Query         psy1895
Match_columns 140
No_of_seqs    195 out of 1109
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 18:59:34 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1895.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1895hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01363 FYVE:  FYVE zinc finge  99.8 2.1E-22 4.6E-27  130.9   1.8   64   69-132     1-68  (69)
  2 smart00064 FYVE Protein presen  99.8 4.2E-20 9.1E-25  119.7   3.4   64   69-132     2-67  (68)
  3 KOG1729|consensus               99.7 1.5E-18 3.4E-23  140.5   0.6   71   63-133   154-226 (288)
  4 KOG1818|consensus               99.6 2.7E-16 5.9E-21  137.5   3.1   67   66-135   157-225 (634)
  5 cd00065 FYVE FYVE domain; Zinc  99.6 6.1E-16 1.3E-20   96.7   2.0   53   77-129     2-56  (57)
  6 PTZ00303 phosphatidylinositol   99.6 1.3E-15 2.8E-20  135.3   3.3   66   67-132   449-530 (1374)
  7 KOG1819|consensus               99.5 3.2E-15   7E-20  128.4   1.9   63   68-130   892-961 (990)
  8 KOG1842|consensus               99.4 9.5E-14 2.1E-18  117.1   1.3   67   67-134   170-261 (505)
  9 KOG1841|consensus               99.1 1.8E-11   4E-16  112.0   1.1   64   64-127   544-608 (1287)
 10 KOG1843|consensus               98.6 1.4E-08   3E-13   85.5   0.9  109   23-131   100-218 (473)
 11 KOG1409|consensus               98.4 3.7E-08 8.1E-13   81.6   0.2   62   69-133   277-351 (404)
 12 KOG4424|consensus               98.3 2.1E-07 4.6E-12   81.2   1.4   65   68-134   408-474 (623)
 13 PF02318 FYVE_2:  FYVE-type zin  97.9 5.7E-05 1.2E-09   53.9   7.1   51   76-131    53-104 (118)
 14 KOG1811|consensus               97.6 4.4E-06 9.4E-11   74.3  -3.5   63   68-130   313-382 (1141)
 15 KOG0230|consensus               97.3 0.00014   3E-09   69.5   2.9   49   77-134     5-53  (1598)
 16 KOG0230|consensus               96.8 0.00067 1.5E-08   65.0   2.6   34   72-107    92-125 (1598)
 17 KOG0993|consensus               95.5  0.0017 3.6E-08   55.5  -1.9   65   69-133   460-526 (542)
 18 KOG1841|consensus               94.4   0.022 4.8E-07   53.8   2.0   56   67-133   647-702 (1287)
 19 KOG1729|consensus               93.0   0.018 3.8E-07   47.3  -1.1   62   69-130    12-81  (288)
 20 PF07975 C1_4:  TFIIH C1-like d  91.9   0.031 6.8E-07   34.4  -0.8   43   79-127     1-49  (51)
 21 TIGR00622 ssl1 transcription f  91.6    0.15 3.1E-06   36.4   2.2   35   76-110    54-98  (112)
 22 KOG4275|consensus               90.6    0.03 6.6E-07   46.1  -2.3   52   72-130    39-90  (350)
 23 KOG3799|consensus               88.9     1.3 2.7E-05   32.9   5.3   50   77-129    65-115 (169)
 24 PF09538 FYDLN_acid:  Protein o  88.4    0.33 7.2E-06   34.3   1.9   32   69-103     4-36  (108)
 25 PF14634 zf-RING_5:  zinc-RING   87.6    0.12 2.6E-06   30.2  -0.7   42   79-127     1-42  (44)
 26 PRK00464 nrdR transcriptional   87.4     0.3 6.5E-06   36.5   1.3   25   79-103     2-38  (154)
 27 PF13717 zinc_ribbon_4:  zinc-r  86.6    0.41   9E-06   27.1   1.3   25   79-103     4-35  (36)
 28 smart00154 ZnF_AN1 AN1-like Zi  86.3    0.44 9.5E-06   27.5   1.3   26   80-107     1-26  (39)
 29 PF07191 zinc-ribbons_6:  zinc-  85.8    0.26 5.6E-06   32.3   0.1   55   79-133     3-62  (70)
 30 PF13719 zinc_ribbon_5:  zinc-r  85.7     0.4 8.8E-06   27.2   0.9   25   79-103     4-35  (37)
 31 KOG2164|consensus               84.5    0.26 5.7E-06   43.2  -0.3   51   78-133   187-237 (513)
 32 TIGR02300 FYDLN_acid conserved  83.5    0.79 1.7E-05   33.4   1.8   26   78-103    10-36  (129)
 33 KOG0320|consensus               82.7    0.15 3.2E-06   39.2  -2.3   47   78-133   132-179 (187)
 34 KOG3576|consensus               82.4    0.26 5.6E-06   39.0  -1.1   32   72-103   112-155 (267)
 35 PF13639 zf-RING_2:  Ring finge  80.7    0.46   1E-05   27.4  -0.2   33   79-112     2-34  (44)
 36 PF12773 DZR:  Double zinc ribb  80.2     1.3 2.7E-05   26.3   1.6   29   74-102     9-38  (50)
 37 PF01485 IBR:  IBR domain;  Int  79.4     1.8 3.8E-05   26.3   2.2   33   78-110    19-57  (64)
 38 KOG0978|consensus               78.9    0.73 1.6E-05   42.0   0.4   44   78-130   644-687 (698)
 39 PRK00420 hypothetical protein;  78.0     1.5 3.4E-05   31.1   1.8   25   78-102    24-49  (112)
 40 cd00162 RING RING-finger (Real  77.7    0.22 4.7E-06   27.7  -2.2   42   80-129     2-43  (45)
 41 PRK00398 rpoP DNA-directed RNA  75.9     1.8 3.8E-05   25.5   1.4   24   79-102     5-30  (46)
 42 PF09297 zf-NADH-PPase:  NADH p  73.7     2.2 4.7E-05   23.2   1.3   26  102-129     4-29  (32)
 43 TIGR02098 MJ0042_CXXC MJ0042 f  73.1     2.2 4.9E-05   23.8   1.3   12   79-90      4-15  (38)
 44 PF10571 UPF0547:  Uncharacteri  72.8     2.1 4.6E-05   22.5   1.0   23   79-103     2-24  (26)
 45 TIGR00570 cdk7 CDK-activating   72.1    0.91   2E-05   37.6  -0.7   49   78-133     4-55  (309)
 46 PF13901 DUF4206:  Domain of un  71.2       2 4.2E-05   33.3   0.9   41   95-135     2-49  (202)
 47 PF13923 zf-C3HC4_2:  Zinc fing  71.1     1.4   3E-05   24.8   0.1   29   80-111     1-29  (39)
 48 PHA02768 hypothetical protein;  70.5     2.5 5.5E-05   26.3   1.2   25   79-103     7-41  (55)
 49 PLN03208 E3 ubiquitin-protein   70.3    0.83 1.8E-05   35.5  -1.3   56   73-132    14-79  (193)
 50 PF13445 zf-RING_UBOX:  RING-ty  68.7     1.6 3.5E-05   25.6   0.0   30   80-110     1-30  (43)
 51 KOG1814|consensus               68.5     9.3  0.0002   33.0   4.5   43   69-112   361-405 (445)
 52 COG2126 RPL37A Ribosomal prote  67.5     2.9 6.2E-05   26.5   1.0   16   87-102     8-25  (61)
 53 PF01927 Mut7-C:  Mut7-C RNAse   65.4     7.6 0.00017   28.3   3.1   20   70-89     84-103 (147)
 54 KOG0823|consensus               64.7     1.6 3.5E-05   34.7  -0.7   32   97-131    63-94  (230)
 55 KOG0317|consensus               64.6     1.9   4E-05   35.5  -0.4   45   78-132   240-284 (293)
 56 PF06221 zf-C2HC5:  Putative zi  64.2     2.4 5.2E-05   26.6   0.1   15   91-105    16-30  (57)
 57 TIGR02605 CxxC_CxxC_SSSS putat  63.8     3.5 7.5E-05   24.5   0.8   14   79-92      7-20  (52)
 58 PRK14559 putative protein seri  63.7     4.6 9.9E-05   36.7   1.9   33   74-110    12-50  (645)
 59 TIGR00100 hypA hydrogenase nic  63.1     3.8 8.2E-05   28.9   1.0   25   77-101    70-94  (115)
 60 PF07282 OrfB_Zn_ribbon:  Putat  62.8     6.7 0.00014   24.6   2.1   28   76-103    27-56  (69)
 61 KOG4739|consensus               62.7     2.5 5.4E-05   33.8   0.0   43   79-131     5-47  (233)
 62 PF05191 ADK_lid:  Adenylate ki  62.4     3.1 6.8E-05   23.5   0.4   16  119-134    19-34  (36)
 63 PF10367 Vps39_2:  Vacuolar sor  62.1      43 0.00094   22.1   7.5   33   75-109    76-108 (109)
 64 PF01155 HypA:  Hydrogenase exp  61.8     2.7 5.8E-05   29.6   0.0   24   78-101    71-94  (113)
 65 smart00659 RPOLCX RNA polymera  61.8     4.7  0.0001   23.8   1.1   23   79-101     4-27  (44)
 66 smart00647 IBR In Between Ring  61.7     7.5 0.00016   23.5   2.1   32   79-110    20-57  (64)
 67 COG5151 SSL1 RNA polymerase II  61.0     3.9 8.5E-05   34.3   0.9   41   70-110   355-405 (421)
 68 PF15227 zf-C3HC4_4:  zinc fing  60.8     1.4   3E-05   25.6  -1.3   15   98-112    15-29  (42)
 69 TIGR01031 rpmF_bact ribosomal   60.1     6.1 0.00013   24.4   1.4   26   71-100    19-46  (55)
 70 PRK00432 30S ribosomal protein  59.9     6.9 0.00015   23.7   1.6   27   77-103    20-47  (50)
 71 KOG3173|consensus               58.4     5.2 0.00011   30.3   1.1   29   76-107   104-132 (167)
 72 PF00097 zf-C3HC4:  Zinc finger  58.2     3.5 7.7E-05   23.0   0.1   30   80-112     1-30  (41)
 73 PF14353 CpXC:  CpXC protein     57.8     5.2 0.00011   28.3   1.0   11   93-103    38-48  (128)
 74 PF03107 C1_2:  C1 domain;  Int  57.6     9.9 0.00022   20.3   1.9   28   79-107     2-29  (30)
 75 PF08271 TF_Zn_Ribbon:  TFIIB z  57.0     7.2 0.00016   22.5   1.3    9   79-87      2-10  (43)
 76 PHA02926 zinc finger-like prot  56.9       2 4.3E-05   34.3  -1.4   54   78-132   171-230 (242)
 77 PF04438 zf-HIT:  HIT zinc fing  56.8     6.5 0.00014   21.3   1.0   23   78-105     3-25  (30)
 78 smart00834 CxxC_CXXC_SSSS Puta  56.7     5.6 0.00012   22.2   0.8   13   79-91      7-19  (41)
 79 PRK12380 hydrogenase nickel in  55.3     6.1 0.00013   27.8   1.0   24   78-101    71-94  (113)
 80 PF15616 TerY-C:  TerY-C metal   54.5     8.6 0.00019   28.1   1.7   24   78-106    78-101 (131)
 81 PF14803 Nudix_N_2:  Nudix N-te  54.1     8.4 0.00018   21.5   1.2   27  103-129     2-30  (34)
 82 PRK12495 hypothetical protein;  53.7      17 0.00036   28.9   3.3   12   77-88     42-53  (226)
 83 PF03604 DNA_RNApol_7kD:  DNA d  53.7     9.5 0.00021   21.0   1.4   23   79-101     2-25  (32)
 84 PRK00564 hypA hydrogenase nick  52.8     7.2 0.00016   27.6   1.0   24   78-101    72-96  (117)
 85 COG5574 PEX10 RING-finger-cont  52.6     3.2 6.8E-05   33.8  -0.9   44   79-130   217-260 (271)
 86 PRK01253 preprotein translocas  52.3     3.6 7.8E-05   25.5  -0.5   24    1-24     11-34  (54)
 87 PF09889 DUF2116:  Uncharacteri  51.7     6.3 0.00014   24.9   0.5   27   93-133     3-30  (59)
 88 PF09723 Zn-ribbon_8:  Zinc rib  50.9     7.4 0.00016   22.5   0.7    9   80-88      8-16  (42)
 89 PF12172 DUF35_N:  Rubredoxin-l  50.8     5.9 0.00013   22.0   0.3    8   95-102    13-20  (37)
 90 PF01907 Ribosomal_L37e:  Ribos  50.5     9.8 0.00021   23.7   1.2    7   96-102    18-24  (55)
 91 KOG1829|consensus               49.1     9.3  0.0002   34.4   1.3   56   76-131   339-403 (580)
 92 COG1996 RPC10 DNA-directed RNA  49.1     8.4 0.00018   23.4   0.8   23   79-101     8-32  (49)
 93 PF06750 DiS_P_DiS:  Bacterial   48.9       7 0.00015   26.6   0.4   25   78-102    34-67  (92)
 94 PF10497 zf-4CXXC_R1:  Zinc-fin  48.6     5.4 0.00012   27.8  -0.2   52   76-129     6-69  (105)
 95 PF15135 UPF0515:  Uncharacteri  47.8      12 0.00026   30.4   1.7   35   70-104   125-166 (278)
 96 PF02150 RNA_POL_M_15KD:  RNA p  47.5     9.7 0.00021   21.2   0.8   26  102-128     2-27  (35)
 97 PRK03824 hypA hydrogenase nick  46.6      10 0.00022   27.5   1.0   13   78-90     71-83  (135)
 98 COG0675 Transposase and inacti  46.1      14 0.00031   29.1   1.9   26   75-103   307-332 (364)
 99 PF13248 zf-ribbon_3:  zinc-rib  45.8      12 0.00027   19.2   1.0    7   79-85      4-10  (26)
100 TIGR00373 conserved hypothetic  45.7      10 0.00022   28.1   1.0   28   76-103   108-138 (158)
101 PF10170 C6_DPF:  Cysteine-rich  45.2      12 0.00027   25.9   1.2   34   93-134    49-84  (97)
102 PRK03681 hypA hydrogenase nick  45.2      11 0.00023   26.6   1.0   24   78-101    71-95  (114)
103 PF13920 zf-C3HC4_3:  Zinc fing  44.6     2.7 5.9E-05   24.8  -1.9   44   78-131     3-47  (50)
104 PRK12496 hypothetical protein;  44.4      14  0.0003   27.7   1.5   11   93-103   127-137 (164)
105 KOG1314|consensus               44.0      10 0.00022   32.4   0.7   33   67-101    76-113 (414)
106 TIGR01384 TFS_arch transcripti  43.8      14 0.00031   25.1   1.3   26   79-104     2-27  (104)
107 COG1545 Predicted nucleic-acid  43.6      13 0.00027   27.2   1.1    8   96-103    32-39  (140)
108 PF11238 DUF3039:  Protein of u  43.6      21 0.00046   22.4   2.0   15  118-132    41-55  (58)
109 PF01428 zf-AN1:  AN1-like Zinc  42.6      15 0.00032   21.2   1.1   15   93-107    13-27  (43)
110 KOG3896|consensus               42.2      13 0.00029   31.6   1.2   31   82-113    14-44  (449)
111 PF07503 zf-HYPF:  HypF finger;  41.2     6.6 0.00014   22.1  -0.5   16   80-95      2-18  (35)
112 COG1773 Rubredoxin [Energy pro  41.2      13 0.00028   23.1   0.8   37   92-128     2-43  (55)
113 COG1439 Predicted nucleic acid  41.0      13 0.00028   28.5   0.9   15   89-103   135-149 (177)
114 PRK04023 DNA polymerase II lar  40.7      24 0.00051   34.0   2.6   46   75-132   624-674 (1121)
115 KOG3362|consensus               40.7      11 0.00024   28.1   0.5   26   76-106   117-142 (156)
116 PF06741 LsmAD:  LsmAD domain;   40.6      24 0.00052   23.1   2.0   36    5-42      2-37  (72)
117 PRK06266 transcription initiat  40.5      12 0.00025   28.5   0.6   28   76-103   116-146 (178)
118 PF01529 zf-DHHC:  DHHC palmito  40.2      16 0.00035   26.5   1.3   28   73-102    44-71  (174)
119 smart00661 RPOL9 RNA polymeras  40.0      21 0.00045   20.9   1.5    8  121-128    20-27  (52)
120 PRK04136 rpl40e 50S ribosomal   39.3      18 0.00038   22.0   1.1   22   78-101    15-36  (48)
121 PF14835 zf-RING_6:  zf-RING of  39.2      18  0.0004   23.3   1.2   41   79-131     9-50  (65)
122 PHA02929 N1R/p28-like protein;  39.1     6.2 0.00014   31.5  -1.2   51   76-132   173-227 (238)
123 PF14446 Prok-RING_1:  Prokaryo  39.0      22 0.00048   22.0   1.5   25   78-102     6-30  (54)
124 PF13913 zf-C2HC_2:  zinc-finge  38.9     5.9 0.00013   20.4  -0.9   13   79-91      4-16  (25)
125 PRK11595 DNA utilization prote  38.8     7.7 0.00017   30.2  -0.7   29   79-109    22-56  (227)
126 PF14471 DUF4428:  Domain of un  38.6      18  0.0004   21.9   1.1   11  122-132    21-31  (51)
127 COG1327 Predicted transcriptio  38.4      16 0.00034   27.5   1.0   15   89-103    24-38  (156)
128 COG1198 PriA Primosomal protei  38.3      20 0.00044   33.2   1.8   32   79-110   446-484 (730)
129 KOG0119|consensus               37.1      54  0.0012   29.2   4.1   40    8-47    190-229 (554)
130 cd02341 ZZ_ZZZ3 Zinc finger, Z  37.0      14  0.0003   22.2   0.4   30   79-109     2-34  (48)
131 smart00109 C1 Protein kinase C  36.6      19 0.00042   20.2   1.0   32   77-108    11-42  (49)
132 KOG2462|consensus               36.2      13 0.00027   30.5   0.2   54   77-131   187-253 (279)
133 PF07754 DUF1610:  Domain of un  36.1      25 0.00054   18.2   1.2    8   93-100    16-23  (24)
134 smart00531 TFIIE Transcription  36.1      50  0.0011   24.0   3.3   30   74-103    96-133 (147)
135 PF00643 zf-B_box:  B-box zinc   35.7      14  0.0003   20.7   0.2   29   78-110     4-32  (42)
136 PF11023 DUF2614:  Protein of u  34.7      16 0.00034   26.1   0.4   24   79-102    71-94  (114)
137 PF00130 C1_1:  Phorbol esters/  34.7      29 0.00062   20.3   1.6   35   76-110    10-45  (53)
138 smart00184 RING Ring finger. E  34.5     8.8 0.00019   19.9  -0.7   15   97-111    14-28  (39)
139 PF01286 XPA_N:  XPA protein N-  34.3      21 0.00046   20.0   0.8   11   78-88      4-14  (34)
140 PF14445 Prok-RING_2:  Prokaryo  34.3     6.7 0.00014   24.2  -1.3   43   79-131     9-51  (57)
141 PF00301 Rubredoxin:  Rubredoxi  33.9      20 0.00044   21.4   0.8   13   93-105     1-13  (47)
142 cd02340 ZZ_NBR1_like Zinc fing  33.7      19 0.00041   20.9   0.6   30   79-110     2-32  (43)
143 PF10013 DUF2256:  Uncharacteri  33.5      25 0.00055   20.7   1.1   15   77-91      8-22  (42)
144 PTZ00073 60S ribosomal protein  33.4      22 0.00048   24.4   0.9    7   96-102    19-25  (91)
145 PF10263 SprT-like:  SprT-like   33.2      24 0.00052   25.3   1.2   10   79-88    125-134 (157)
146 PRK14892 putative transcriptio  33.1      33 0.00072   23.8   1.8   43   77-122    21-64  (99)
147 smart00291 ZnF_ZZ Zinc-binding  33.0      19  0.0004   20.9   0.5   21   78-100     5-25  (44)
148 PF00096 zf-C2H2:  Zinc finger,  32.9      15 0.00033   17.6   0.1   10   79-88      2-11  (23)
149 KOG4080|consensus               32.5      21 0.00046   27.2   0.8   14  119-132   104-117 (176)
150 TIGR00599 rad18 DNA repair pro  32.5      20 0.00043   30.8   0.8   48   75-132    24-71  (397)
151 PF13005 zf-IS66:  zinc-finger   32.2      29 0.00063   19.9   1.3   11   78-88      3-13  (47)
152 cd00202 ZnF_GATA Zinc finger D  31.8      17 0.00036   22.3   0.1   29   80-110     2-30  (54)
153 KOG1812|consensus               31.6      21 0.00045   30.4   0.7   32   78-110   307-340 (384)
154 PF07130 YebG:  YebG protein;    31.4      86  0.0019   20.7   3.5   43   11-53     26-68  (75)
155 PF09332 Mcm10:  Mcm10 replicat  31.4      20 0.00043   30.2   0.6    9   77-85    252-260 (344)
156 PF02591 DUF164:  Putative zinc  31.3      28 0.00061   21.0   1.1   25   78-102    23-55  (56)
157 KOG1311|consensus               31.1      22 0.00049   28.6   0.8   23   77-101   113-135 (299)
158 KOG2807|consensus               31.0      32  0.0007   29.1   1.7   51   71-128   324-374 (378)
159 TIGR00311 aIF-2beta translatio  30.9      23  0.0005   25.8   0.8   25   78-102    98-127 (133)
160 TIGR00244 transcriptional regu  30.6      30 0.00065   25.8   1.4   15   89-103    24-38  (147)
161 PF09947 DUF2180:  Uncharacteri  29.9      16 0.00035   23.7  -0.1   39   94-132    17-67  (68)
162 cd02249 ZZ Zinc finger, ZZ typ  29.6      21 0.00045   20.8   0.3   30   79-110     2-32  (46)
163 PF09862 DUF2089:  Protein of u  29.5      31 0.00067   24.5   1.2   26   80-107     1-26  (113)
164 PF05443 ROS_MUCR:  ROS/MUCR tr  29.0      15 0.00033   26.7  -0.4   20   74-94     69-88  (132)
165 PF11781 RRN7:  RNA polymerase   28.8      28 0.00061   19.5   0.7   24   79-102    10-34  (36)
166 PRK03564 formate dehydrogenase  28.4      45 0.00097   27.7   2.2   55   77-132   187-263 (309)
167 KOG3795|consensus               28.1      29 0.00062   26.9   0.9   23   87-109     9-34  (230)
168 PHA00733 hypothetical protein   28.0 1.2E+02  0.0027   21.6   4.2   26   78-103    74-109 (128)
169 PHA00732 hypothetical protein   28.0      47   0.001   21.9   1.8    9   80-88      4-12  (79)
170 TIGR00595 priA primosomal prot  27.7      40 0.00086   29.6   1.8   33   79-111   224-263 (505)
171 PF02148 zf-UBP:  Zn-finger in   27.7      40 0.00086   20.8   1.4   16   91-106     9-24  (63)
172 TIGR01562 FdhE formate dehydro  27.5      49  0.0011   27.4   2.2   56   77-132   184-263 (305)
173 KOG2593|consensus               27.4      93   0.002   27.2   3.9   34   77-110   128-170 (436)
174 PF12760 Zn_Tnp_IS1595:  Transp  27.4      44 0.00096   19.4   1.5   30   69-101    13-45  (46)
175 PF00569 ZZ:  Zinc finger, ZZ t  27.2      20 0.00043   21.0  -0.1   22   78-100     5-26  (46)
176 KOG0153|consensus               26.8      29 0.00063   29.5   0.8   23   72-94     36-58  (377)
177 PRK05452 anaerobic nitric oxid  26.2      61  0.0013   28.2   2.7   40   90-129   422-466 (479)
178 PRK13729 conjugal transfer pil  26.1   2E+02  0.0044   25.5   5.8   44    4-47     55-100 (475)
179 COG1645 Uncharacterized Zn-fin  25.9      38 0.00082   24.8   1.2   24   78-109    29-52  (131)
180 COG1997 RPL43A Ribosomal prote  25.7      50  0.0011   22.6   1.6   26   78-105    36-65  (89)
181 COG4338 Uncharacterized protei  25.7      22 0.00047   21.7  -0.1   15   78-92     13-27  (54)
182 PF03833 PolC_DP2:  DNA polymer  25.6      23  0.0005   33.4   0.0   32   92-130   654-689 (900)
183 PF11331 DUF3133:  Protein of u  25.4      38 0.00081   20.3   0.9   16  118-133     3-18  (46)
184 KOG1356|consensus               25.3      32 0.00069   32.4   0.8   34   77-112   229-262 (889)
185 PF13465 zf-H2C2_2:  Zinc-finge  25.3      38 0.00083   17.2   0.8    9   94-102    15-23  (26)
186 PRK14873 primosome assembly pr  25.1      40 0.00087   30.8   1.4   32   79-110   394-431 (665)
187 PRK03988 translation initiatio  25.1      34 0.00073   25.1   0.8   24   78-101   103-131 (138)
188 KOG1813|consensus               25.1      38 0.00082   28.2   1.1   28   79-110   243-270 (313)
189 KOG3183|consensus               24.9      26 0.00057   28.2   0.2   51   78-131     9-65  (250)
190 cd04476 RPA1_DBD_C RPA1_DBD_C:  24.9      37  0.0008   24.8   1.0   26   78-103    35-61  (166)
191 COG1998 RPS31 Ribosomal protei  24.8      44 0.00096   20.4   1.1   24   78-101    20-45  (51)
192 PF09845 DUF2072:  Zn-ribbon co  24.7      34 0.00074   25.0   0.8   24   78-101     2-27  (131)
193 smart00653 eIF2B_5 domain pres  24.7      34 0.00074   24.1   0.7   24   78-101    81-109 (110)
194 cd00350 rubredoxin_like Rubred  24.5      42 0.00091   18.2   0.9   10   94-103     2-11  (33)
195 cd02345 ZZ_dah Zinc finger, ZZ  24.4      32 0.00069   20.5   0.5   27   79-107     2-30  (49)
196 PRK06260 threonine synthase; V  24.4      48   0.001   27.9   1.7   24   79-102     5-28  (397)
197 PRK05978 hypothetical protein;  24.4      42 0.00091   24.9   1.2   26   78-103    34-62  (148)
198 PRK14559 putative protein seri  24.3      60  0.0013   29.7   2.4   45   79-131     3-51  (645)
199 PRK14714 DNA polymerase II lar  24.2      44 0.00096   33.0   1.6   28   93-127   667-698 (1337)
200 COG2888 Predicted Zn-ribbon RN  24.2      63  0.0014   20.5   1.8   32   77-108     9-42  (61)
201 PF01190 Pollen_Ole_e_I:  Polle  24.1      48   0.001   22.1   1.3   10  100-109     3-12  (97)
202 COG4530 Uncharacterized protei  24.0      41 0.00088   24.1   1.0   26   78-103    10-36  (129)
203 PF04423 Rad50_zn_hook:  Rad50   24.0      27 0.00058   21.0   0.1   11   79-89     22-32  (54)
204 smart00504 Ubox Modified RING   24.0      36 0.00077   20.4   0.6   30   79-112     3-32  (63)
205 KOG1315|consensus               23.9      39 0.00084   28.1   1.0   10  120-129   125-134 (307)
206 PF13240 zinc_ribbon_2:  zinc-r  23.9      39 0.00085   17.0   0.7    9   80-88      2-10  (23)
207 PRK03954 ribonuclease P protei  23.5 2.3E+02  0.0051   20.3   4.9   10   78-87     65-74  (121)
208 COG3364 Zn-ribbon containing p  23.4      31 0.00067   24.3   0.3   11   93-103     2-12  (112)
209 PRK07591 threonine synthase; V  23.3      50  0.0011   28.2   1.6   25   78-103    19-43  (421)
210 PRK12286 rpmF 50S ribosomal pr  23.3      55  0.0012   20.3   1.4    8  120-127    39-46  (57)
211 PRK14890 putative Zn-ribbon RN  23.1      84  0.0018   19.8   2.2   27   77-103     7-35  (59)
212 PF01147 Crust_neurohorm:  Crus  23.0      22 0.00049   23.3  -0.4   16  118-133    17-32  (73)
213 PF13894 zf-C2H2_4:  C2H2-type   23.0      32  0.0007   16.0   0.3   11   79-89      2-12  (24)
214 smart00731 SprT SprT homologue  22.7      57  0.0012   23.5   1.6   10   79-88    114-123 (146)
215 PRK04351 hypothetical protein;  22.7      51  0.0011   24.3   1.4   13  119-131   130-142 (149)
216 cd02342 ZZ_UBA_plant Zinc fing  22.5      36 0.00079   20.1   0.4   28   79-107     2-30  (43)
217 PRK00762 hypA hydrogenase nick  22.5      44 0.00095   23.8   1.0   11   78-89     71-81  (124)
218 PF03966 Trm112p:  Trm112p-like  22.5      55  0.0012   20.5   1.3   14   90-103    50-63  (68)
219 PF06397 Desulfoferrod_N:  Desu  22.4      41 0.00088   19.1   0.6   11   93-103     6-16  (36)
220 PRK04179 rpl37e 50S ribosomal   22.3      42 0.00091   21.4   0.7    7   96-102    20-26  (62)
221 PF06677 Auto_anti-p27:  Sjogre  22.0      55  0.0012   19.0   1.1   22   79-107    19-40  (41)
222 PRK09678 DNA-binding transcrip  21.8      61  0.0013   21.2   1.4   14   90-103    24-39  (72)
223 KOG4323|consensus               21.8      46   0.001   29.3   1.1   53   78-130   169-224 (464)
224 PF01667 Ribosomal_S27e:  Ribos  21.7      62  0.0013   20.1   1.4   27   79-105     9-38  (55)
225 PF13912 zf-C2H2_6:  C2H2-type   21.7      32 0.00069   17.1   0.1   11   79-89      3-13  (27)
226 cd07153 Fur_like Ferric uptake  21.6      47   0.001   22.5   0.9   13   96-108    76-88  (116)
227 PF04216 FdhE:  Protein involve  21.4      47   0.001   26.8   1.0   55   77-131   172-248 (290)
228 PF07776 zf-AD:  Zinc-finger as  21.0      30 0.00066   20.9  -0.1   16  118-133    42-57  (75)
229 KOG2932|consensus               21.0      45 0.00097   28.1   0.8   46   76-132    89-134 (389)
230 PF02945 Endonuclease_7:  Recom  20.9      40 0.00088   22.4   0.5   30   78-107    23-58  (81)
231 cd02336 ZZ_RSC8 Zinc finger, Z  20.8      41 0.00089   19.9   0.4   10  121-130    23-32  (45)
232 PRK10061 DNA damage-inducible   20.7      95   0.002   21.5   2.2   43   11-53     26-68  (96)
233 PRK02935 hypothetical protein;  20.3      48   0.001   23.4   0.7   25   79-103    72-96  (110)
234 cd00730 rubredoxin Rubredoxin;  20.2      54  0.0012   19.8   0.9   12   93-104     1-12  (50)
235 PRK08197 threonine synthase; V  20.2      61  0.0013   27.3   1.5   24   78-102     8-31  (394)
236 PHA02942 putative transposase;  20.2      82  0.0018   26.7   2.3   28   76-103   324-352 (383)
237 PRK12336 translation initiatio  20.1      47   0.001   25.6   0.8   26   78-103    99-129 (201)
238 PRK05580 primosome assembly pr  20.1      67  0.0014   29.3   1.8   32   79-110   392-430 (679)
239 KOG2177|consensus               20.0      22 0.00047   26.9  -1.1   31   78-112    14-44  (386)

No 1  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=99.85  E-value=2.1e-22  Score=130.89  Aligned_cols=64  Identities=50%  Similarity=1.155  Sum_probs=47.8

Q ss_pred             CccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCC----CCCCCcccCcccHHHhh
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALP----SAAKPVRVCDECNVKLV  132 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp----~~~~~~RVC~~C~~~l~  132 (140)
                      |.|+||.++..|+.|+++|++++||||||.||.+||+.|+.+.+++|    ....++|||+.||..|+
T Consensus         1 ~~W~~d~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~~~~~~RvC~~C~~~~~   68 (69)
T PF01363_consen    1 PHWVPDSEASNCMICGKKFSLFRRRHHCRNCGRVVCSSCSSQRIPLPTPSSGSGEPVRVCDSCYSKLQ   68 (69)
T ss_dssp             --SSSGGG-SB-TTT--B-BSSS-EEE-TTT--EEECCCS-EEEEET--GGTESEEEEE-HHHHHHHH
T ss_pred             CCcCCCCCCCcCcCcCCcCCCceeeEccCCCCCEECCchhCCEEcccccccCCCCcCEECHHHHHHhc
Confidence            68999999999999999999999999999999999999999999888    23899999999999875


No 2  
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the KOG1729|consensus
Probab=99.71  E-value=1.5e-18  Score=140.53  Aligned_cols=71  Identities=48%  Similarity=1.007  Sum_probs=65.7

Q ss_pred             HhhccCCccccCcCCcccccccc-ccccccccccccccCceEeCCCCCCeeeCCCC-CCCcccCcccHHHhhc
Q psy1895          63 AKRATEAQWAKDKEAITCRACDK-EFTVTRRRHHCRNCGEIFCNMCSDNKMALPSA-AKPVRVCDECNVKLVE  133 (140)
Q Consensus        63 ~l~~~~~~W~~~~~~~~C~~C~~-~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~-~~~~RVC~~C~~~l~~  133 (140)
                      .....++.|+||.++..|+.|++ .|+++.||||||+||.|||..|+.++..+|.. .+|+|||+.||..|..
T Consensus       154 ~~~~~~~~W~PD~ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~~Cs~n~~~l~~~~~k~~rvC~~CF~el~~  226 (288)
T KOG1729|consen  154 PSNNSAAVWLPDSEATECMVCGCTEFTLSERRHHCRNCGDIVCAPCSRNRFLLPNLSTKPIRVCDICFEELEK  226 (288)
T ss_pred             CCCCcCCcccCcccceecccCCCccccHHHHHHHHHhcchHhhhhhhcCcccccccCCCCceecHHHHHHHhc
Confidence            34456799999999999999999 99999999999999999999999999889987 8999999999999864


No 4  
>KOG1818|consensus
Probab=99.60  E-value=2.7e-16  Score=137.52  Aligned_cols=67  Identities=43%  Similarity=1.019  Sum_probs=60.5

Q ss_pred             ccCCccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCC--CCCcccCcccHHHhhccc
Q psy1895          66 ATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSA--AKPVRVCDECNVKLVEKL  135 (140)
Q Consensus        66 ~~~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~--~~~~RVC~~C~~~l~~~~  135 (140)
                      ...+.|++..   .|..|..+|++++|+||||+||+|||..|++...+||..  .+|||||+.||+.+....
T Consensus       157 ~~~pdW~D~~---~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~C~E~l~~~s  225 (634)
T KOG1818|consen  157 ETAPDWIDSE---ECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDSCYELLTRAS  225 (634)
T ss_pred             cCCccccccc---ccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhhhHHHhhhcc
Confidence            3568998754   899999999999999999999999999999999999987  699999999999987643


No 5  
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=99.58  E-value=6.1e-16  Score=96.69  Aligned_cols=53  Identities=64%  Similarity=1.333  Sum_probs=49.6

Q ss_pred             CccccccccccccccccccccccCceEeCCCCCCeeeCCC--CCCCcccCcccHH
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPS--AAKPVRVCDECNV  129 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~--~~~~~RVC~~C~~  129 (140)
                      +..|..|+++|+++.|+|||+.||.+||..|+.+...+|.  ...|+|||+.||.
T Consensus         2 ~~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C~~~~~~~~~~~~~~~~rvC~~C~~   56 (57)
T cd00065           2 ASSCMGCGKPFTLTRRRHHCRNCGRIFCSKCSSNRIPLPSMGGGKPVRVCDSCYE   56 (57)
T ss_pred             cCcCcccCccccCCccccccCcCcCCcChHHcCCeeecCcccCCCccEeChHHhC
Confidence            4579999999999999999999999999999999999987  4899999999985


No 6  
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=99.56  E-value=1.3e-15  Score=135.32  Aligned_cols=66  Identities=32%  Similarity=0.781  Sum_probs=53.9

Q ss_pred             cCCccccCcCC-ccccccccccccc-----cccccccccCceEeCCCCCCeeeCC-------CC---CCCcccCcccHHH
Q psy1895          67 TEAQWAKDKEA-ITCRACDKEFTVT-----RRRHHCRNCGEIFCNMCSDNKMALP-------SA---AKPVRVCDECNVK  130 (140)
Q Consensus        67 ~~~~W~~~~~~-~~C~~C~~~F~~~-----~rkhhCr~CG~i~C~~Cs~~~~~lp-------~~---~~~~RVC~~C~~~  130 (140)
                      ..|.|++|+++ ..|+.|+++|+.+     .||||||+||.+||+.||+++...|       ..   ..+.|||+.||+.
T Consensus       449 hAPvWqpDDEaSdtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~CSSnRs~yp~aKLpKPgsseE~ppRRVCD~CYdq  528 (1374)
T PTZ00303        449 HNPSWQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCDTCYKE  528 (1374)
T ss_pred             cCCCCCCCcccCCcccCcCCcccccccccccccccccCCccccCccccCCcccCcccccCCCCCcccccccchhHHHHHH
Confidence            45999999984 8899999999854     6999999999999999999876432       22   3467899999966


Q ss_pred             hh
Q psy1895         131 LV  132 (140)
Q Consensus       131 l~  132 (140)
                      +.
T Consensus       529 ~E  530 (1374)
T PTZ00303        529 YE  530 (1374)
T ss_pred             HH
Confidence            53


No 7  
>KOG1819|consensus
Probab=99.52  E-value=3.2e-15  Score=128.36  Aligned_cols=63  Identities=44%  Similarity=0.994  Sum_probs=59.0

Q ss_pred             CCccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCC--CCCcccCc-----ccHHH
Q psy1895          68 EAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSA--AKPVRVCD-----ECNVK  130 (140)
Q Consensus        68 ~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~--~~~~RVC~-----~C~~~  130 (140)
                      .|-|+||.++..|+.|+.+|+.|+|+||||+||.|||..|+...+|+|..  .+.+|||.     .||..
T Consensus       892 ppawipd~~a~~cmacq~pf~afrrrhhcrncggifcg~cs~asapip~~gl~ka~rvcrpqsnldc~~r  961 (990)
T KOG1819|consen  892 PPAWIPDEDAEQCMACQMPFNAFRRRHHCRNCGGIFCGKCSCASAPIPEHGLDKAPRVCRPQSNLDCLTR  961 (990)
T ss_pred             CcccCCCCcchhhhhccCcHHHHHHhhhhcccCceeecccccCCCCCcccccccCceecCCcccccceee
Confidence            47899999999999999999999999999999999999999999999976  78999999     78754


No 8  
>KOG1842|consensus
Probab=99.38  E-value=9.5e-14  Score=117.10  Aligned_cols=67  Identities=36%  Similarity=0.879  Sum_probs=56.6

Q ss_pred             cCCccccCcCCccccccccccccccccccccccCceEeCCCCCCeee-------------------------CCCCCCCc
Q psy1895          67 TEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMA-------------------------LPSAAKPV  121 (140)
Q Consensus        67 ~~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~-------------------------lp~~~~~~  121 (140)
                      ....|++|.++..|+.|..+|++++|+||||.||.|+|.+|+.+ ++                         |+....+.
T Consensus       170 svVpW~DDs~V~~CP~Ca~~F~l~rRrHHCRLCG~VmC~~C~k~-iSle~a~~ltsss~~dt~~e~~qq~~~lH~~~~~i  248 (505)
T KOG1842|consen  170 SVVPWLDDSSVQFCPECANSFGLTRRRHHCRLCGRVMCRDCSKF-ISLEIAIGLTSSSASDTHFEPNQQKDDLHQHPQPI  248 (505)
T ss_pred             ccccccCCCcccccccccchhhhHHHhhhhhhcchHHHHHHHHh-cChHHHHHHhhccCCCCCcCcccCcccccCChhHh
Confidence            44889999999999999999999999999999999999999876 22                         11124569


Q ss_pred             ccCcccHHHhhcc
Q psy1895         122 RVCDECNVKLVEK  134 (140)
Q Consensus       122 RVC~~C~~~l~~~  134 (140)
                      |+|..|...|..+
T Consensus       249 RlC~hCl~~L~~R  261 (505)
T KOG1842|consen  249 RLCMHCLDNLFRR  261 (505)
T ss_pred             HHHHHHHHHHHHH
Confidence            9999999888643


No 9  
>KOG1841|consensus
Probab=99.10  E-value=1.8e-11  Score=112.02  Aligned_cols=64  Identities=36%  Similarity=0.765  Sum_probs=54.6

Q ss_pred             hhccCCccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCC-CCCcccCccc
Q psy1895          64 KRATEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSA-AKPVRVCDEC  127 (140)
Q Consensus        64 l~~~~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~-~~~~RVC~~C  127 (140)
                      ++...|.|+||..+..||.|..+|++++||||||+||+|+|+.|+..+..+-.. ..-.|||..|
T Consensus       544 lgkkqP~wvpdse~pncm~clqkft~ikrrhhcRacgkVlcgvccnek~~leyl~e~~~rv~nV~  608 (1287)
T KOG1841|consen  544 LGKKQPSWVPDSEAPNCMDCLQKFTPIKRRHHCRACGKVLCGVCCNEKSALEYLSESEGRVSNVD  608 (1287)
T ss_pred             cCCCCCccCccccCchHHHHHhhcccccccccchhccceeehhhcchhhhhhhcCcccccccccc
Confidence            455679999999999999999999999999999999999999999998777654 3445666555


No 10 
>KOG1843|consensus
Probab=98.58  E-value=1.4e-08  Score=85.53  Aligned_cols=109  Identities=21%  Similarity=0.163  Sum_probs=76.0

Q ss_pred             hcchhhhhHHHHHHHHHHHHHhhhhhhHHHHH--HHHHH----HHHHhhccCCccccCcCCccccccccccc-ccccccc
Q psy1895          23 VKDNVSDDKYKESELALEELGAQLSKSKLQVS--DLMEE----HQIAKRATEAQWAKDKEAITCRACDKEFT-VTRRRHH   95 (140)
Q Consensus        23 ~~~~~~r~~~~~~~~~l~~~~~~l~~s~~~~~--~l~~~----~~~~l~~~~~~W~~~~~~~~C~~C~~~F~-~~~rkhh   95 (140)
                      +.+.+.-...+++.+.+.+++...-.+...+.  .|-+.    ....++.-+|.|.+++....|+.|..+|+ ++-||||
T Consensus       100 ltd~V~ilNs~~av~~f~~~G~itLGgn~svsAgPLgr~aea~a~asl~~~ap~f~yskskglfagvSvegsaI~erR~a  179 (473)
T KOG1843|consen  100 LTDFVIILNSALAVQSFARFGTITLGGNLSVSAGPLGRNAEAAASASLGGEAPVFLYSKSKGLFAGVSVEGSAIIERREA  179 (473)
T ss_pred             HHHHHHhhcchHhhhhhhhcCeeeecCcceeccCcccccchhhhhhhhcCcCccccccccccceeeeecccceeeecchh
Confidence            44444444555666777776654321211111  11111    11134445699999999999999999999 7899999


Q ss_pred             ccccCceEeCCCCCCeeeCC--CC-CCCcccCcccHHHh
Q psy1895          96 CRNCGEIFCNMCSDNKMALP--SA-AKPVRVCDECNVKL  131 (140)
Q Consensus        96 Cr~CG~i~C~~Cs~~~~~lp--~~-~~~~RVC~~C~~~l  131 (140)
                      ||.|+.+||-.|+.-.-.+|  .. ..+.|||+.|+..|
T Consensus       180 nR~~yg~~cra~~ilsg~vp~p~a~d~l~RVldS~~~nl  218 (473)
T KOG1843|consen  180 NRKFYGIFCRAKSILSGLVPVPFAADPLQRVLDSCAFNL  218 (473)
T ss_pred             hhhhcCccchhhhhhccCCCCCcccCCHHHHHhhHhhcc
Confidence            99999999999988754444  33 78899999999988


No 11 
>KOG1409|consensus
Probab=98.45  E-value=3.7e-08  Score=81.64  Aligned_cols=62  Identities=35%  Similarity=0.961  Sum_probs=53.7

Q ss_pred             CccccCcCCccccccccccc-----------cccccccccccCceEeCCCCCCeeeCCCC--CCCcccCcccHHHhhc
Q psy1895          69 AQWAKDKEAITCRACDKEFT-----------VTRRRHHCRNCGEIFCNMCSDNKMALPSA--AKPVRVCDECNVKLVE  133 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~-----------~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~--~~~~RVC~~C~~~l~~  133 (140)
                      |.|..++   .|..|+.+|.           +-.|.||||.||..+|..|++++...|..  +-.+|+|+.||..|..
T Consensus       277 pewl~s~---~cQ~c~qpffwn~~~m~~~k~~glr~h~crkcg~avc~~c~s~~~~~p~mg~e~~vR~~~~c~~~i~~  351 (404)
T KOG1409|consen  277 PEWLDSD---SCQKCNQPFFWNFRQMWDRKQLGLRQHHCRKCGKAVCGKCSSNRSSYPTMGFEFSVRVCDSCYPTIKD  351 (404)
T ss_pred             ccccccc---hhhhhCchHHHHHHHHHhhhhhhhhhhhhhhhhhhcCcccccCccccccccceeEEEEecccchhhhc
Confidence            8898876   8999999985           23578999999999999999998877764  7889999999999864


