BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy1883
MGPRKKELSTYYLLNYLEAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKSRLFQAL
LGQLGGAIGISVLGIFKIWDL

High Scoring Gene Products

Symbol, full name Information P value
dlg1
discs large 1
protein from Drosophila melanogaster 6.3e-10
DLG1
Disks large homolog 1
protein from Homo sapiens 6.1e-07
DLG1
Disks large homolog 1
protein from Homo sapiens 6.1e-07
DLG1
Disks large homolog 1
protein from Homo sapiens 6.1e-07
DLG1
Disks large homolog 1
protein from Homo sapiens 9.7e-07
DLG1
Disks large homolog 1
protein from Homo sapiens 1.4e-05
Dlg1
discs, large homolog 1 (Drosophila)
protein from Mus musculus 1.4e-05
Dlg1
discs, large homolog 1 (Drosophila)
gene from Rattus norvegicus 1.8e-05
dlg1
discs, large (Drosophila) homolog 1
gene_product from Danio rerio 7.7e-05
dlg1l
discs, large (Drosophila) homolog 1, like
gene_product from Danio rerio 0.00013
DLG1
Disks large homolog 1
protein from Homo sapiens 0.00017

The BLAST search returned 1 gene product which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy1883
        (81 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

FB|FBgn0001624 - symbol:dlg1 "discs large 1" species:7227...   155  6.3e-10   1
UNIPROTKB|C9JN61 - symbol:DLG1 "Disks large homolog 1" sp...   114  6.1e-07   1
UNIPROTKB|C9JUA9 - symbol:DLG1 "Disks large homolog 1" sp...   114  6.1e-07   1
UNIPROTKB|F2Z2L0 - symbol:DLG1 "Disks large homolog 1" sp...   114  6.1e-07   1
UNIPROTKB|A8MUT6 - symbol:DLG1 "Disks large homolog 1" sp...   114  9.7e-07   1
UNIPROTKB|Q12959 - symbol:DLG1 "Disks large homolog 1" sp...   114  1.4e-05   1
MGI|MGI:107231 - symbol:Dlg1 "discs, large homolog 1 (Dro...   114  1.4e-05   1
RGD|2505 - symbol:Dlg1 "discs, large homolog 1 (Drosophil...   113  1.8e-05   1
ZFIN|ZDB-GENE-010724-8 - symbol:dlg1 "discs, large (Droso...   107  7.7e-05   1
UNIPROTKB|E1BT38 - symbol:DLG1 "Uncharacterized protein" ...   106  0.00010   1
ZFIN|ZDB-GENE-050222-3 - symbol:dlg1l "discs, large (Dros...   105  0.00013   1
UNIPROTKB|C9J110 - symbol:DLG1 "Disks large homolog 1" sp...    91  0.00017   1


>FB|FBgn0001624 [details] [associations]
            symbol:dlg1 "discs large 1" species:7227 "Drosophila
            melanogaster" [GO:0005886 "plasma membrane" evidence=IDA;IMP;NAS]
            [GO:0005918 "septate junction" evidence=NAS;TAS] [GO:0007391
            "dorsal closure" evidence=NAS;TAS] [GO:0008104 "protein
            localization" evidence=IMP;TAS] [GO:0007268 "synaptic transmission"
            evidence=IMP] [GO:0004385 "guanylate kinase activity" evidence=TAS]
            [GO:0016020 "membrane" evidence=TAS] [GO:0005856 "cytoskeleton"
            evidence=NAS] [GO:0016334 "establishment or maintenance of polarity
            of follicular epithelium" evidence=IGI] [GO:0016327 "apicolateral
            plasma membrane" evidence=IDA] [GO:0008283 "cell proliferation"
            evidence=TAS] [GO:0016335 "morphogenesis of larval imaginal disc
            epithelium" evidence=TAS] [GO:0016336 "establishment or maintenance
            of polarity of larval imaginal disc epithelium" evidence=NAS;TAS]
            [GO:0016333 "morphogenesis of follicular epithelium" evidence=IMP]
            [GO:0030710 "regulation of border follicle cell delamination"
            evidence=TAS] [GO:0005938 "cell cortex" evidence=IDA] [GO:0016332
            "establishment or maintenance of polarity of embryonic epithelium"
            evidence=TAS] [GO:0008105 "asymmetric protein localization"
            evidence=IMP;TAS] [GO:0007399 "nervous system development"
            evidence=IMP] [GO:0045175 "basal protein localization"
            evidence=NAS;IMP] [GO:0045179 "apical cortex" evidence=IDA]
            [GO:0005198 "structural molecule activity" evidence=TAS]
            [GO:0045196 "establishment or maintenance of neuroblast polarity"
            evidence=TAS] [GO:0045197 "establishment or maintenance of
            epithelial cell apical/basal polarity" evidence=NAS;TAS]
            [GO:0002009 "morphogenesis of an epithelium" evidence=TAS]
            [GO:0043195 "terminal bouton" evidence=IDA] [GO:0005515 "protein
            binding" evidence=IPI] [GO:0042734 "presynaptic membrane"
            evidence=IDA] [GO:0019991 "septate junction assembly" evidence=TAS]
            [GO:0042127 "regulation of cell proliferation" evidence=TAS]
            [GO:0007010 "cytoskeleton organization" evidence=NAS] [GO:0051726
            "regulation of cell cycle" evidence=NAS] [GO:0005154 "epidermal
            growth factor receptor binding" evidence=TAS] [GO:0008285 "negative
            regulation of cell proliferation" evidence=TAS] [GO:0001738
            "morphogenesis of a polarized epithelium" evidence=TAS] [GO:0016323
            "basolateral plasma membrane" evidence=TAS] [GO:0045202 "synapse"
            evidence=IDA;TAS] [GO:0045167 "asymmetric protein localization
            involved in cell fate determination" evidence=TAS] [GO:0045211
            "postsynaptic membrane" evidence=IDA] [GO:0051294 "establishment of
            spindle orientation" evidence=IMP] [GO:0051124 "synaptic growth at
            neuromuscular junction" evidence=IMP] [GO:0031594 "neuromuscular
            junction" evidence=IDA] [GO:0008049 "male courtship behavior"
            evidence=IMP] [GO:0045475 "locomotor rhythm" evidence=IMP]
            [GO:0007617 "mating behavior" evidence=IMP] [GO:0046956 "positive
            phototaxis" evidence=IMP] [GO:0016328 "lateral plasma membrane"
            evidence=IDA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IDA] [GO:0005920 "smooth septate junction" evidence=IDA]
            Pfam:PF00018 Pfam:PF00595 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR004172 InterPro:IPR008144 InterPro:IPR008145
            Pfam:PF00625 PROSITE:PS50002 PROSITE:PS50052 PROSITE:PS50106
            PROSITE:PS51022 SMART:SM00072 SMART:SM00228 SMART:SM00326
            SMART:SM00569 GO:GO:0045167 GO:GO:0001708 GO:GO:0048471
            GO:GO:0008285 GO:GO:0005856 GO:GO:0005198 GO:GO:0005918
            GO:GO:0007391 GO:GO:0019991 GO:GO:0007268 GO:GO:0045211
            EMBL:AE014298 GO:GO:0031594 GO:GO:0051124 GO:GO:0007155
            GO:GO:0016323 GO:GO:0043195 GO:GO:0000122 SUPFAM:SSF50044
            GO:GO:0051726 GO:GO:0045179 GO:GO:0004871 GO:GO:0005154
            GO:GO:0045475 GO:GO:0008049 SUPFAM:SSF50156 GO:GO:0001738
            GO:GO:0016328 GO:GO:0046956 GO:GO:0007318 GO:GO:0060581
            GO:GO:0016327 GO:GO:0042058 GO:GO:0004385 PROSITE:PS00856
            GO:GO:0045197 GO:GO:0051294 GO:GO:0016332
            GeneTree:ENSGT00560000077048 InterPro:IPR020590 GO:GO:0008593
            EMBL:M73529 EMBL:AY332243 EMBL:AY059433 EMBL:AY069408 EMBL:AY075410
            EMBL:BT099726 PIR:A39651 RefSeq:NP_001096955.1
            RefSeq:NP_001096956.1 RefSeq:NP_001162719.1 RefSeq:NP_001245623.1
            RefSeq:NP_511120.2 RefSeq:NP_727518.1 RefSeq:NP_727519.1
            RefSeq:NP_727520.1 RefSeq:NP_996402.1 RefSeq:NP_996403.1
            RefSeq:NP_996404.1 RefSeq:NP_996405.1 RefSeq:NP_996406.1
            RefSeq:NP_996407.1 UniGene:Dm.4352 PDB:3TVT PDBsum:3TVT
            ProteinModelPortal:P31007 SMR:P31007 IntAct:P31007 MINT:MINT-287852
            STRING:P31007 PaxDb:P31007 EnsemblMetazoa:FBtr0073488 GeneID:32083
            KEGG:dme:Dmel_CG1725 CTD:1739 FlyBase:FBgn0001624 eggNOG:COG0194
            InParanoid:P31007 KO:K12075 OMA:WNRRITE OrthoDB:EOG4X0K7Q
            ChiTaRS:dlg1 GenomeRNAi:32083 NextBio:776723 Bgee:P31007
            GermOnline:CG1725 GO:GO:0030714 GO:GO:0045175 GO:GO:0045196
            GO:GO:0016336 GO:GO:0030710 GO:GO:0046425 InterPro:IPR015143
            Pfam:PF09058 Uniprot:P31007
        Length = 970

