Diaphorina citri psyllid: psy185


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MGGRALPRQTHWEDQLLSSSSIPLLWAGEPYRGKPIGKINSYHHQVGGEVYAVNEYTLLLSQFNYDGLGVDTFFWAGTSPRPGPQGFLVTDEHGK
ccccccccHHHHHHHHHHcccccccccccccccCEccccccccccccCEEEEEEccEEEEEcEECccccccEEEEEccccccccccEEccccccc
**********HWEDQLLSSSSIPLLWAGEPYRGKPIGKINSYHHQVGGEVYAVNEYTLLLSQFNYDGLGVDTFFWAGTSPRPGPQGF*VT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGRALPRQTHWEDQLLSSSSIPLLWAGEPYRGKPIGKINSYHHQVGGEVYAVNEYTLLLSQFNYDGLGVDTFFWAGTSPRPGPQGFLVTDEHGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007362 [BP]terminal region determinationprobableGO:0032502, GO:0007389, GO:0032501, GO:0009880, GO:0044707, GO:0009790, GO:0009948, GO:0048856, GO:0044767, GO:0008595, GO:0009952, GO:0008150, GO:0003002, GO:0000578, GO:0035282, GO:0009798, GO:0007351, GO:0007350, GO:0007275, GO:0044699, GO:0007354
GO:0008362 [BP]chitin-based embryonic cuticle biosynthetic processprobableGO:0032502, GO:0040003, GO:0042335, GO:0044707, GO:0048856, GO:0044767, GO:0032501, GO:0008150, GO:0007275, GO:0044699
GO:0035158 [BP]regulation of tube diameter, open tracheal systemprobableGO:0035150, GO:0035151, GO:0035152, GO:0032501, GO:0044707, GO:0007424, GO:0060541, GO:0048856, GO:0090066, GO:0008150, GO:0065007, GO:0048731, GO:0035296, GO:0065008, GO:0032502, GO:0007275, GO:0044699
GO:0060439 [BP]trachea morphogenesisprobableGO:0060541, GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0060438, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0006035 [BP]cuticle chitin biosynthetic processprobableGO:0046349, GO:0006807, GO:0007275, GO:0044699, GO:0040003, GO:0044710, GO:0042335, GO:0071704, GO:0006031, GO:0006030, GO:0006034, GO:0032502, GO:0032501, GO:1901576, GO:0044767, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0006023, GO:1901564, GO:1901566, GO:0044707, GO:1901137, GO:1901135, GO:0048856, GO:0043170, GO:0006040, GO:0006022, GO:1901073, GO:1901071
GO:0001838 [BP]embryonic epithelial tube formationprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0060562, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856
GO:0008293 [BP]torso signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted