l-~~ITl~~i~~l--R~~~nd~~lDvl~Y~  111 (112)
                                 .++ .-||.+.+...  +.|+-|.++|+++|.
T Consensus       413 Pef~G~Vsi~gHSLGSvit~Dil~~q~~P~~l~D~~ld~~~~~  455 (741)
T KOG2308|consen  413 PEFNGKVSIAGHSLGSVITYDILSHQRSPTFLLDELLDKLLYE  455 (741)
T ss_pred             hhhcCceeeccCCCCceEEEeecccccCcchhHHHHHhhhhcc
Confidence                       223 44566665555  679999999999884


No 3  
>PF03959 FSH1:  Serine hydrolase (FSH1);  InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family. It consists of serine hydrolases of unknown specificity [, ] and includes uncharacterised proteins.; PDB: 1YCD_A.
Probab=72.88  E-value=3.2  Score=30.86  Aligned_cols=27  Identities=19%  Similarity=0.465  Sum_probs=13.8

Q ss_pred             EEEEeCCCccCCchhHHHHhHHHHHHHHH
Q psy18230         26 VFVVHGMGQKMDSGRIIKNATQFRESVMW   54 (112)
Q Consensus        26 VfvVHGIGq~~~~~~iv~~~~~~r~~~~~   54 (112)
                      |||.||-||+-.  -|-..+..+|+.+.+
T Consensus         7 iLcLHG~~~na~--if~~q~~~l~~~l~~   33 (212)
T PF03959_consen    7 ILCLHGYGQNAE--IFRQQTSALRKALKK   33 (212)
T ss_dssp             EEEE--TT--HH--HHHHHTHHHHHHHHH
T ss_pred             EEEeCCCCcCHH--HHHHHHHHHHHHHhh
Confidence            899999999753  233344556655544


No 4  
>PF12146 Hydrolase_4:  Putative lysophospholipase;  InterPro: IPR022742  This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length. Many members are annotated as being lysophospholipases, and others as alpha-beta hydrolase fold-containing proteins. 
Probab=68.84  E-value=8.7  Score=24.61  Aligned_cols=39  Identities=21%  Similarity=0.425  Sum_probs=26.1

Q ss_pred             CCeEEEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccCCCCceEEEeeeecc
Q psy18230         22 ISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRS   76 (112)
Q Consensus        22 idHLVfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~~~~rvefLPI~Wr~   76 (112)
                      +.-.|+++||.|.+.+         .+...++.|++       .+..+.-..+|-
T Consensus        15 ~k~~v~i~HG~~eh~~---------ry~~~a~~L~~-------~G~~V~~~D~rG   53 (79)
T PF12146_consen   15 PKAVVVIVHGFGEHSG---------RYAHLAEFLAE-------QGYAVFAYDHRG   53 (79)
T ss_pred             CCEEEEEeCCcHHHHH---------HHHHHHHHHHh-------CCCEEEEECCCc
Confidence            8999999999986543         45666666664       335555555543


No 5  
>PF05057 DUF676:  Putative serine esterase (DUF676);  InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases.
Probab=66.87  E-value=4.3  Score=30.46  Aligned_cols=15  Identities=40%  Similarity=0.558  Sum_probs=13.0

Q ss_pred             CCCeEEEEEeCCCcc
Q psy18230         21 DISHLVFVVHGMGQK   35 (112)
Q Consensus        21 ~idHLVfvVHGIGq~   35 (112)
                      +-.|||.+|||++-.
T Consensus         2 ~~~hLvV~vHGL~G~   16 (217)
T PF05057_consen    2 KPVHLVVFVHGLWGN   16 (217)
T ss_pred             CCCEEEEEeCCCCCC
Confidence            458999999999866


No 6  
>KOG2551|consensus
Probab=56.91  E-value=12  Score=29.48  Aligned_cols=35  Identities=20%  Similarity=0.299  Sum_probs=27.2

Q ss_pred             EEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccC
Q psy18230         26 VFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFAS   62 (112)
Q Consensus        26 VfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~   62 (112)
                      |||.||-=|...  .|-.....+|+.++++.+-+|++
T Consensus         8 vLcLHGfrQsg~--~F~~Ktg~~rK~l~k~~el~f~~   42 (230)
T KOG2551|consen    8 VLCLHGFRQSGK--VFSEKTGSLRKLLKKLAELVFPD   42 (230)
T ss_pred             EEEecchhhccH--HHHHHhhhHHHHHHhhheEEecC
Confidence            899999988764  45566688999999887766654


No 7  
>KOG1455|consensus
Probab=53.81  E-value=32  Score=28.28  Aligned_cols=47  Identities=19%  Similarity=0.380  Sum_probs=34.6

Q ss_pred             CCCCeEEEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccCCCCceEEEeeeeccccccC
Q psy18230         20 EDISHLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALD   81 (112)
Q Consensus        20 ~~idHLVfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~~~~rvefLPI~Wr~~l~~d   81 (112)
                      .++.-|||++||-|..++        ..|.+.+..+++       .+..+-.+.|+-.=..|
T Consensus        51 ~~pr~lv~~~HG~g~~~s--------~~~~~~a~~l~~-------~g~~v~a~D~~GhG~Sd   97 (313)
T KOG1455|consen   51 TEPRGLVFLCHGYGEHSS--------WRYQSTAKRLAK-------SGFAVYAIDYEGHGRSD   97 (313)
T ss_pred             CCCceEEEEEcCCcccch--------hhHHHHHHHHHh-------CCCeEEEeeccCCCcCC
Confidence            488999999999998664        457777777775       44677788887654443


No 8  
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional
Probab=46.76  E-value=36  Score=22.70  Aligned_cols=26  Identities=15%  Similarity=0.227  Sum_probs=21.8

Q ss_pred             eccccCccC--CCCCCCCCCCeEEEEEe
Q psy18230          5 LARGYKDQA--LETDRPEDISHLVFVVH   30 (112)
Q Consensus         5 l~RG~~~~~--~~~d~~~~idHLVfvVH   30 (112)
                      -+|||.-..  ..+.+.+.|..+.+|++
T Consensus        24 sRRg~NI~SLtvg~Te~~~iSRmtivv~   51 (84)
T PRK13562         24 VRLQYNIDTLHVTHSEQPGISNMEIQVD   51 (84)
T ss_pred             hccCcCeeeEEecccCCCCceEEEEEEe
Confidence            479999765  56778899999999998


No 9  
>PF10137 TIR-like:  Predicted nucleotide-binding protein containing TIR-like domain;  InterPro: IPR019302 This entry represents a TIR-like domain found in a family of prokaryotic predicted nucleotide-binding proteins. Their exact function has not, as yet, been defined. 
Probab=35.72  E-value=63  Score=22.74  Aligned_cols=14  Identities=21%  Similarity=0.525  Sum_probs=10.0

Q ss_pred             EEEeeeeccccccC
Q psy18230         68 EFFPVEWRSSLALD   81 (112)
Q Consensus        68 efLPI~Wr~~l~~d   81 (112)
                      .+=|+.|+......
T Consensus        24 ~~ep~i~~~~~~~g   37 (125)
T PF10137_consen   24 GLEPIIWHEQPNLG   37 (125)
T ss_pred             CCceEEeecCCCCC
Confidence            35689999888543


No 10 
>COG2840 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=35.29  E-value=34  Score=25.99  Aligned_cols=19  Identities=37%  Similarity=0.663  Sum_probs=13.4

Q ss_pred             EEEEEeCCCccCCchhHHH
Q psy18230         25 LVFVVHGMGQKMDSGRIIK   43 (112)
Q Consensus        25 LVfvVHGIGq~~~~~~iv~   43 (112)
                      =|+||||-|-..+...+++
T Consensus       127 cv~VihGkG~s~g~~~vLK  145 (184)
T COG2840         127 CVLVIHGKGRSKGSKPVLK  145 (184)
T ss_pred             EEEEEeCCCcCCCCchhHH
Confidence            3789999998555445444


No 11 
>PF01713 Smr:  Smr domain;  InterPro: IPR002625 This family includes the Smr (Small MutS Related) proteins, and the C-terminal region of the MutS2 protein. It has been suggested that this domain interacts with the MutS1 (P23909 from SWISSPROT) protein in the case of Smr proteins and with the N-terminal MutS related region of MutS2, P94545 from SWISSPROT [].; PDB: 3QD7_X 2D9I_A 3FAU_A 2VKC_A 2ZQE_A.
Probab=35.23  E-value=53  Score=20.64  Aligned_cols=15  Identities=13%  Similarity=0.333  Sum_probs=9.0