 Score = 155 (59.6 bits), Expect = 6.3e-10, P = 6.3e-10
 Identities = 30/38 (78%), Positives = 35/38 (92%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKSR 55
             EAHRALELLEDYH++L++P D+ LR AIERVIRIFKSR
Sbjct:     7 EAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSR 44


>UNIPROTKB|C9JN61 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0008104 "protein localization" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0014069 "postsynaptic density" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0031253 "cell projection
            membrane" evidence=IEA] [GO:0031579 "membrane raft organization"
            evidence=IEA] [GO:0031594 "neuromuscular junction" evidence=IEA]
            [GO:0032147 "activation of protein kinase activity" evidence=IEA]
            [GO:0032947 "protein complex scaffold" evidence=IEA] [GO:0033268
            "node of Ranvier" evidence=IEA] [GO:0035748 "myelin sheath abaxonal
            region" evidence=IEA] [GO:0042110 "T cell activation" evidence=IEA]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IEA] [GO:0042391 "regulation of membrane potential"
            evidence=IEA] [GO:0042982 "amyloid precursor protein metabolic
            process" evidence=IEA] [GO:0043219 "lateral loop" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608 "reproductive
            structure development" evidence=IEA] [GO:0048704 "embryonic
            skeletal system morphogenesis" evidence=IEA] [GO:0048745 "smooth
            muscle tissue development" evidence=IEA] [GO:0050680 "negative
            regulation of epithelial cell proliferation" evidence=IEA]
            [GO:0060022 "hard palate development" evidence=IEA]
            InterPro:IPR004172 PROSITE:PS51022 SMART:SM00569 GO:GO:0014069
            GO:GO:0008104 GO:GO:0042130 GO:GO:0008284 GO:GO:0031594
            GO:GO:0045121 GO:GO:0042391 GO:GO:0042982 GO:GO:0042110
            GO:GO:0030838 GO:GO:0032147 GO:GO:0016328 GO:GO:0048704
            GO:GO:0050680 GO:GO:0001658 GO:GO:0030432 GO:GO:0033268
            GO:GO:0001772 GO:GO:0043219 GO:GO:0002088 GO:GO:0031579
            GO:GO:0001771 GO:GO:0035748 GO:GO:0048608 InterPro:IPR015143
            Pfam:PF09058 EMBL:AC068302 EMBL:AC092937 HGNC:HGNC:2900
            GO:GO:0031253 GO:GO:0060022 GO:GO:0048745 GO:GO:0002369
            InterPro:IPR019590 Pfam:PF10608 HOGENOM:HOG000202691
            IPI:IPI00790354 ProteinModelPortal:C9JN61 SMR:C9JN61 STRING:C9JN61
            Ensembl:ENST00000419553 ArrayExpress:C9JN61 Bgee:C9JN61
            Uniprot:C9JN61
        Length = 154

 Score = 114 (45.2 bits), Expect = 6.1e-07, P = 6.1e-07
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>UNIPROTKB|C9JUA9 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0008104 "protein localization" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0014069 "postsynaptic density" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0031253 "cell projection
            membrane" evidence=IEA] [GO:0031579 "membrane raft organization"
            evidence=IEA] [GO:0031594 "neuromuscular junction" evidence=IEA]
            [GO:0032147 "activation of protein kinase activity" evidence=IEA]
            [GO:0032947 "protein complex scaffold" evidence=IEA] [GO:0033268
            "node of Ranvier" evidence=IEA] [GO:0035748 "myelin sheath abaxonal
            region" evidence=IEA] [GO:0042110 "T cell activation" evidence=IEA]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IEA] [GO:0042391 "regulation of membrane potential"
            evidence=IEA] [GO:0042982 "amyloid precursor protein metabolic
            process" evidence=IEA] [GO:0043219 "lateral loop" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608 "reproductive
            structure development" evidence=IEA] [GO:0048704 "embryonic
            skeletal system morphogenesis" evidence=IEA] [GO:0048745 "smooth
            muscle tissue development" evidence=IEA] [GO:0050680 "negative
            regulation of epithelial cell proliferation" evidence=IEA]
            [GO:0060022 "hard palate development" evidence=IEA]
            InterPro:IPR004172 PROSITE:PS51022 SMART:SM00569 GO:GO:0014069
            GO:GO:0008104 GO:GO:0042130 GO:GO:0008284 GO:GO:0031594
            GO:GO:0045121 GO:GO:0042391 GO:GO:0042982 GO:GO:0042110
            GO:GO:0030838 GO:GO:0032147 GO:GO:0016328 GO:GO:0048704
            GO:GO:0050680 GO:GO:0001658 GO:GO:0030432 GO:GO:0033268
            GO:GO:0001772 GO:GO:0043219 GO:GO:0002088 GO:GO:0031579
            GO:GO:0001771 GO:GO:0035748 GO:GO:0048608 InterPro:IPR015143
            Pfam:PF09058 EMBL:AC068302 EMBL:AC092937 HGNC:HGNC:2900
            GO:GO:0031253 GO:GO:0060022 GO:GO:0048745 GO:GO:0002369
            HOGENOM:HOG000202691 IPI:IPI00796899 ProteinModelPortal:C9JUA9
            SMR:C9JUA9 STRING:C9JUA9 Ensembl:ENST00000436682
            ArrayExpress:C9JUA9 Bgee:C9JUA9 Uniprot:C9JUA9
        Length = 123

 Score = 114 (45.2 bits), Expect = 6.1e-07, P = 6.1e-07
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>UNIPROTKB|F2Z2L0 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0008104 "protein localization" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0014069 "postsynaptic density" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0031253 "cell projection
            membrane" evidence=IEA] [GO:0031579 "membrane raft organization"
            evidence=IEA] [GO:0031594 "neuromuscular junction" evidence=IEA]
            [GO:0032147 "activation of protein kinase activity" evidence=IEA]
            [GO:0032947 "protein complex scaffold" evidence=IEA] [GO:0033268
            "node of Ranvier" evidence=IEA] [GO:0035748 "myelin sheath abaxonal
            region" evidence=IEA] [GO:0042110 "T cell activation" evidence=IEA]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IEA] [GO:0042391 "regulation of membrane potential"
            evidence=IEA] [GO:0042982 "amyloid precursor protein metabolic
            process" evidence=IEA] [GO:0043219 "lateral loop" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608 "reproductive
            structure development" evidence=IEA] [GO:0048704 "embryonic
            skeletal system morphogenesis" evidence=IEA] [GO:0048745 "smooth
            muscle tissue development" evidence=IEA] [GO:0050680 "negative
            regulation of epithelial cell proliferation" evidence=IEA]
            [GO:0060022 "hard palate development" evidence=IEA]
            InterPro:IPR004172 PROSITE:PS51022 SMART:SM00569 GO:GO:0014069
            GO:GO:0008104 GO:GO:0042130 GO:GO:0008284 GO:GO:0031594
            GO:GO:0045121 GO:GO:0042391 GO:GO:0042982 GO:GO:0042110
            GO:GO:0030838 GO:GO:0032147 GO:GO:0016328 GO:GO:0048704
            GO:GO:0050680 GO:GO:0001658 GO:GO:0030432 GO:GO:0033268
            GO:GO:0001772 GO:GO:0043219 GO:GO:0002088 GO:GO:0031579
            GO:GO:0001771 GO:GO:0035748 GO:GO:0048608 InterPro:IPR015143
            Pfam:PF09058 EMBL:AC068302 EMBL:AC092937 HGNC:HGNC:2900
            GO:GO:0031253 GO:GO:0060022 GO:GO:0048745 GO:GO:0002369
            IPI:IPI00794349 ProteinModelPortal:F2Z2L0 SMR:F2Z2L0
            Ensembl:ENST00000412364 ArrayExpress:F2Z2L0 Bgee:F2Z2L0
            Uniprot:F2Z2L0
        Length = 106

 Score = 114 (45.2 bits), Expect = 6.1e-07, P = 6.1e-07
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>UNIPROTKB|A8MUT6 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0008104 "protein localization" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0014069 "postsynaptic density" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0031253 "cell projection
            membrane" evidence=IEA] [GO:0031579 "membrane raft organization"
            evidence=IEA] [GO:0031594 "neuromuscular junction" evidence=IEA]
            [GO:0032147 "activation of protein kinase activity" evidence=IEA]
            [GO:0032947 "protein complex scaffold" evidence=IEA] [GO:0033268
            "node of Ranvier" evidence=IEA] [GO:0035748 "myelin sheath abaxonal
            region" evidence=IEA] [GO:0042110 "T cell activation" evidence=IEA]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IEA] [GO:0042391 "regulation of membrane potential"
            evidence=IEA] [GO:0042982 "amyloid precursor protein metabolic
            process" evidence=IEA] [GO:0043219 "lateral loop" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608 "reproductive
            structure development" evidence=IEA] [GO:0048704 "embryonic
            skeletal system morphogenesis" evidence=IEA] [GO:0048745 "smooth
            muscle tissue development" evidence=IEA] [GO:0050680 "negative
            regulation of epithelial cell proliferation" evidence=IEA]
            [GO:0060022 "hard palate development" evidence=IEA]
            InterPro:IPR004172 PROSITE:PS51022 SMART:SM00569 GO:GO:0014069
            GO:GO:0008104 GO:GO:0042130 GO:GO:0008284 GO:GO:0031594
            GO:GO:0045121 GO:GO:0042391 GO:GO:0042982 GO:GO:0042110
            GO:GO:0030838 GO:GO:0032147 GO:GO:0016328 GO:GO:0048704
            GO:GO:0050680 GO:GO:0001658 GO:GO:0030432 GO:GO:0033268
            GO:GO:0001772 GO:GO:0043219 GO:GO:0002088 GO:GO:0031579
            GO:GO:0001771 GO:GO:0035748 GO:GO:0048608 InterPro:IPR015143
            Pfam:PF09058 EMBL:AC068302 EMBL:AC092937 HGNC:HGNC:2900
            OrthoDB:EOG447FSN GO:GO:0031253 GO:GO:0060022 GO:GO:0048745
            GO:GO:0002369 InterPro:IPR019590 Pfam:PF10608 IPI:IPI00830135
            ProteinModelPortal:A8MUT6 SMR:A8MUT6 STRING:A8MUT6
            Ensembl:ENST00000392380 HOGENOM:HOG000202691 HOVERGEN:HBG100016
            ArrayExpress:A8MUT6 Bgee:A8MUT6 Uniprot:A8MUT6
        Length = 208

 Score = 114 (45.2 bits), Expect = 9.7e-07, P = 9.7e-07
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>UNIPROTKB|Q12959 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0019048 "virus-host interaction" evidence=IEA]
            [GO:0045211 "postsynaptic membrane" evidence=IEA] [GO:0001658
            "branching involved in ureteric bud morphogenesis" evidence=IEA]
            [GO:0001771 "immunological synapse formation" evidence=IEA]
            [GO:0002088 "lens development in camera-type eye" evidence=IEA]
            [GO:0002369 "T cell cytokine production" evidence=IEA] [GO:0008284
            "positive regulation of cell proliferation" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030432
            "peristalsis" evidence=IEA] [GO:0030838 "positive regulation of
            actin filament polymerization" evidence=IEA] [GO:0031253 "cell
            projection membrane" evidence=IEA] [GO:0031579 "membrane raft
            organization" evidence=IEA] [GO:0031594 "neuromuscular junction"
            evidence=IEA] [GO:0032147 "activation of protein kinase activity"
            evidence=IEA] [GO:0032947 "protein complex scaffold" evidence=IEA]
            [GO:0033268 "node of Ranvier" evidence=IEA] [GO:0035748 "myelin
            sheath abaxonal region" evidence=IEA] [GO:0042110 "T cell
            activation" evidence=IEA] [GO:0042130 "negative regulation of T
            cell proliferation" evidence=IEA] [GO:0042982 "amyloid precursor
            protein metabolic process" evidence=IEA] [GO:0043219 "lateral loop"
            evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608
            "reproductive structure development" evidence=IEA] [GO:0048704
            "embryonic skeletal system morphogenesis" evidence=IEA] [GO:0048745
            "smooth muscle tissue development" evidence=IEA] [GO:0050680
            "negative regulation of epithelial cell proliferation"
            evidence=IEA] [GO:0060022 "hard palate development" evidence=IEA]
            [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA]
            [GO:0014069 "postsynaptic density" evidence=IEA] [GO:0042383
            "sarcolemma" evidence=IEA] [GO:0030054 "cell junction"
            evidence=IDA] [GO:0016337 "cell-cell adhesion" evidence=IDA]
            [GO:0001935 "endothelial cell proliferation" evidence=IDA]
            [GO:0019901 "protein kinase binding" evidence=IPI] [GO:0030866
            "cortical actin cytoskeleton organization" evidence=IDA]
            [GO:0007015 "actin filament organization" evidence=IDA] [GO:0004721
            "phosphoprotein phosphatase activity" evidence=TAS] [GO:0015459
            "potassium channel regulator activity" evidence=IDA;NAS]
            [GO:0005515 "protein binding" evidence=IPI] [GO:0045930 "negative
            regulation of mitotic cell cycle" evidence=IMP] [GO:0007093
            "mitotic cell cycle checkpoint" evidence=NAS] [GO:0016323
            "basolateral plasma membrane" evidence=IDA] [GO:0007163
            "establishment or maintenance of cell polarity" evidence=TAS]
            [GO:0019902 "phosphatase binding" evidence=IPI] [GO:0008022
            "protein C-terminus binding" evidence=IPI] [GO:0005911 "cell-cell
            junction" evidence=IDA] [GO:0005874 "microtubule" evidence=IDA]
            [GO:0005737 "cytoplasm" evidence=IDA] [GO:0031434
            "mitogen-activated protein kinase kinase binding" evidence=IPI]
            [GO:0009898 "internal side of plasma membrane" evidence=IDA]
            [GO:0048471 "perinuclear region of cytoplasm" evidence=IDA]
            [GO:0005783 "endoplasmic reticulum" evidence=IDA] [GO:0005794
            "Golgi apparatus" evidence=IDA] [GO:0004385 "guanylate kinase
            activity" evidence=TAS] [GO:0008092 "cytoskeletal protein binding"
            evidence=TAS] [GO:0005829 "cytosol" evidence=TAS] [GO:0005886
            "plasma membrane" evidence=TAS] [GO:0007268 "synaptic transmission"
            evidence=TAS] [GO:0007411 "axon guidance" evidence=TAS] [GO:0044325
            "ion channel binding" evidence=IPI] [GO:0043268 "positive
            regulation of potassium ion transport" evidence=IDA] [GO:0042391
            "regulation of membrane potential" evidence=IDA] [GO:0090004
            "positive regulation of establishment of protein localization to
            plasma membrane" evidence=IDA] [GO:0072659 "protein localization to
            plasma membrane" evidence=IMP] [GO:0097016 "L27 domain binding"
            evidence=IPI] [GO:0001772 "immunological synapse" evidence=TAS]
            [GO:0097025 "MPP7-DLG1-LIN7 complex" evidence=IDA] [GO:0070830
            "tight junction assembly" evidence=IDA] [GO:0005634 "nucleus"
            evidence=IDA] [GO:0005923 "tight junction" evidence=IDA]
            Reactome:REACT_13685 Pfam:PF00595 InterPro:IPR001452
            InterPro:IPR001478 InterPro:IPR004172 InterPro:IPR008144
            InterPro:IPR008145 Pfam:PF00625 PROSITE:PS50002 PROSITE:PS50052
            PROSITE:PS50106 PROSITE:PS51022 SMART:SM00072 SMART:SM00228
            SMART:SM00326 SMART:SM00569 GO:GO:0005783 GO:GO:0005829
            GO:GO:0005634 GO:GO:0005794 GO:GO:0048471 Reactome:REACT_111045
            GO:GO:0007411 GO:GO:0019048 GO:GO:0014069 GO:GO:0007015
            GO:GO:0042130 GO:GO:0005789 GO:GO:0030866 GO:GO:0008092
            GO:GO:0007163 GO:GO:0008284 GO:GO:0007268 GO:GO:0045211
            GO:GO:0031594 GO:GO:0016323 GO:GO:0043268 GO:GO:0045121
            GO:GO:0042391 GO:GO:0042383 GO:GO:0015459 SUPFAM:SSF50044
            GO:GO:0005923 GO:GO:0004721 GO:GO:0042982 GO:GO:0042110
            GO:GO:0016337 GO:GO:0030838 GO:GO:0072659 GO:GO:0032147
            SUPFAM:SSF50156 GO:GO:0016328 GO:GO:0090004 GO:GO:0005874
            GO:GO:0048704 InterPro:IPR011511 Pfam:PF07653 GO:GO:0050680
            GO:GO:0001658 GO:GO:0030432 GO:GO:0033268 PDB:3RL7 PDB:3RL8
            PDB:4G69 PDBsum:3RL7 PDBsum:3RL8 PDBsum:4G69 GO:GO:0070830
            GO:GO:0001935 GO:GO:0009898 GO:GO:0001772 GO:GO:0045930
            EMBL:CH471191 GO:GO:0043219 GO:GO:0004385 PROSITE:PS00856
            GO:GO:0002088 GO:GO:0031579 GO:GO:0001771 GO:GO:0031575
            GO:GO:0035748 InterPro:IPR020590 GO:GO:0048608 CTD:1739
            eggNOG:COG0194 InterPro:IPR015143 Pfam:PF09058 EMBL:U13896
            EMBL:U13897 EMBL:AK294772 EMBL:AK294855 EMBL:EF553524 EMBL:AC068302
            EMBL:AC092937 EMBL:BC140841 EMBL:BC144651 IPI:IPI00030351
            IPI:IPI00218729 IPI:IPI00552213 IPI:IPI00552376 IPI:IPI00552511
            IPI:IPI00552682 IPI:IPI00553029 IPI:IPI00789849 PIR:I38756
            PIR:I38757 RefSeq:NP_001091894.1 RefSeq:NP_001191315.1
            RefSeq:NP_001191316.1 RefSeq:NP_001191317.1 RefSeq:NP_004078.2
            UniGene:Hs.292549 PDB:1PDR PDB:2OQS PDB:2X7Z PDB:3LRA PDB:4AMH
            PDBsum:1PDR PDBsum:2OQS PDBsum:2X7Z PDBsum:3LRA PDBsum:4AMH
            ProteinModelPortal:Q12959 SMR:Q12959 IntAct:Q12959 MINT:MINT-107690
            STRING:Q12959 PhosphoSite:Q12959 DMDM:223590196 PaxDb:Q12959
            PRIDE:Q12959 Ensembl:ENST00000314062 Ensembl:ENST00000346964
            Ensembl:ENST00000357674 Ensembl:ENST00000392382
            Ensembl:ENST00000419354 Ensembl:ENST00000422288
            Ensembl:ENST00000443183 Ensembl:ENST00000448528
            Ensembl:ENST00000450955 Ensembl:ENST00000452595 GeneID:1739
            KEGG:hsa:1739 UCSC:uc003fxn.4 UCSC:uc003fxo.4 UCSC:uc010iam.1
            UCSC:uc011bue.2 GeneCards:GC03M196769 HGNC:HGNC:2900 HPA:CAB016307
            MIM:601014 neXtProt:NX_Q12959 PharmGKB:PA27356 HOVERGEN:HBG107814
            KO:K12076 OrthoDB:EOG447FSN EvolutionaryTrace:Q12959
            GenomeRNAi:1739 NextBio:7051 PMAP-CutDB:A5YKK7 ArrayExpress:Q12959
            Bgee:Q12959 CleanEx:HS_DLG1 Genevestigator:Q12959
            GermOnline:ENSG00000075711 GO:GO:0031253 GO:GO:0097025
            GO:GO:0060022 GO:GO:0048745 GO:GO:0002369 InterPro:IPR016313
            InterPro:IPR019590 InterPro:IPR019583 Pfam:PF10608 Pfam:PF10600
            PIRSF:PIRSF001741 Uniprot:Q12959
        Length = 904

 Score = 114 (45.2 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>MGI|MGI:107231 [details] [associations]
            symbol:Dlg1 "discs, large homolog 1 (Drosophila)"
            species:10090 "Mus musculus" [GO:0001657 "ureteric bud development"
            evidence=IMP] [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IMP] [GO:0001771 "immunological synapse
            formation" evidence=IMP] [GO:0001772 "immunological synapse"
            evidence=IDA] [GO:0001935 "endothelial cell proliferation"
            evidence=ISO] [GO:0002088 "lens development in camera-type eye"
            evidence=IMP] [GO:0002369 "T cell cytokine production"
            evidence=IMP] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005634 "nucleus" evidence=ISO] [GO:0005737 "cytoplasm"
            evidence=ISO] [GO:0005783 "endoplasmic reticulum" evidence=ISO]
            [GO:0005794 "Golgi apparatus" evidence=ISO] [GO:0005874
            "microtubule" evidence=ISO] [GO:0005886 "plasma membrane"
            evidence=ISO;IDA] [GO:0005911 "cell-cell junction" evidence=ISO]
            [GO:0005913 "cell-cell adherens junction" evidence=TAS] [GO:0005923
            "tight junction" evidence=ISO] [GO:0007015 "actin filament
            organization" evidence=ISO] [GO:0008022 "protein C-terminus
            binding" evidence=ISO] [GO:0008104 "protein localization"
            evidence=IGI;IMP] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IMP] [GO:0009898 "internal side of plasma
            membrane" evidence=ISO] [GO:0009925 "basal plasma membrane"
            evidence=ISO] [GO:0014069 "postsynaptic density" evidence=ISO;IDA]
            [GO:0015459 "potassium channel regulator activity" evidence=ISO]
            [GO:0016020 "membrane" evidence=IEA] [GO:0016323 "basolateral
            plasma membrane" evidence=ISO;IDA;TAS] [GO:0016328 "lateral plasma
            membrane" evidence=IDA] [GO:0016337 "cell-cell adhesion"
            evidence=ISO] [GO:0019901 "protein kinase binding" evidence=ISO]
            [GO:0019902 "phosphatase binding" evidence=ISO] [GO:0030054 "cell
            junction" evidence=ISO;IDA] [GO:0030165 "PDZ domain binding"
            evidence=ISO] [GO:0030315 "T-tubule" evidence=ISO] [GO:0030432
            "peristalsis" evidence=IMP] [GO:0030838 "positive regulation of
            actin filament polymerization" evidence=IMP] [GO:0030866 "cortical
            actin cytoskeleton organization" evidence=ISO] [GO:0031253 "cell
            projection membrane" evidence=IDA] [GO:0031434 "mitogen-activated
            protein kinase kinase binding" evidence=ISO] [GO:0031579 "membrane
            raft organization" evidence=IMP] [GO:0031594 "neuromuscular
            junction" evidence=IDA] [GO:0032147 "activation of protein kinase
            activity" evidence=IMP] [GO:0032880 "regulation of protein
            localization" evidence=ISO] [GO:0032947 "protein complex scaffold"
            evidence=IMP] [GO:0033268 "node of Ranvier" evidence=IDA]
            [GO:0035255 "ionotropic glutamate receptor binding" evidence=ISO]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IDA]
            [GO:0040018 "positive regulation of multicellular organism growth"
            evidence=TAS] [GO:0042110 "T cell activation" evidence=IMP]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IMP] [GO:0042391 "regulation of membrane potential"
            evidence=ISO;IGI] [GO:0042734 "presynaptic membrane" evidence=ISO]
            [GO:0042982 "amyloid precursor protein metabolic process"
            evidence=IGI] [GO:0043005 "neuron projection" evidence=ISO]
            [GO:0043219 "lateral loop" evidence=IDA] [GO:0043268 "positive
            regulation of potassium ion transport" evidence=ISO] [GO:0044325
            "ion channel binding" evidence=ISO] [GO:0045121 "membrane raft"
            evidence=IDA] [GO:0045202 "synapse" evidence=IDA] [GO:0045211
            "postsynaptic membrane" evidence=IEA] [GO:0045930 "negative
            regulation of mitotic cell cycle" evidence=ISO] [GO:0048471
            "perinuclear region of cytoplasm" evidence=ISO] [GO:0048608
            "reproductive structure development" evidence=IMP] [GO:0048639
            "positive regulation of developmental growth" evidence=TAS]
            [GO:0048704 "embryonic skeletal system morphogenesis" evidence=IMP]
            [GO:0048729 "tissue morphogenesis" evidence=IMP] [GO:0048745
            "smooth muscle tissue development" evidence=IMP] [GO:0050680
            "negative regulation of epithelial cell proliferation"
            evidence=IMP] [GO:0060022 "hard palate development" evidence=IMP]
            [GO:0070830 "tight junction assembly" evidence=ISO] [GO:0072659
            "protein localization to plasma membrane" evidence=ISO] [GO:0090004
            "positive regulation of establishment of protein localization to
            plasma membrane" evidence=ISO] [GO:0097016 "L27 domain binding"
            evidence=ISO] [GO:0097025 "MPP7-DLG1-LIN7 complex" evidence=ISO]
            Pfam:PF00595 InterPro:IPR001452 InterPro:IPR001478
            InterPro:IPR004172 InterPro:IPR008144 InterPro:IPR008145
            Pfam:PF00625 PROSITE:PS50002 PROSITE:PS50052 PROSITE:PS50106
            PROSITE:PS51022 SMART:SM00072 SMART:SM00228 SMART:SM00326
            SMART:SM00569 MGI:MGI:107231 GO:GO:0005634 GO:GO:0019901
            GO:GO:0014069 GO:GO:0008104 GO:GO:0007015 GO:GO:0042130
            GO:GO:0005789 GO:GO:0030866 GO:GO:0008284 GO:GO:0045211
            GO:GO:0031594 GO:GO:0040018 GO:GO:0016323 GO:GO:0045121
            GO:GO:0042391 SUPFAM:SSF50044 GO:GO:0005913 Reactome:REACT_127416
            GO:GO:0005923 GO:GO:0042982 GO:GO:0042110 GO:GO:0016337
            GO:GO:0030838 GO:GO:0072659 GO:GO:0032147 SUPFAM:SSF50156
            GO:GO:0032947 GO:GO:0016328 GO:GO:0048704 InterPro:IPR011511
            Pfam:PF07653 GO:GO:0050680 GO:GO:0001658 GO:GO:0030432
            GO:GO:0033268 GO:GO:0070830 GO:GO:0001935 GO:GO:0001772
            GO:GO:0045930 GO:GO:0043219 PROSITE:PS00856 GO:GO:0002088
            GO:GO:0031579 GO:GO:0001771 GO:GO:0019902 GO:GO:0035748
            GO:GO:0048639 InterPro:IPR020590 GO:GO:0048608 CTD:1739
            eggNOG:COG0194 ChiTaRS:dlg1 InterPro:IPR015143 Pfam:PF09058
            HOVERGEN:HBG107814 KO:K12076 OrthoDB:EOG447FSN GO:GO:0031253
            GO:GO:0097025 GO:GO:0060022 GO:GO:0048745 GO:GO:0002369
            InterPro:IPR016313 InterPro:IPR019590 InterPro:IPR019583
            Pfam:PF10608 Pfam:PF10600 PIRSF:PIRSF001741 EMBL:U93309
            EMBL:AY159380 EMBL:BC047142 EMBL:BC057118 IPI:IPI00125861
            IPI:IPI00408668 IPI:IPI00553807 RefSeq:NP_001239362.1
            RefSeq:NP_001239363.1 RefSeq:NP_001239364.1 RefSeq:NP_031888.2
            UniGene:Mm.382 ProteinModelPortal:Q811D0 SMR:Q811D0 IntAct:Q811D0
            MINT:MINT-136497 STRING:Q811D0 PhosphoSite:Q811D0 PaxDb:Q811D0
            PRIDE:Q811D0 Ensembl:ENSMUST00000064477 Ensembl:ENSMUST00000100001
            Ensembl:ENSMUST00000115205 GeneID:13383 KEGG:mmu:13383
            UCSC:uc007yxo.1 UCSC:uc007yxp.1 UCSC:uc007yxs.1
            GeneTree:ENSGT00660000095130 HOGENOM:HOG000232102 NextBio:283732
            Bgee:Q811D0 CleanEx:MM_DLG1 Genevestigator:Q811D0
            GermOnline:ENSMUSG00000022770 Uniprot:Q811D0
        Length = 905

