BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy1833
(105 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1VR0|A Chain A, Crystal Structure Of Putative 2-Phosphosulfolactate
Phosphatase (15026306) From Clostridium Acetobutylicum
At 2.6 A Resolution
pdb|1VR0|B Chain B, Crystal Structure Of Putative 2-Phosphosulfolactate
Phosphatase (15026306) From Clostridium Acetobutylicum
At 2.6 A Resolution
pdb|1VR0|C Chain C, Crystal Structure Of Putative 2-Phosphosulfolactate
Phosphatase (15026306) From Clostridium Acetobutylicum
At 2.6 A Resolution
Length = 247
Score = 25.8 bits (55), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 12/33 (36%), Positives = 19/33 (57%)
Query: 55 PYLTEEEELVHLKDLDRNENFRRERRALKLQKF 87
P LT EE L +K+ ++ ER+ LK++ F
Sbjct: 59 PVLTVEEALKKVKEYGKDAILGGERKGLKIEGF 91
>pdb|3AYH|A Chain A, Crystal Structure Of The C1725 SUBCOMPLEX FROM S. POMBE
RNA Polymerase Iii
Length = 136
Score = 25.8 bits (55), Expect = 6.8, Method: Compositional matrix adjust.
Identities = 11/29 (37%), Positives = 16/29 (55%)
Query: 53 RHPYLTEEEELVHLKDLDRNENFRRERRA 81
R YLT E HLK+++ +N R + R
Sbjct: 14 RDAYLTNAEVFFHLKEMENEQNARTQERG 42
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.143 0.419
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,755,140
Number of Sequences: 62578
Number of extensions: 82128
Number of successful extensions: 233
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 232
Number of HSP's gapped (non-prelim): 2
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)