Q ss_pred             eEEEEEeCCCccCCc
Q psy18230         24 HLVFVVHGMGQKMDS   38 (112)
Q Consensus        24 HLVfvVHGIGq~~~~   38 (112)
                      .-+.||||.|.+-..
T Consensus        28 ~~~~II~G~G~hS~~   42 (83)
T PF01713_consen   28 RELRIITGKGNHSKG   42 (83)
T ss_dssp             SEEEEE--STCTCCT
T ss_pred             CEEEEEeccCCCCCC
Confidence            346799999966544


No 12 
>PRK11152 ilvM acetolactate synthase 2 regulatory subunit; Provisional
Probab=35.22  E-value=47  Score=21.46  Aligned_cols=25  Identities=12%  Similarity=0.267  Sum_probs=19.3

Q ss_pred             ccccCccC--CCCCCCCCCCeEEEEEe
Q psy18230          6 ARGYKDQA--LETDRPEDISHLVFVVH   30 (112)
Q Consensus         6 ~RG~~~~~--~~~d~~~~idHLVfvVH   30 (112)
                      +|||.-.+  ..+.+.+.+.++.++|.
T Consensus        26 rRGfnI~sl~v~~t~~~~~sriti~v~   52 (76)
T PRK11152         26 HRGFQVCSMNMTQNTDAQNINIELTVA   52 (76)
T ss_pred             cCCeeeeeEEeeecCCCCEEEEEEEEC
Confidence            69998665  34555788999999994


No 13 
>PRK04946 hypothetical protein; Provisional
Probab=35.06  E-value=22  Score=26.77  Aligned_cols=11  Identities=36%  Similarity=0.670  Sum_probs=9.1

Q ss_pred             eEEEEEeCCCc
Q psy18230         24 HLVFVVHGMGQ   34 (112)
Q Consensus        24 HLVfvVHGIGq   34 (112)
                      .-|+||||.|.
T Consensus       125 r~v~IIHGkG~  135 (181)
T PRK04946        125 FCACVMHGHGK  135 (181)
T ss_pred             CEEEEEcCCCH
Confidence            35799999995


No 14 
>COG2087 CobU Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase [Coenzyme metabolism]
Probab=32.50  E-value=5.6  Score=30.08  Aligned_cols=34  Identities=26%  Similarity=0.349  Sum_probs=19.0

Q ss_pred             eeccccCccCC--CCCCCCCCCeEEEEEeCCCccCC
Q psy18230          4 RLARGYKDQAL--ETDRPEDISHLVFVVHGMGQKMD   37 (112)
Q Consensus         4 ~l~RG~~~~~~--~~d~~~~idHLVfvVHGIGq~~~   37 (112)
                      ++.|=|.|.+-  ...-....|...|||+||..++.
T Consensus       139 ~l~R~fRD~~G~lnQ~la~~~deV~lvvaGlplklK  174 (175)
T COG2087         139 RLGRLFRDIAGRLNQQLAALADEVYLVVAGLPLKLK  174 (175)
T ss_pred             hhhHHHHHHHhHHHHHHHHhcCeEEEEEcCcccccC
Confidence            34444554431  22224556777888888877653


No 15 
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=32.06  E-value=28  Score=29.37  Aligned_cols=19  Identities=21%  Similarity=0.482  Sum_probs=17.0

Q ss_pred             chHHHHHHHhhhhhhhccc
Q psy18230         92 NVLNLRHMLNASAMDIMYY  110 (112)
Q Consensus        92 ~i~~lR~~~nd~~lDvl~Y  110 (112)
                      +.+.||.++-+.++|+||=
T Consensus       352 GARGLRsI~E~~lld~Mfe  370 (408)
T COG1219         352 GARGLRSIIEELLLDVMFE  370 (408)
T ss_pred             chhHHHHHHHHHHHHHHhh
Confidence            5699999999999999983


No 16 
>PF07521 RMMBL:  RNA-metabolising metallo-beta-lactamase;  InterPro: IPR011108 The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 from INTERPRO and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in RNA metabolism [].; PDB: 3ZQ4_D 2I7T_A 2I7V_A 2YCB_B 3BK1_A 3T3N_A 3BK2_A 3T3O_A 3AF5_A 3AF6_A ....
Probab=31.35  E-value=27  Score=19.84  Aligned_cols=8  Identities=50%  Similarity=0.862  Sum_probs=6.4