 Score = 114 (45.2 bits), Expect = 1.4e-05, P = 1.4e-05
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQS 43


>RGD|2505 [details] [associations]
            symbol:Dlg1 "discs, large homolog 1 (Drosophila)" species:10116
          "Rattus norvegicus" [GO:0001657 "ureteric bud development"
          evidence=ISO] [GO:0001658 "branching involved in ureteric bud
          morphogenesis" evidence=IEA;ISO] [GO:0001771 "immunological synapse
          formation" evidence=IEA;ISO] [GO:0001772 "immunological synapse"
          evidence=IEA;ISO] [GO:0001935 "endothelial cell proliferation"
          evidence=IEA;ISO;ISS] [GO:0002088 "lens development in camera-type
          eye" evidence=IEA;ISO] [GO:0002369 "T cell cytokine production"
          evidence=IEA;ISO] [GO:0005515 "protein binding" evidence=IPI]
          [GO:0005634 "nucleus" evidence=IEA;ISO] [GO:0005737 "cytoplasm"
          evidence=ISO] [GO:0005783 "endoplasmic reticulum" evidence=IEA;ISO]
          [GO:0005789 "endoplasmic reticulum membrane" evidence=IEA]
          [GO:0005794 "Golgi apparatus" evidence=IEA;ISO] [GO:0005874
          "microtubule" evidence=IEA;ISO] [GO:0005886 "plasma membrane"
          evidence=ISO;IDA] [GO:0005911 "cell-cell junction" evidence=ISO]
          [GO:0005923 "tight junction" evidence=IEA;ISO] [GO:0007015 "actin
          filament organization" evidence=IEA;ISO;ISS] [GO:0007155 "cell
          adhesion" evidence=IEP] [GO:0008022 "protein C-terminus binding"
          evidence=IEA;ISO;IPI] [GO:0008104 "protein localization"
          evidence=ISO] [GO:0008284 "positive regulation of cell proliferation"
          evidence=IEA;ISO] [GO:0009898 "internal side of plasma membrane"
          evidence=IEA;ISO] [GO:0009925 "basal plasma membrane" evidence=IDA]
          [GO:0014069 "postsynaptic density" evidence=IEA;ISO;IDA;TAS]
          [GO:0015459 "potassium channel regulator activity" evidence=ISO]
          [GO:0016323 "basolateral plasma membrane" evidence=IEA;ISO;ISS;IDA]
          [GO:0016328 "lateral plasma membrane" evidence=IEA;ISO] [GO:0016337
          "cell-cell adhesion" evidence=IEA;ISO;ISS] [GO:0019901 "protein
          kinase binding" evidence=ISO;ISS;IPI] [GO:0019902 "phosphatase
          binding" evidence=IEA;ISO;ISS] [GO:0030054 "cell junction"
          evidence=IEA;ISO] [GO:0030165 "PDZ domain binding" evidence=IPI]
          [GO:0030315 "T-tubule" evidence=IDA] [GO:0030432 "peristalsis"
          evidence=IEA;ISO] [GO:0030838 "positive regulation of actin filament
          polymerization" evidence=IEA;ISO] [GO:0030866 "cortical actin
          cytoskeleton organization" evidence=IEA;ISO;ISS] [GO:0031253 "cell
          projection membrane" evidence=IEA;ISO] [GO:0031434 "mitogen-activated
          protein kinase kinase binding" evidence=IEA;ISO] [GO:0031579
          "membrane raft organization" evidence=IEA;ISO] [GO:0031594
          "neuromuscular junction" evidence=IEA;ISO] [GO:0032147 "activation of
          protein kinase activity" evidence=IEA;ISO] [GO:0032880 "regulation of
          protein localization" evidence=IMP] [GO:0032947 "protein complex
          scaffold" evidence=IEA;ISO] [GO:0033268 "node of Ranvier"
          evidence=IEA;ISO] [GO:0035255 "ionotropic glutamate receptor binding"
          evidence=IPI] [GO:0035748 "myelin sheath abaxonal region"
          evidence=IEA;ISO] [GO:0042110 "T cell activation" evidence=IEA;ISO]
          [GO:0042130 "negative regulation of T cell proliferation"
          evidence=IEA;ISO] [GO:0042391 "regulation of membrane potential"
          evidence=IEA;ISO] [GO:0042734 "presynaptic membrane" evidence=IDA]
          [GO:0042982 "amyloid precursor protein metabolic process"
          evidence=IEA;ISO] [GO:0043005 "neuron projection" evidence=IDA]
          [GO:0043219 "lateral loop" evidence=IEA;ISO] [GO:0043268 "positive
          regulation of potassium ion transport" evidence=IEA;ISO;IMP]
          [GO:0044325 "ion channel binding" evidence=IEA;ISO] [GO:0045121
          "membrane raft" evidence=IEA;ISO] [GO:0045202 "synapse" evidence=ISO]
          [GO:0045211 "postsynaptic membrane" evidence=TAS] [GO:0045930
          "negative regulation of mitotic cell cycle" evidence=IEA;ISO;ISS]
          [GO:0048471 "perinuclear region of cytoplasm" evidence=IEA;ISO]
          [GO:0048608 "reproductive structure development" evidence=IEA;ISO]
          [GO:0048704 "embryonic skeletal system morphogenesis"
          evidence=IEA;ISO] [GO:0048729 "tissue morphogenesis" evidence=ISO]
          [GO:0048745 "smooth muscle tissue development" evidence=IEA;ISO]
          [GO:0050680 "negative regulation of epithelial cell proliferation"
          evidence=IEA;ISO] [GO:0060022 "hard palate development"
          evidence=IEA;ISO] [GO:0070830 "tight junction assembly"
          evidence=IEA;ISO] [GO:0072659 "protein localization to plasma
          membrane" evidence=IEA;ISO] [GO:0090004 "positive regulation of
          establishment of protein localization to plasma membrane"
          evidence=IEA;ISO] [GO:0097016 "L27 domain binding" evidence=IEA;ISO]
          [GO:0097025 "MPP7-DLG1-LIN7 complex" evidence=IEA;ISO] Pfam:PF00595
          InterPro:IPR001452 InterPro:IPR001478 InterPro:IPR004172
          InterPro:IPR008144 InterPro:IPR008145 Pfam:PF00625 PROSITE:PS50002
          PROSITE:PS50052 PROSITE:PS50106 PROSITE:PS51022 SMART:SM00072
          SMART:SM00228 SMART:SM00326 SMART:SM00569 RGD:2505 GO:GO:0019901
          GO:GO:0014069 GO:GO:0007015 GO:GO:0005789 GO:GO:0030866 GO:GO:0030054
          GO:GO:0045211 GO:GO:0042734 GO:GO:0043268 GO:GO:0032880 GO:GO:0030315
          SUPFAM:SSF50044 GO:GO:0016337 SUPFAM:SSF50156 InterPro:IPR011511
          Pfam:PF07653 GO:GO:0009925 GO:GO:0001935 GO:GO:0045930
          PROSITE:PS00856 GO:GO:0019902 InterPro:IPR020590 PDB:1RSO PDBsum:1RSO
          CTD:1739 eggNOG:COG0194 InterPro:IPR015143 Pfam:PF09058
          HOVERGEN:HBG107814 KO:K12076 OrthoDB:EOG447FSN InterPro:IPR016313
          InterPro:IPR019590 InterPro:IPR019583 Pfam:PF10608 Pfam:PF10600
          PIRSF:PIRSF001741 HOGENOM:HOG000232102 EMBL:U14950 IPI:IPI00207201
          PIR:I56552 RefSeq:NP_036920.1 UniGene:Rn.89331 PDB:1ZOK PDB:2AWU
          PDB:2AWW PDB:2AWX PDB:2G2L PDB:2I0I PDB:2I0L PDB:3UAT PDBsum:1ZOK
          PDBsum:2AWU PDBsum:2AWW PDBsum:2AWX PDBsum:2G2L PDBsum:2I0I
          PDBsum:2I0L PDBsum:3UAT ProteinModelPortal:Q62696 SMR:Q62696
          IntAct:Q62696 MINT:MINT-93379 STRING:Q62696 PhosphoSite:Q62696
          PRIDE:Q62696 GeneID:25252 KEGG:rno:25252 UCSC:RGD:2505
          EvolutionaryTrace:Q62696 NextBio:605875 ArrayExpress:Q62696
          Genevestigator:Q62696 GermOnline:ENSRNOG00000038597 Uniprot:Q62696
        Length = 911

