Diaphorina citri psyllid: psy1826


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSLAQISWVRHRDIHLLTVSGYTYTSDQRFSCIHKPQNEDWTLQIKYPQKRDSGIYECQVSTTPPIGISMYLSVVEPITQIIGGPDMYINKGSTMNLTCVIKHSPEPPPAIYWLHNTEVSQLNLMQRESESSSFVKRLVVLLSVSIVELTWKLEATYILAGTYTNSFNL
ccccEEEEEEccccEEEEECcEEECccccEEEEEccccccEEEEEccccccccCEEEEEEccccccEEEEEEEEcccEEEEcccccEEECccccEEEEEEEECccccccEEEEEEccEEEccccccccEEEEEEEEEEEEEEEEEEEEEEEEEccEEcccccccccccc
*SLAQISWVRHRDIHLLTVSGYTYTSDQRFSCIHKPQNEDWTLQIKYPQKRDSGIYECQVSTTPPIGISMYLSVVEPITQIIGGPDMYINKGSTMNLTCVIKHSPEPPPAIYWLHNTEVSQLNL*********FVKRLVVLLSVSIVELTWKLEATYILAGTYTN****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLAQISWVRHRDIHLLTVSGYTYTSDQRFSCIHKPQNEDWTLQIKYPQKRDSGIYECQVSTTPPIGISMYLSVVEPITQIIGGPDMYINKGSTMNLTCVIKHSPEPPPAIYWLHNTEVSQLNLMQRESESSSFVKRLVVLLSVSIVELTWKLEATYILAGTYTNSFNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0048149 [BP]behavioral response to ethanolprobableGO:1901700, GO:0030534, GO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0007610, GO:0045471, GO:0008150, GO:0042221, GO:0097305, GO:0010033, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DMK, chain A
Confidence level:very confident
Coverage over the Query: 4-123
View the alignment between query and template
View the model in PyMOL
Template: 3B43, chain A
Confidence level:very confident
Coverage over the Query: 4-161
View the alignment between query and template
View the model in PyMOL