Q ss_pred             eEEEEEeC
Q psy18230         24 HLVFVVHG   31 (112)
Q Consensus        24 HLVfvVHG   31 (112)
                      .-+|+|||
T Consensus        33 ~~vilVHG   40 (43)
T PF07521_consen   33 RKVILVHG   40 (43)
T ss_dssp             SEEEEESS
T ss_pred             CEEEEecC
Confidence            56788998


No 17 
>PF12697 Abhydrolase_6:  Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A ....
Probab=28.28  E-value=1.2e+02  Score=20.30  Aligned_cols=35  Identities=17%  Similarity=0.244  Sum_probs=21.9

Q ss_pred             EEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccCCCCceEEEeeeeccc
Q psy18230         26 VFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSS   77 (112)
Q Consensus        26 VfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~~~~rvefLPI~Wr~~   77 (112)
                      |+++||.|.....         |+...+.+.        .+..++-++++..
T Consensus         1 vv~~hG~~~~~~~---------~~~~~~~l~--------~~~~v~~~d~~G~   35 (228)
T PF12697_consen    1 VVFLHGFGGSSES---------WDPLAEALA--------RGYRVIAFDLPGH   35 (228)
T ss_dssp             EEEE-STTTTGGG---------GHHHHHHHH--------TTSEEEEEECTTS
T ss_pred             eEEECCCCCCHHH---------HHHHHHHHh--------CCCEEEEEecCCc
Confidence            6899999987632         333444443        2356888888863


No 18 
>PF02230 Abhydrolase_2:  Phospholipase/Carboxylesterase;  InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases.; GO: 0016787 hydrolase activity; PDB: 3U0V_A 1AUR_A 1AUO_B 1FJ2_B 3CN9_A 3CN7_A.
Probab=28.25  E-value=47  Score=24.24  Aligned_cols=18  Identities=28%  Similarity=0.506  Sum_probs=11.8

Q ss_pred             CCCCCeEEEEEeCCCccC
Q psy18230         19 PEDISHLVFVVHGMGQKM   36 (112)
Q Consensus        19 ~~~idHLVfvVHGIGq~~   36 (112)
                      ..+-..||++.||-|+..
T Consensus        10 ~~~~~~lvi~LHG~G~~~   27 (216)
T PF02230_consen   10 KGKAKPLVILLHGYGDSE   27 (216)
T ss_dssp             SST-SEEEEEE--TTS-H
T ss_pred             CCCCceEEEEECCCCCCc
Confidence            456778999999999976


No 19 
>PF01674 Lipase_2:  Lipase (class 2);  InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids []. This group of lipases has been called class 2 as they are not clearly related to other lipase families, and includes LipA and LipB from Bacillus subtilis [] and uncharacterised proteins from Caenorhabditis.; PDB: 2VTV_B 2X76_A 2X5X_A 2QXU_A 3QMM_A 1I6W_A 3D2C_J 2QXT_B 1R50_A 1T2N_A ....
Probab=26.60  E-value=60  Score=24.87  Aligned_cols=67  Identities=19%  Similarity=0.285  Sum_probs=30.4

Q ss_pred             EEEEEeCCCccCCchhHHHHhHHHHHHHHHHHHhcccCCCCceEEEeeeeccccccCC-CccccccccchHHHHHHHhhh
Q psy18230         25 LVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDG-DIVESITQLNVLNLRHMLNAS  103 (112)
Q Consensus        25 LVfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~~~~~~~~rvefLPI~Wr~~l~~d~-~~l~~ITl~~i~~lR~~~nd~  103 (112)
                      -|..|||.+......        +......+++.-+    +.-|+....|-+.-.... .... -+-+++..||.|+..|
T Consensus         3 PVVlVHG~~~~~~~~--------w~~~~~~l~~~GY----~~~~vya~tyg~~~~~~~~~~~~-~~~~~~~~l~~fI~~V   69 (219)
T PF01674_consen    3 PVVLVHGTGGNAYSN--------WSTLAPYLKAAGY----CDSEVYALTYGSGNGSPSVQNAH-MSCESAKQLRAFIDAV   69 (219)
T ss_dssp             -EEEE--TTTTTCGG--------CCHHHHHHHHTT------CCCEEEE--S-CCHHTHHHHHH-B-HHHHHHHHHHHHHH
T ss_pred             CEEEECCCCcchhhC--------HHHHHHHHHHcCC----CcceeEeccCCCCCCCCcccccc-cchhhHHHHHHHHHHH
Confidence            488999999643321        2222233443322    334566777755443221 0111 2235678999999887


