Diaphorina citri psyllid: psy1838


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MYCLQWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFLERKPCTICSLVFIIAVFLICYSGIGNCLFWSNNCDTVQCENG
ccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccEEEEcccccccccccc
MYCLQWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFLERKPCTICSLVFIIAVFLICYSGIGNCLFWSNNCDTVQ****
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYCLQWLIPVLLIPKPLNPALLQTHVMFMVLYLTGFFLERKPCTICSLVFIIAVFLICYSGIGNCLFWSNNCDTVQCENG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bladder cancer-associated protein May regulate cell proliferation and coordinate apoptosis and cell cycle progression via a novel mechanism independent of both p53/TP53 and NF-kappa-B.very confidentQ5R692
Bladder cancer-associated protein May regulate cell proliferation and coordinate apoptosis and cell cycle progression via a novel mechanism independent of both p53/TP53 and nuclear factor kappa B (NF-kappaB).very confidentP62954
Bladder cancer-associated protein very confidentQ5M8I8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006915 [BP]apoptotic processconfidentGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted