BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy1866
(235 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DF4|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab
Complexed With Mn2+
pdb|2DQN|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab
Complexed With Asn
pdb|2F2A|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab
Complexed With Gln
pdb|2G5H|B Chain B, Structure Of Trna-Dependent Amidotransferase Gatcab
pdb|2G5I|B Chain B, Structure Of Trna-dependent Amidotransferase Gatcab
Complexed With Adp-alf4
pdb|3IP4|B Chain B, The High Resolution Structure Of Gatcab
Length = 483
Score = 30.4 bits (67), Expect = 0.79, Method: Compositional matrix adjust.
Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 2/55 (3%)
Query: 178 RALPHLEPKAQNSKKKICKDLEAVFQMSDEAVILKVKDNVHDSNLERITNKKYGR 232
+ P L K N+K+ I +D + Q+SDEA +LK + D+N + + + K G+
Sbjct: 388 KVFPELAAKGGNAKQ-IMED-NGLVQISDEATLLKFVNEALDNNEQSVEDYKNGK 440
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.364
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,549,792
Number of Sequences: 62578
Number of extensions: 176186
Number of successful extensions: 465
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 464
Number of HSP's gapped (non-prelim): 2
length of query: 235
length of database: 14,973,337
effective HSP length: 96
effective length of query: 139
effective length of database: 8,965,849
effective search space: 1246253011
effective search space used: 1246253011
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)