Q ss_pred             h
Q psy18230        104 A  104 (112)
Q Consensus       104 ~  104 (112)
                      +
T Consensus        70 l   70 (219)
T PF01674_consen   70 L   70 (219)
T ss_dssp             H
T ss_pred             H
Confidence            5


No 20 
>PRK12418 cysteinyl-tRNA synthetase; Provisional
Probab=24.34  E-value=67  Score=26.82  Aligned_cols=46  Identities=13%  Similarity=0.289  Sum_probs=29.0

Q ss_pred             CccCCch--hHHHHhHHHHHHHHHHHHhcccCCCCceEEEeeeeccccccCCCccc
Q psy18230         33 GQKMDSG--RIIKNATQFRESVMWLKKKYFASSKLRAEFFPVEWRSSLALDGDIVE   86 (112)
Q Consensus        33 Gq~~~~~--~iv~~~~~~r~~~~~l~~~~~~~~~~rvefLPI~Wr~~l~~d~~~l~   86 (112)
                      |++|++.  |++.-.        ++.+..+....-|.-+|..+||+.+.|..+.++
T Consensus       259 G~KMSKSlGN~i~~~--------ell~~G~d~~~lR~~lls~~yr~~l~fs~e~l~  306 (384)
T PRK12418        259 GEKMSKSRGNLVFVS--------RLRAAGVDPAAIRLALLAGHYRADREWTDAVLA  306 (384)
T ss_pred             CCcccCcCCCcCCHH--------HHHhccCChhheeEEEeccCCCCCcccCHHHHH
Confidence            8888764  554321        122221222357899999999999999866443


No 21 
>PF11798 IMS_HHH:  IMS family HHH motif;  InterPro: IPR024728 This helix-hairpin-helix motif is found in proteins belonging to the type-Y family of DNA polymerases []. This type of polymerases are thought to be involved in UV protection and mutation [, ]. ; PDB: 3PZP_B 2OH2_B 2W7O_B 3IN5_B 1T94_A 2W7P_B 2W8K_A 2AGQ_A 1RYR_A 3RAX_A ....
Probab=23.59  E-value=9.2  Score=20.68  Aligned_cols=10  Identities=30%  Similarity=0.631  Sum_probs=6.3

Q ss_pred             EeCCCccCCc
Q psy18230         29 VHGMGQKMDS   38 (112)
Q Consensus        29 VHGIGq~~~~   38 (112)
                      ++|||.+..+
T Consensus        16 ~~GIG~kt~~   25 (32)
T PF11798_consen   16 FWGIGKKTAK   25 (32)
T ss_dssp             STTS-HHHHH
T ss_pred             hCCccHHHHH
Confidence            5899987653


No 22 
>PF03944 Endotoxin_C:  delta endotoxin;  InterPro: IPR005638 This family contains insecticidal toxins produced by Bacillus species of bacteria. During spore formation the bacteria produce crystals of this protein. When an insect ingests these proteins, they are activated by proteolytic cleavage. The N terminus is cleaved in all of the proteins and a C-terminal extension is cleaved in some members. Once activated, the endotoxin binds to the gut epithelium and causes cell lysis by the formation of cation-selective channels, which leads to death. The activated region of the delta toxin is composed of three distinct structural domains: an N-terminal helical bundle domain (IPR005639 from INTERPRO) involved in membrane insertion and pore formation; a beta-sheet central domain (IPR001178 from INTERPRO) involved in receptor binding; and a C-terminal beta-sandwich domain that interacts with the N-terminal domain to form a channel [, ]. This entry represents the conserved C-terminal domain.; PDB: 1DLC_A 1JI6_A 1W99_A 1CIY_A 1I5P_A 2C9K_A 3EB7_A.
Probab=23.52  E-value=36  Score=23.99  Aligned_cols=8  Identities=50%  Similarity=1.057  Sum_probs=6.4

Q ss_pred             ceEEEeee
Q psy18230         66 RAEFFPVE   73 (112)
Q Consensus        66 rvefLPI~   73 (112)
                      |+||+||+
T Consensus       136 kIEFIPv~  143 (143)
T PF03944_consen  136 KIEFIPVN  143 (143)
T ss_dssp             EEEEEECT
T ss_pred             eEEEEeCC
Confidence            78899874