 Score = 113 (44.8 bits), Expect = 1.8e-05, P = 1.8e-05
 Identities = 23/37 (62%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LLE+Y SKL+   D+QLRS+IERVI IF+S
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIERVISIFQS 43


>ZFIN|ZDB-GENE-010724-8 [details] [associations]
            symbol:dlg1 "discs, large (Drosophila) homolog 1"
            species:7955 "Danio rerio" [GO:0001935 "endothelial cell
            proliferation" evidence=ISS] [GO:0007015 "actin filament
            organization" evidence=ISS] [GO:0016337 "cell-cell adhesion"
            evidence=ISS] [GO:0030866 "cortical actin cytoskeleton
            organization" evidence=ISS] [GO:0016323 "basolateral plasma
            membrane" evidence=ISS] [GO:0019902 "phosphatase binding"
            evidence=ISS] [GO:0045930 "negative regulation of mitotic cell
            cycle" evidence=ISS] [GO:0019901 "protein kinase binding"
            evidence=ISS] [GO:0016020 "membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0005783 "endoplasmic reticulum"
            evidence=IEA] [GO:0005789 "endoplasmic reticulum membrane"
            evidence=IEA] Pfam:PF00018 Pfam:PF00595 InterPro:IPR001452
            InterPro:IPR001478 InterPro:IPR004172 InterPro:IPR008144
            InterPro:IPR008145 Pfam:PF00625 PROSITE:PS50002 PROSITE:PS50052
            PROSITE:PS50106 PROSITE:PS51022 SMART:SM00072 SMART:SM00228
            SMART:SM00326 SMART:SM00569 ZFIN:ZDB-GENE-010724-8 SUPFAM:SSF50044
            SUPFAM:SSF50156 PROSITE:PS00856 InterPro:IPR020590
            InterPro:IPR015143 Pfam:PF09058 InterPro:IPR016313
            InterPro:IPR019590 InterPro:IPR019583 Pfam:PF10608 Pfam:PF10600
            PIRSF:PIRSF001741 GeneTree:ENSGT00660000095130 EMBL:BX255895
            EMBL:CR847898 EMBL:CT030696 EMBL:CU179662 EMBL:CU855809
            IPI:IPI01017012 Ensembl:ENSDART00000028406 ArrayExpress:E7FAT1
            Bgee:E7FAT1 Uniprot:E7FAT1
        Length = 909

 Score = 107 (42.7 bits), Expect = 7.7e-05, P = 7.7e-05
 Identities = 22/37 (59%), Positives = 28/37 (75%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +A RAL+LLE+Y +KL+   D  LR +IERVI IFKS
Sbjct:     7 DAQRALQLLEEYQTKLSQTGDPHLRLSIERVINIFKS 43


>UNIPROTKB|E1BT38 [details] [associations]
            symbol:DLG1 "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0001935 "endothelial cell proliferation"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0005634 "nucleus" evidence=IEA] [GO:0005783
            "endoplasmic reticulum" evidence=IEA] [GO:0005794 "Golgi apparatus"
            evidence=IEA] [GO:0005874 "microtubule" evidence=IEA] [GO:0005923
            "tight junction" evidence=IEA] [GO:0007015 "actin filament
            organization" evidence=IEA] [GO:0008022 "protein C-terminus
            binding" evidence=IEA] [GO:0008284 "positive regulation of cell
            proliferation" evidence=IEA] [GO:0009898 "internal side of plasma
            membrane" evidence=IEA] [GO:0014069 "postsynaptic density"
            evidence=IEA] [GO:0016323 "basolateral plasma membrane"
            evidence=IEA] [GO:0016328 "lateral plasma membrane" evidence=IEA]
            [GO:0016337 "cell-cell adhesion" evidence=IEA] [GO:0019902
            "phosphatase binding" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0030866 "cortical actin
            cytoskeleton organization" evidence=IEA] [GO:0031253 "cell
            projection membrane" evidence=IEA] [GO:0031434 "mitogen-activated
            protein kinase kinase binding" evidence=IEA] [GO:0031579 "membrane
            raft organization" evidence=IEA] [GO:0031594 "neuromuscular
            junction" evidence=IEA] [GO:0032147 "activation of protein kinase
            activity" evidence=IEA] [GO:0032947 "protein complex scaffold"
            evidence=IEA] [GO:0033268 "node of Ranvier" evidence=IEA]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IEA]
            [GO:0042110 "T cell activation" evidence=IEA] [GO:0042130 "negative
            regulation of T cell proliferation" evidence=IEA] [GO:0042391
            "regulation of membrane potential" evidence=IEA] [GO:0042982
            "amyloid precursor protein metabolic process" evidence=IEA]
            [GO:0043219 "lateral loop" evidence=IEA] [GO:0043268 "positive
            regulation of potassium ion transport" evidence=IEA] [GO:0044325
            "ion channel binding" evidence=IEA] [GO:0045121 "membrane raft"
            evidence=IEA] [GO:0045930 "negative regulation of mitotic cell
            cycle" evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0048608 "reproductive structure development"
            evidence=IEA] [GO:0048704 "embryonic skeletal system morphogenesis"
            evidence=IEA] [GO:0048745 "smooth muscle tissue development"
            evidence=IEA] [GO:0050680 "negative regulation of epithelial cell
            proliferation" evidence=IEA] [GO:0060022 "hard palate development"
            evidence=IEA] [GO:0070830 "tight junction assembly" evidence=IEA]
            [GO:0072659 "protein localization to plasma membrane" evidence=IEA]
            [GO:0090004 "positive regulation of establishment of protein
            localization to plasma membrane" evidence=IEA] [GO:0097016 "L27
            domain binding" evidence=IEA] [GO:0097025 "MPP7-DLG1-LIN7 complex"
            evidence=IEA] Pfam:PF00018 Pfam:PF00595 InterPro:IPR001452
            InterPro:IPR001478 InterPro:IPR004172 InterPro:IPR008144
            InterPro:IPR008145 Pfam:PF00625 PROSITE:PS50002 PROSITE:PS50052
            PROSITE:PS50106 PROSITE:PS51022 SMART:SM00072 SMART:SM00228
            SMART:SM00326 SMART:SM00569 GO:GO:0005634 GO:GO:0005737
            GO:GO:0014069 GO:GO:0007015 GO:GO:0042130 GO:GO:0030866
            GO:GO:0008284 GO:GO:0031594 GO:GO:0045121 GO:GO:0042391
            SUPFAM:SSF50044 GO:GO:0005923 GO:GO:0042982 GO:GO:0042110
            GO:GO:0016337 GO:GO:0030838 GO:GO:0072659 GO:GO:0032147
            SUPFAM:SSF50156 GO:GO:0016328 GO:GO:0050680 GO:GO:0033268
            GO:GO:0070830 GO:GO:0001935 GO:GO:0001772 GO:GO:0045930
            GO:GO:0043219 PROSITE:PS00856 GO:GO:0031579 GO:GO:0035748
            InterPro:IPR020590 InterPro:IPR015143 Pfam:PF09058 GO:GO:0031253
            GO:GO:0097025 InterPro:IPR016313 InterPro:IPR019590
            InterPro:IPR019583 Pfam:PF10608 Pfam:PF10600 PIRSF:PIRSF001741
            GeneTree:ENSGT00660000095130 OMA:GLKHVTS EMBL:AADN02020536
            EMBL:AADN02020537 IPI:IPI00571670 ProteinModelPortal:E1BT38
            Ensembl:ENSGALT00000011195 Uniprot:E1BT38
        Length = 933

