Diaphorina citri psyllid: psy1865


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MDKNLRLKYEPCEQDTLQFQLKIKCTKSASFSHSSHADDMYEKHKVFTKDIQWVPIGSQGDMYKSSDVGPIHDDILIAKLRPGHEIDVTMFAVKSIGRDHAKFSPVATAFYRLLPKITLTQEIEGEMAQRLQTMFSPGVISIEKKPNAGVVA
cccccccccccccccEEEEEEEEEEcccccccccccccccccccEEECcccEEEEccccccccccccccccccccEEEEcccccEEEEEEEEEEccccccccccccEEEEEEEEEEEEEcccccHHHHHHHHHHcccccEEEEcccccEEEc
******L*YEPCEQDTLQFQLKIKCTKSASFSHSSHADDMYEKHKVFTKDIQWVPIGSQGDMYKSSDVGPIHDDILIAKLRPGHEIDVTMFAVKSIGRDHAKFSPVATAFYRLLPKITLTQEIEGEMAQRLQTMFSPGVISIEKKP******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDKNLRLKYEPCEQDTLQFQLKIKCTKSASFSHSSHADDMYEKHKVFTKDIQWVPIGSQGDMYKSSDVGPIHDDILIAKLRPGHEIDVTMFAVKSIGRDHAKFSPVATAFYRLLPKITLTQEIEGEMAQRLQTMFSPGVISIEKKPNAGVVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentQ32L22
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentP52432
DNA-directed RNA polymerases I and III subunit RPAC1 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft.confidentO15160

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain C
Confidence level:very confident
Coverage over the Query: 8-29,43-142
View the alignment between query and template
View the model in PyMOL