No 23 
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated
Probab=23.29  E-value=75  Score=20.58  Aligned_cols=27  Identities=19%  Similarity=0.276  Sum_probs=21.5

Q ss_pred             eccccCccC--CCCCCCCCCCeEEEEEeC
Q psy18230          5 LARGYKDQA--LETDRPEDISHLVFVVHG   31 (112)
Q Consensus         5 l~RG~~~~~--~~~d~~~~idHLVfvVHG   31 (112)
                      =+|||.-.+  ..+.+.+.+..+.+++.|
T Consensus        24 ~rRgfNI~Sl~vg~te~~~~sriti~~~~   52 (76)
T PRK06737         24 ARRGYYISSLNLNERDTSGVSEMKLTAVC   52 (76)
T ss_pred             hccCcceEEEEecccCCCCeeEEEEEEEC
Confidence            379999665  456678899999999986


No 24 
>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed
Probab=22.18  E-value=83  Score=28.60  Aligned_cols=24  Identities=33%  Similarity=0.533  Sum_probs=17.5

Q ss_pred             eEEEEEeCCCccCCchhHHHHhHHHHHHHHHHHHh
Q psy18230         24 HLVFVVHGMGQKMDSGRIIKNATQFRESVMWLKKK   58 (112)
Q Consensus        24 HLVfvVHGIGq~~~~~~iv~~~~~~r~~~~~l~~~   58 (112)
                      .-|.+|||.|.           ..+|+.+.+..++
T Consensus       734 ~~v~IIHGkGt-----------G~Lr~~v~~~L~~  757 (782)
T PRK00409        734 GEVLIIHGKGT-----------GKLRKGVQEFLKK  757 (782)
T ss_pred             CEEEEEcCCCh-----------hHHHHHHHHHHcC
Confidence            35889999995           4688888765553


No 25 
>PRK11460 putative hydrolase; Provisional
Probab=22.12  E-value=80  Score=23.60  Aligned_cols=17  Identities=24%  Similarity=0.526  Sum_probs=13.5

Q ss_pred             CCCeEEEEEeCCCccCC
Q psy18230         21 DISHLVFVVHGMGQKMD   37 (112)
Q Consensus        21 ~idHLVfvVHGIGq~~~   37 (112)
                      +-..+|++.||-|....
T Consensus        14 ~~~~~vIlLHG~G~~~~   30 (232)
T PRK11460         14 PAQQLLLLFHGVGDNPV   30 (232)
T ss_pred             CCCcEEEEEeCCCCChH
Confidence            34579999999998754


No 26 
>PF00975 Thioesterase:  Thioesterase domain;  InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics []. Thioesterases are required for the addition of the last amino acid to the peptide antibiotic, thereby forming a cyclic antibiotic. Next to the operons encoding these enzymes, in almost all cases, are genes that encode proteins that have similarity to the type II fatty acid thioesterases of vertebrates.; GO: 0016788 hydrolase activity, acting on ester bonds, 0009058 biosynthetic process; PDB: 2RON_A 2K2Q_B 3LCR_B 2HFJ_B 1MNQ_A 1MN6_B 1MNA_B 2HFK_B 2H7Y_B 2H7X_A ....
Probab=21.92  E-value=51  Score=23.64  Aligned_cols=10  Identities=20%  Similarity=0.375  Sum_probs=8.0

Q ss_pred             EEEEeCCCcc
Q psy18230         26 VFVVHGMGQK   35 (112)
Q Consensus        26 VfvVHGIGq~   35 (112)
                      |||+||+|-.
T Consensus         3 lf~~p~~gG~   12 (229)
T PF00975_consen    3 LFCFPPAGGS   12 (229)
T ss_dssp             EEEESSTTCS
T ss_pred             EEEEcCCccC
Confidence            7899998863


No 27 
>PF10503 Esterase_phd:  Esterase PHB depolymerase
Probab=21.49  E-value=61  Score=24.84  Aligned_cols=12  Identities=58%  Similarity=0.919  Sum_probs=11.1

Q ss_pred             EEEEEeCCCccC
Q psy18230         25 LVFVVHGMGQKM   36 (112)
Q Consensus        25 LVfvVHGIGq~~   36 (112)
                      ||++.||-||.-
T Consensus        18 LVv~LHG~~~~a   29 (220)
T PF10503_consen   18 LVVVLHGCGQSA   29 (220)
T ss_pred             EEEEeCCCCCCH
Confidence            999999999975


