Query         psy1838
Match_columns 80
No_of_seqs    45 out of 47
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 17:38:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1838.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1838hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG4489|consensus              100.0 2.4E-42 5.1E-47  231.0   7.5   79    1-80      1-79  (87)
  2 PF06726 BC10:  Bladder cancer- 100.0 3.2E-29   7E-34  159.1   3.0   65    1-65      1-65  (65)
  3 PF11833 DUF3353:  Protein of u  49.1      18  0.0004   26.6   2.7   34    5-38    161-194 (194)
  4 PF01623 Carla_C4:  Carlavirus   41.3      14  0.0003   25.2   0.9   15   66-80     66-80  (91)
  5 smart00274 FOLN Follistatin-N-  30.9      28 0.00062   18.4   0.9   10   71-80      1-10  (26)
  6 KOG2771|consensus               25.4      28 0.00061   28.6   0.5   17   35-51    275-291 (344)
  7 TIGR03063 srtB_target sortase   23.1 1.2E+02  0.0025   16.8   2.5   10   26-35     11-20  (29)
  8 PF15322 PMSI1:  Protein missin  20.2      37 0.00081   27.7   0.2   32   38-77    221-252 (311)
  9 COG1862 YajC Preprotein transl  19.2      97  0.0021   20.9   2.0   19   24-42     11-29  (97)
 10 PF02132 RecR:  RecR protein;    18.8      62  0.0013   18.1   0.9    9   39-47     28-36  (41)

No 1  
>KOG4489|consensus
Probab=100.00  E-value=2.4e-42  Score=231.03  Aligned_cols=79  Identities=71%  Similarity=1.382  Sum_probs=77.8

Q ss_pred             CchhhhhhhhhhccCCCCchhhhhHHHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHhhcCCCceeeecCCccceeccCC
Q psy1838           1 MYCLQWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFLERKPCTICSLVFIIAVFLICYSGIGNCLFWSNNCDTVQCENG   80 (80)
Q Consensus         1 MyCLrw~LPlLliP~pasPa~~~~~~~Fi~Lfli~~~l~~RPC~yCSlll~~l~~~~C~s~~~~C~f~~~~c~~~~~~~~   80 (80)
                      ||||||+||+|+||||.||+++.+|+|||++|++|||+|||||++||++|++++.++|||++|||+||+ +|+++.+|+|
T Consensus         1 MYCLQwLlPVLLIPKp~nPal~~~h~mFm~fYlvgFfLERkPCtICslvFl~AlsLiCYS~~gnCifw~-~c~~~l~e~~   79 (87)
T KOG4489|consen    1 MYCLQWLLPVLLIPKPINPALLVEHAMFMWFYLVGFFLERKPCTICSLVFLIALSLICYSDPGNCIFWP-TCTKKLNEEV   79 (87)
T ss_pred             CchHHhhhhheecCCCCChHHHHHHHHHHHHHHHHHHhccCCceehHHHHHHHHHHHhhcCCCCEEEec-CCCCCCCccc
Confidence            999999999999999999999999999999999999999999999999999999999999999999999 9999999875


No 2  
>PF06726 BC10:  Bladder cancer-related protein BC10;  InterPro: IPR018015 This family consists of a series of short proteins of around 90 residues in length. The human protein O60629 from SWISSPROT (or BC10) has been implicated in bladder cancer where the transcription of the gene coding for this protein is nearly completely abolished in highly invasive transitional cell carcinomas (TCCs) []. The protein is a small globular protein containing two transmembrane helices, and it is a multiply edited transcript. All the editing sites are found in either the 5'-UTR or the N-terminal section of the protein, which is predicted to be outside the membrane. The three coding edits are all non-synonymous and predicted to encode exposed residues []. The function of this family is unknown.
Probab=99.95  E-value=3.2e-29  Score=159.07  Aligned_cols=65  Identities=54%  Similarity=1.133  Sum_probs=64.1

Q ss_pred             CchhhhhhhhhhccCCCCchhhhhHHHHHHHHHHHHHHhcCCchHHHHHHHHHHHHHhhcCCCce
Q psy1838           1 MYCLQWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFLERKPCTICSLVFIIAVFLICYSGIGNC   65 (80)
Q Consensus         1 MyCLrw~LPlLliP~pasPa~~~~~~~Fi~Lfli~~~l~~RPC~yCSlll~~l~~~~C~s~~~~C   65 (80)
                      ||||||++|++++|+|+||+++++|++|+++|++|+++|+|||+|||+++.+++.++|+++|++|
T Consensus         1 M~cL~~~~p~l~~p~~~~~~~~~a~~~f~~l~lig~~~~~~Pc~~c~i~~~~~~~a~~~~~~~~~   65 (65)
T PF06726_consen    1 MYCLHWNLPLLLFPKPANRALVNASPMFIVLFLIGFFLERRPCVHCSITFGAFFFAICRPNWSNC   65 (65)
T ss_pred             CceeeecccceeeecCCCchhhhcccHHHHHHHHHHHHhhCCceeehHHHHHHHHHhcCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999987


No 3  
>PF11833 DUF3353:  Protein of unknown function (DUF3353);  InterPro: IPR021788  This family of proteins are functionally uncharacterised. This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 205 to 258 amino acids in length. 
Probab=49.07  E-value=18  Score=26.62  Aligned_cols=34  Identities=29%  Similarity=0.670  Sum_probs=28.2

Q ss_pred             hhhhhhhhccCCCCchhhhhHHHHHHHHHHHHHH
Q psy1838           5 QWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFL   38 (80)
Q Consensus         5 rw~LPlLliP~pasPa~~~~~~~Fi~Lfli~~~l   38 (80)
                      .-|+|...+|-+.+|.....=+.|++|++++.|+
T Consensus       161 ~~~l~~~~~p~~~s~~~~~sl~~~i~lwl~s~fL  194 (194)
T PF11833_consen  161 ASWLPVDIVPGPWSPEQLVSLFTYILLWLVSLFL  194 (194)
T ss_pred             HhhcccccCCCCCCHHHHHHHHHHHHHHHHHhcC
Confidence            3466777778779999999999999999999875


No 4  
>PF01623 Carla_C4:  Carlavirus putative nucleic acid binding protein;  InterPro: IPR002568 This family of carlavirus nucleic acid binding proteins includes a motif for a potential C-4 type zinc finger this has four highly conserved cysteine residues and is a conserved feature of the carlaviruses 3' terminal ORF []. These proteins may function as viral transcriptional regulators. The carlavirus family includes Garlic latent virus and Potato virus S and Potato virus M, these viruses are positive strand, ssRNA with no DNA stage.; GO: 0003676 nucleic acid binding, 0006355 regulation of transcription, DNA-dependent
Probab=41.35  E-value=14  Score=25.18  Aligned_cols=15  Identities=27%  Similarity=0.968  Sum_probs=11.8

Q ss_pred             eeecCCccceeccCC
Q psy1838          66 LFWSNNCDTVQCENG   80 (80)
Q Consensus        66 ~f~~~~c~~~~~~~~   80 (80)
                      |...+.||+++|-+|
T Consensus        66 f~~t~rCDnkTC~PG   80 (91)
T PF01623_consen   66 FYFTKRCDNKTCVPG   80 (91)
T ss_pred             ceeCccCCCCcccCC
Confidence            344669999999887


No 5  
>smart00274 FOLN Follistatin-N-terminal domain-like. Follistatin-N-terminal domain-like, EGF-like. Region distinct from the kazal-like sequence
Probab=30.93  E-value=28  Score=18.40  Aligned_cols=10  Identities=50%  Similarity=1.105  Sum_probs=7.8

Q ss_pred             CccceeccCC
Q psy1838          71 NCDTVQCENG   80 (80)
Q Consensus        71 ~c~~~~~~~~   80 (80)
                      +|++++|..|
T Consensus         1 ~C~~v~C~~G   10 (26)
T smart00274        1 SCRNVQCPFG   10 (26)
T ss_pred             CCCCEECCCC
Confidence            4888888776


No 6  
>KOG2771|consensus
Probab=25.44  E-value=28  Score=28.59  Aligned_cols=17  Identities=29%  Similarity=1.022  Sum_probs=13.9

Q ss_pred             HHHHhcCCchHHHHHHH
Q psy1838          35 GFFLERKPCTICSLVFI   51 (80)
Q Consensus        35 ~~~l~~RPC~yCSlll~   51 (80)
                      =.|+.|.||..||.-|+
T Consensus       275 dv~ll~EPC~MCsMALv  291 (344)
T KOG2771|consen  275 DVYLLHEPCAMCSMALV  291 (344)
T ss_pred             eEEEecChHHHHHHHHH
Confidence            45889999999997664


No 7  
>TIGR03063 srtB_target sortase B cell surface sorting signal. Two different classes of sorting signal, both analogous to the sortase A signal LPXTG, may be recognized by the sortase SrtB. These are given as NXZTN and NPKXZ. Proteins sorted by this class of sortase are less common than the sortase A and LPXTG system. This model describes a number of cell surface protein C-terminal regions from Gram-positive bacteria that appear to be sortase B (SrtB) sorting signals.
Probab=23.14  E-value=1.2e+02  Score=16.81  Aligned_cols=10  Identities=30%  Similarity=0.657  Sum_probs=6.9

Q ss_pred             HHHHHHHHHH
Q psy1838          26 VMFMVLYLTG   35 (80)
Q Consensus        26 ~~Fi~Lfli~   35 (80)
                      .+|+++++.+
T Consensus        11 ~ly~~l~~~s   20 (29)
T TIGR03063        11 GLYAVLFLGS   20 (29)
T ss_pred             HHHHHHHHHH
Confidence            3577777775


No 8  
>PF15322 PMSI1:  Protein missing in infertile sperm 1, putative
Probab=20.17  E-value=37  Score=27.68  Aligned_cols=32  Identities=28%  Similarity=0.580  Sum_probs=18.8

Q ss_pred             HhcCCchHHHHHHHHHHHHHhhcCCCceeeecCCccceec
Q psy1838          38 LERKPCTICSLVFIIAVFLICYSGIGNCLFWSNNCDTVQC   77 (80)
Q Consensus        38 l~~RPC~yCSlll~~l~~~~C~s~~~~C~f~~~~c~~~~~   77 (80)
                      -|||||+|=-        -.|+--...|-.-+.-|....|
T Consensus       221 TehrPCtY~~--------C~Cnr~~eECPLD~~lc~d~sc  252 (311)
T PF15322_consen  221 TEHRPCTYQQ--------CPCNREREECPLDSSLCPDTSC  252 (311)
T ss_pred             hccCCccccc--------CCcccccccCCCCCCCCCCccc
Confidence            5899999921        1244434557666656665554


No 9  
>COG1862 YajC Preprotein translocase subunit YajC [Intracellular trafficking and secretion]
Probab=19.17  E-value=97  Score=20.91  Aligned_cols=19  Identities=16%  Similarity=0.418  Sum_probs=12.5

Q ss_pred             hHHHHHHHHHHHHHHhcCC
Q psy1838          24 THVMFMVLYLTGFFLERKP   42 (80)
Q Consensus        24 ~~~~Fi~Lfli~~~l~~RP   42 (80)
                      .=.++++++.+-+|+..||
T Consensus        11 ~ll~~vl~~~ifyFli~RP   29 (97)
T COG1862          11 LLLPLVLIFAIFYFLIIRP   29 (97)
T ss_pred             HHHHHHHHHHHHHHhhcCH
Confidence            3455666666666668887


No 10 
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=18.81  E-value=62  Score=18.08  Aligned_cols=9  Identities=67%  Similarity=1.523  Sum_probs=0.0

Q ss_pred             hcCCchHHH
Q psy1838          39 ERKPCTICS   47 (80)
Q Consensus        39 ~~RPC~yCS   47 (80)
                      +..||.+|+
T Consensus        28 e~~~C~IC~   36 (41)
T PF02132_consen   28 EEDPCEICS   36 (41)
T ss_dssp             SSSS-HHHH
T ss_pred             CCCcCcCCC


Done!