No 12 
>KOG4424|consensus
Probab=98.30  E-value=2.1e-07  Score=81.18  Aligned_cols=65  Identities=28%  Similarity=0.656  Sum_probs=55.7

Q ss_pred             CCccccCcCCccccccccccc-cccccccccccCceEeCCCCCCeeeCCCC-CCCcccCcccHHHhhcc
Q psy1895          68 EAQWAKDKEAITCRACDKEFT-VTRRRHHCRNCGEIFCNMCSDNKMALPSA-AKPVRVCDECNVKLVEK  134 (140)
Q Consensus        68 ~~~W~~~~~~~~C~~C~~~F~-~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~-~~~~RVC~~C~~~l~~~  134 (140)
                      .++|  ++....|+.|+.+|+ ...++|||+.||.++|+.|+.+...+.+. ....|||..||....+.
T Consensus       408 ~~r~--~~k~~~c~~c~e~~~s~t~~R~~~k~~~~vlc~~cs~~~~~l~~~~s~ssrv~~~~~~~~~~a  474 (623)
T KOG4424|consen  408 APRR--DNKVTSCDSCEETFNSITFRRHRCKAKGAVLCDKCSDFMAKLSYDNSRSSRVCMDRYLTPSGA  474 (623)
T ss_pred             Cccc--ccccccchhhcCchhhHHHhhhhhhhccceeeccccchhhhhcccccchhhhhhhhccCCCCC
Confidence            4567  777889999999998 67889999999999999999998877643 78889999999886653


No 13 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=97.90  E-value=5.7e-05  Score=53.87  Aligned_cols=51  Identities=25%  Similarity=0.657  Sum_probs=41.0

Q ss_pred             CCccccccccccccc-cccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          76 EAITCRACDKEFTVT-RRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~-~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      ....|..|..+|+++ ++.+.|..|+..||..|..+     ....+.-+|..|++.-
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~-----~~~~~~WlC~vC~k~r  104 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY-----SKKEPIWLCKVCQKQR  104 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE-----TSSSCCEEEHHHHHHH
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccCCc-----CCCCCCEEChhhHHHH
Confidence            345899999999976 57888999999999999876     2257889999999764


No 14 
>KOG1811|consensus
Probab=97.57  E-value=4.4e-06  Score=74.26  Aligned_cols=63  Identities=30%  Similarity=0.715  Sum_probs=51.0

Q ss_pred             CCccccCc----CCcccccc-ccccccccccccccccCceEeCCCCCCeeeCCC--CCCCcccCcccHHH
Q psy1895          68 EAQWAKDK----EAITCRAC-DKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPS--AAKPVRVCDECNVK  130 (140)
Q Consensus        68 ~~~W~~~~----~~~~C~~C-~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~--~~~~~RVC~~C~~~  130 (140)
                      ..+|+||.    .-..|+.| +..|..++||||||.||...|..|...+.....  +..|.++|+.|+..
T Consensus       313 l~nfq~darrafs~a~~~a~~R~~~kd~~Rk~~~~g~Ga~e~aa~ea~kgiqEd~gse~~Adg~Dq~psv  382 (1141)
T KOG1811|consen  313 LHNFQPDARRAFSEAICMACCREHFKDFNRKHHCRGCGALECAACEAKKGIQEDCGSENPADGCDQCPSV  382 (1141)
T ss_pred             hhhcChhhhhhhhhhHHHHHHHHHHHHHHHhhhccccchHHHhHHHHhhhhhhcccccCcccccccccch
Confidence            46799987    44567754 557999999999999999999999988765543  37899999999954


No 15 
>KOG0230|consensus
Probab=97.32  E-value=0.00014  Score=69.46  Aligned_cols=49  Identities=43%  Similarity=1.055  Sum_probs=40.2

Q ss_pred             CccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhcc
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVEK  134 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~~  134 (140)
                      ...|..|+   +.++++|||+.||++||+.|...      .....|||..|+......
T Consensus         5 ~~~~~~~~---t~~~~~~~~~~~g~~~~~~~~~~------~~~~i~~~~~~~~~~~~~   53 (1598)
T KOG0230|consen    5 SNVCYDCD---TSVNRRHHCRVCGRVFCSKCQDS------PETSIRVCNECRGQWEQG   53 (1598)
T ss_pred             ccchhccc---cccccCCCCcccCceeccccCCC------Cccceeehhhhhhhcccc
Confidence            45677787   78899999999999999999833      234899999999987653


No 16 
>KOG0230|consensus
Probab=96.84  E-value=0.00067  Score=65.02  Aligned_cols=34  Identities=44%  Similarity=1.199  Sum_probs=33.2

Q ss_pred             ccCcCCccccccccccccccccccccccCceEeCCC
Q psy1895          72 AKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        72 ~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      .||.....|..|...|..++|+|||  ||+|||..|
T Consensus        92 m~d~s~~ec~~~~~~~~t~Rr~~~~--~gqi~~ss~  125 (1598)
T KOG0230|consen   92 MPDSSSKECYDCEQKFETFRRKHHC--CGQIFCSSC  125 (1598)
T ss_pred             CCccccchhhhhccchhhhhccccc--CccccCCcc
Confidence            8889999999999999999999999  999999999


No 17 
>KOG0993|consensus
Probab=95.53  E-value=0.0017  Score=55.50  Aligned_cols=65  Identities=23%  Similarity=0.548  Sum_probs=55.7

Q ss_pred             CccccCcCCccccccccccccccccccccc--cCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTRRRHHCRN--CGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~--CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      ..|.-+.+...|..|..+|..++-.-||-+  |++|||-.|+...+|--.+..|..||..|+..+.+
T Consensus       460 le~ql~~~ve~c~~~~aS~~slk~e~erl~qq~eqi~~~~~~Katvp~l~~e~~akv~rlq~eL~~s  526 (542)
T KOG0993|consen  460 LEWQLDDDVEQCSNCDASFASLKVEPERLHQQCEQIFCMNCLKATVPSLPNERPAKVCRLQHELLNS  526 (542)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhHHHhhcccccccchHHHHHHHHHHhhh
Confidence            567778888999999999999999999988  99999999998765544458999999999988764


No 18 
>KOG1841|consensus
Probab=94.42  E-value=0.022  Score=53.75  Aligned_cols=56  Identities=30%  Similarity=0.449  Sum_probs=46.9

Q ss_pred             cCCccccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          67 TEAQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        67 ~~~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      .++.|++|..+..|+.|.+.|.++.++||||  |.++         .+-.+.+..|+|..|+..+..
T Consensus       647 ~ksVw~aDg~aPng~la~t~~~~~~e~~hsr--~~ls---------~~~~s~~~~~~~n~t~s~~rn  702 (1287)
T KOG1841|consen  647 VKSVWFADGIAPNGELAETRFTFTGERHHSR--GKLS---------LLYSSRKEARPCNITHSVLRN  702 (1287)
T ss_pred             ecceeccCCcCCCceecccceeeeccccccc--cccc---------ccccccccCCCCcccCccchh
Confidence            4589999999999999999999999999999  8877         222235677999999887765


No 19 
>KOG1729|consensus
Probab=93.04  E-value=0.018  Score=47.25  Aligned_cols=62  Identities=27%  Similarity=0.628  Sum_probs=49.9