No 28 
>smart00463 SMR Small MutS-related domain.
Probab=21.20  E-value=70  Score=19.90  Aligned_cols=14  Identities=14%  Similarity=0.368  Sum_probs=11.6

Q ss_pred             eEEEEEeCCCccCC
Q psy18230         24 HLVFVVHGMGQKMD   37 (112)
Q Consensus        24 HLVfvVHGIGq~~~   37 (112)
                      ..+.||||-|..-.
T Consensus        32 ~~~~II~G~G~~s~   45 (80)
T smart00463       32 QKLVIITGKGKHSL   45 (80)
T ss_pred             ceEEEEEcccCCCc
Confidence            67999999997643


No 29 
>KOG2541|consensus
Probab=21.19  E-value=1.1e+02  Score=24.97  Aligned_cols=13  Identities=46%  Similarity=0.761  Sum_probs=11.3

Q ss_pred             EEEEeCCCccCCc
Q psy18230         26 VFVVHGMGQKMDS   38 (112)
Q Consensus        26 VfvVHGIGq~~~~   38 (112)
                      +.+.||||-.|..
T Consensus        26 ~ii~HGigd~c~~   38 (296)
T KOG2541|consen   26 VIVWHGIGDSCSS   38 (296)
T ss_pred             EEEEeccCccccc
Confidence            6789999999875


No 30 
>PF09600 Cyd_oper_YbgE:  Cyd operon protein YbgE (Cyd_oper_YbgE);  InterPro: IPR011846  This entry describes a small protein of unknown function, about 100 amino acids in length, essentially always found in an operon with CydAB, subunits of the cytochrome d terminal oxidase. It appears to be an integral membrane protein. It is found so far only in the Proteobacteria [].
Probab=21.08  E-value=27  Score=23.10  Aligned_cols=10  Identities=30%  Similarity=0.461  Sum_probs=7.3

Q ss_pred             EEEeCCCccC
Q psy18230         27 FVVHGMGQKM   36 (112)
Q Consensus        27 fvVHGIGq~~   36 (112)
                      .+|||+|=+-
T Consensus        46 ~~IhGvGF~P   55 (82)
T PF09600_consen   46 GWIHGVGFRP   55 (82)
T ss_pred             HHhhccccch
Confidence            3689999654


No 31 
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH. This CoA-binding enzyme is required for the production of pimeloyl-coenzyme A, the substrate of the BioF protein early in the biosynthesis of biotin. Its exact function is unknown, but is proposed in ref 2. This enzyme belongs to the alpha/beta hydrolase fold family (pfam model pfam00561). Members of this family are restricted to the Proteobacteria.
Probab=20.39  E-value=68  Score=22.14  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=10.6

Q ss_pred             EEEEEeCCCccCC
Q psy18230         25 LVFVVHGMGQKMD   37 (112)
Q Consensus        25 LVfvVHGIGq~~~   37 (112)
                      .|+++||.|....
T Consensus         6 ~iv~~HG~~~~~~   18 (245)
T TIGR01738         6 HLVLIHGWGMNAE   18 (245)
T ss_pred             eEEEEcCCCCchh
Confidence            5899999988754


No 32 
>COG2088 SpoVG Uncharacterized protein, involved in the regulation of septum location [Cell envelope biogenesis, outer membrane]
Probab=20.39  E-value=51  Score=22.50  Aligned_cols=29  Identities=28%  Similarity=0.345  Sum_probs=17.7

Q ss_pred             EEEEeCC----CccC-------------CchhHHH-HhHHHHHHHHH
Q psy18230         26 VFVVHGM----GQKM-------------DSGRIIK-NATQFRESVMW   54 (112)
Q Consensus        26 VfvVHGI----Gq~~-------------~~~~iv~-~~~~~r~~~~~   54 (112)
                      .||||||    |++.             +.+.|++ .+..+|+..+.
T Consensus        28 efVvhdirVi~G~~GlfVAMPSrrt~dgEFrDI~HPI~~~~R~kIq~   74 (95)
T COG2088          28 EFVVHDIRVIEGNNGLFVAMPSRRTPDGEFRDIAHPINSDTREKIQD   74 (95)
T ss_pred             eEEEeccEEEeCCcceEEEccCccCCCcchhhccCcCCHHHHHHHHH
Confidence            5999999    5541             1124555 34777777654


Done!