 Score = 106 (42.4 bits), Expect = 0.00010, P = 0.00010
 Identities = 21/37 (56%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +  RAL LL++Y SKL+   D+QLR++IERVI IF+S
Sbjct:     7 DTQRALRLLQEYRSKLSQAEDRQLRNSIERVIGIFQS 43


>ZFIN|ZDB-GENE-050222-3 [details] [associations]
            symbol:dlg1l "discs, large (Drosophila) homolog 1,
            like" species:7955 "Danio rerio" [GO:0001935 "endothelial cell
            proliferation" evidence=ISS] [GO:0007015 "actin filament
            organization" evidence=ISS] [GO:0016337 "cell-cell adhesion"
            evidence=ISS] [GO:0030866 "cortical actin cytoskeleton
            organization" evidence=ISS] [GO:0019901 "protein kinase binding"
            evidence=ISS] [GO:0019902 "phosphatase binding" evidence=ISS]
            [GO:0016323 "basolateral plasma membrane" evidence=ISS] [GO:0045930
            "negative regulation of mitotic cell cycle" evidence=ISS]
            [GO:0016020 "membrane" evidence=IEA] Pfam:PF00595
            InterPro:IPR001452 InterPro:IPR001478 InterPro:IPR004172
            InterPro:IPR008144 InterPro:IPR008145 Pfam:PF00625 PROSITE:PS50002
            PROSITE:PS50052 PROSITE:PS50106 PROSITE:PS51022 SMART:SM00072
            SMART:SM00228 SMART:SM00326 SMART:SM00569 ZFIN:ZDB-GENE-050222-3
            SUPFAM:SSF50044 SUPFAM:SSF50156 InterPro:IPR011511 Pfam:PF07653
            PROSITE:PS00856 InterPro:IPR020590 InterPro:IPR015143 Pfam:PF09058
            InterPro:IPR016313 InterPro:IPR019590 InterPro:IPR019583
            Pfam:PF10608 Pfam:PF10600 PIRSF:PIRSF001741
            GeneTree:ENSGT00660000095130 EMBL:AL840636 EMBL:BX663506
            IPI:IPI00632974 Ensembl:ENSDART00000061429 Bgee:E7F796
            Uniprot:E7F796
        Length = 906

 Score = 105 (42.0 bits), Expect = 0.00013, P = 0.00013
 Identities = 22/37 (59%), Positives = 29/37 (78%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIERVIRIFKS 54
             +A RAL LLE+Y SKL+   D+QLR +I+RVI IF+S
Sbjct:     7 DAQRALLLLEEYRSKLSSTEDRQLRHSIQRVIDIFQS 43


>UNIPROTKB|C9J110 [details] [associations]
            symbol:DLG1 "Disks large homolog 1" species:9606 "Homo
            sapiens" [GO:0001658 "branching involved in ureteric bud
            morphogenesis" evidence=IEA] [GO:0001771 "immunological synapse
            formation" evidence=IEA] [GO:0001772 "immunological synapse"
            evidence=IEA] [GO:0002088 "lens development in camera-type eye"
            evidence=IEA] [GO:0002369 "T cell cytokine production"
            evidence=IEA] [GO:0008104 "protein localization" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0014069 "postsynaptic density" evidence=IEA]
            [GO:0016328 "lateral plasma membrane" evidence=IEA] [GO:0030054
            "cell junction" evidence=IEA] [GO:0030432 "peristalsis"
            evidence=IEA] [GO:0030838 "positive regulation of actin filament
            polymerization" evidence=IEA] [GO:0031253 "cell projection
            membrane" evidence=IEA] [GO:0031579 "membrane raft organization"
            evidence=IEA] [GO:0031594 "neuromuscular junction" evidence=IEA]
            [GO:0032147 "activation of protein kinase activity" evidence=IEA]
            [GO:0032947 "protein complex scaffold" evidence=IEA] [GO:0033268
            "node of Ranvier" evidence=IEA] [GO:0035748 "myelin sheath abaxonal
            region" evidence=IEA] [GO:0042110 "T cell activation" evidence=IEA]
            [GO:0042130 "negative regulation of T cell proliferation"
            evidence=IEA] [GO:0042391 "regulation of membrane potential"
            evidence=IEA] [GO:0042982 "amyloid precursor protein metabolic
            process" evidence=IEA] [GO:0043219 "lateral loop" evidence=IEA]
            [GO:0045121 "membrane raft" evidence=IEA] [GO:0048608 "reproductive
            structure development" evidence=IEA] [GO:0048704 "embryonic
            skeletal system morphogenesis" evidence=IEA] [GO:0048745 "smooth
            muscle tissue development" evidence=IEA] [GO:0050680 "negative
            regulation of epithelial cell proliferation" evidence=IEA]
            [GO:0060022 "hard palate development" evidence=IEA] GO:GO:0014069
            GO:GO:0008104 GO:GO:0042130 GO:GO:0008284 GO:GO:0031594
            GO:GO:0045121 GO:GO:0042391 GO:GO:0042982 GO:GO:0042110
            GO:GO:0030838 GO:GO:0032147 GO:GO:0016328 GO:GO:0048704
            GO:GO:0050680 GO:GO:0001658 GO:GO:0030432 GO:GO:0033268
            GO:GO:0001772 GO:GO:0043219 GO:GO:0002088 GO:GO:0031579
            GO:GO:0001771 GO:GO:0035748 GO:GO:0048608 InterPro:IPR015143
            Pfam:PF09058 EMBL:AC068302 EMBL:AC092937 HGNC:HGNC:2900
            GO:GO:0031253 GO:GO:0060022 GO:GO:0048745 GO:GO:0002369
            IPI:IPI00798030 ProteinModelPortal:C9J110 SMR:C9J110 STRING:C9J110
            Ensembl:ENST00000434148 HOGENOM:HOG000203337 ArrayExpress:C9J110
            Bgee:C9J110 Uniprot:C9J110
        Length = 36

 Score = 91 (37.1 bits), Expect = 0.00017, P = 0.00017
 Identities = 18/30 (60%), Positives = 23/30 (76%)

Query:    18 EAHRALELLEDYHSKLTDPSDKQLRSAIER 47
             +  RAL LLE+Y SKL+   D+QLRS+IER
Sbjct:     7 DTQRALHLLEEYRSKLSQTEDRQLRSSIER 36


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.322   0.139   0.399    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       81        66   0.00091  102 3  11 22  0.41    28
                                                     29  0.48    28


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  12
  No. of states in DFA:  500 (53 KB)
  Total size of DFA:  90 KB (2067 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  8.54u 0.06s 8.60t   Elapsed:  00:00:33
  Total cpu time:  8.54u 0.06s 8.60t   Elapsed:  00:00:34
  Start:  Thu Aug 15 13:58:31 2013   End:  Thu Aug 15 13:59:05 2013

Back to top