Q ss_pred             CccccCcCCccccccccccccccccccccccCceEeCCCCC-Ce--eeC-CCC----CCCcccCcccHHH
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSD-NK--MAL-PSA----AKPVRVCDECNVK  130 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~-~~--~~l-p~~----~~~~RVC~~C~~~  130 (140)
                      +.|+.+.++..|..|...|.+..|.|||+.||+++|..|.. ..  ..+ |..    ..+..+|..|+..
T Consensus        12 ~~~~~~~e~~s~~~~~~e~~~~~r~~~~~~~grv~~~q~~~~k~~rk~~q~r~~~l~~D~~~~~~~~~~~   81 (288)
T KOG1729|consen   12 VDWQANSEANSCRNCKVEFCFGRRGHPCRECGRVLCRQGTLVKRCRKKLQSRSFFLFNDILVYGNIVSDN   81 (288)
T ss_pred             HHHHHhccchhhhhhcccchhhhccCcccccchhhhhhhhhHHHHhcccccccccccccchhhcccccCH
Confidence            77899999999999999999999999999999999999987 11  111 111    5667788888766


No 20 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=91.88  E-value=0.031  Score=34.39  Aligned_cols=43  Identities=28%  Similarity=0.675  Sum_probs=24.7

Q ss_pred             cccccccccccc------cccccccccCceEeCCCCCCeeeCCCCCCCcccCccc
Q psy1895          79 TCRACDKEFTVT------RRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDEC  127 (140)
Q Consensus        79 ~C~~C~~~F~~~------~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C  127 (140)
                      .|..|.++|...      ..++.|..|+++||..|=.+-      ......|.-|
T Consensus         1 ~CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fi------HE~LH~CPGC   49 (51)
T PF07975_consen    1 YCFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFI------HETLHNCPGC   49 (51)
T ss_dssp             EETTTTEE-TTS-------EEE--TTTT--B-HHHHHTT------TTTS-SSSTT
T ss_pred             CCccCCCCCCCcccccccCCeEECCCCCCccccCcChhh------hccccCCcCC
Confidence            378899999875      367999999999999985441      2344555554


No 21 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=91.59  E-value=0.15  Score=36.37  Aligned_cols=35  Identities=26%  Similarity=0.611  Sum_probs=28.1

Q ss_pred             CCccccccccccccc----------cccccccccCceEeCCCCCC
Q psy1895          76 EAITCRACDKEFTVT----------RRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~----------~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      ....|..|+.+|...          ..++.|..|..+||.+|=.+
T Consensus        54 ~~~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~f   98 (112)
T TIGR00622        54 GSRFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVF   98 (112)
T ss_pred             CCCcccCcCCCCCCcccccccccccccceeCCCCCCccccccchh
Confidence            345699999999742          34678999999999999655


No 22 
>KOG4275|consensus
Probab=90.60  E-value=0.03  Score=46.06  Aligned_cols=52  Identities=29%  Similarity=0.784  Sum_probs=43.3

Q ss_pred             ccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHH
Q psy1895          72 AKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVK  130 (140)
Q Consensus        72 ~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~  130 (140)
                      -+...+.+|..|+..|..+.+||-|-.|.+-||..||..       ....|.|..|...
T Consensus        39 s~~~~~p~ckacg~~f~~~~~k~~c~dckk~fc~tcs~v-------~~~lr~c~~c~r~   90 (350)
T KOG4275|consen   39 SSSSQAPHCKACGEEFEDAQSKSDCEDCKKEFCATCSRV-------SISLRTCTSCRRV   90 (350)
T ss_pred             CcccccchhhhhchhHhhhhhhhhhhhhhHHHHHHHHHh-------cccchhhhHHHHH
Confidence            344556799999999999999999999999999999944       3456888888754


No 23 
>KOG3799|consensus
Probab=88.89  E-value=1.3  Score=32.85  Aligned_cols=50  Identities=32%  Similarity=0.766  Sum_probs=36.6

Q ss_pred             Ccccccccc-ccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHH
Q psy1895          77 AITCRACDK-EFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNV  129 (140)
Q Consensus        77 ~~~C~~C~~-~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~  129 (140)
                      ...|.+|.+ +|.- .=-|.|..|.--||..|... +.+ .+++-..||+.|-.
T Consensus        65 datC~IC~KTKFAD-G~GH~C~YCq~r~CARCGGr-v~l-rsNKv~wvcnlc~k  115 (169)
T KOG3799|consen   65 DATCGICHKTKFAD-GCGHNCSYCQTRFCARCGGR-VSL-RSNKVMWVCNLCRK  115 (169)
T ss_pred             Ccchhhhhhccccc-ccCcccchhhhhHHHhcCCe-eee-ccCceEEeccCCcH
Confidence            347999988 3542 23488999999999999865 322 23677889999964


No 24 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.37  E-value=0.33  Score=34.25  Aligned_cols=32  Identities=25%  Similarity=0.622  Sum_probs=23.2

Q ss_pred             CccccCcCCcccccccccccccccc-ccccccCceE
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTRRR-HHCRNCGEIF  103 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~rk-hhCr~CG~i~  103 (140)
                      +-|--.   ..|+.|+++|==|+|. ..|..||.+|
T Consensus         4 pelGtK---R~Cp~CG~kFYDLnk~PivCP~CG~~~   36 (108)
T PF09538_consen    4 PELGTK---RTCPSCGAKFYDLNKDPIVCPKCGTEF   36 (108)
T ss_pred             cccCCc---ccCCCCcchhccCCCCCccCCCCCCcc
Confidence            455443   4899999999866554 4488888876


No 25 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=87.56  E-value=0.12  Score=30.22  Aligned_cols=42  Identities=29%  Similarity=0.762  Sum_probs=27.3

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCccc
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDEC  127 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C  127 (140)
                      +|..|...|+ -.++..=-.||++||..|.....      ....+|..|
T Consensus         1 ~C~~C~~~~~-~~~~~~l~~CgH~~C~~C~~~~~------~~~~~CP~C   42 (44)
T PF14634_consen    1 HCNICFEKYS-EERRPRLTSCGHIFCEKCLKKLK------GKSVKCPIC   42 (44)
T ss_pred             CCcCcCcccc-CCCCeEEcccCCHHHHHHHHhhc------CCCCCCcCC
Confidence            4778888882 12233345899999999987654      234555555


No 26 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=87.40  E-value=0.3  Score=36.55  Aligned_cols=25  Identities=40%  Similarity=0.870  Sum_probs=19.4

Q ss_pred             cccccccccc------------cccccccccccCceE
Q psy1895          79 TCRACDKEFT------------VTRRRHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~------------~~~rkhhCr~CG~i~  103 (140)
                      .|+.|+.+++            ..+|+++|++||..|
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f   38 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRF   38 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcc
Confidence            5888888772            355678999999877


No 27 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=86.60  E-value=0.41  Score=27.07  Aligned_cols=25  Identities=32%  Similarity=1.063  Sum_probs=17.4

Q ss_pred             cccccccccccc-------cccccccccCceE
Q psy1895          79 TCRACDKEFTVT-------RRRHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~~~-------~rkhhCr~CG~i~  103 (140)
                      .|..|++.|.+-       .++..|.+||++|
T Consensus         4 ~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHCCCCCcEEECCCCCCEe
Confidence            588888888732       3456677887765


No 28 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=86.27  E-value=0.44  Score=27.49  Aligned_cols=26  Identities=38%  Similarity=1.063  Sum_probs=19.0

Q ss_pred             ccccccccccccccccccccCceEeCCC
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      |..|++.-.++  ...|+.|+.+||...
T Consensus         1 C~~C~~~~~l~--~f~C~~C~~~FC~~H   26 (39)
T smart00154        1 CHFCRKKVGLT--GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CcccCCccccc--CeECCccCCcccccc
Confidence            55677765554  577999999998754


No 29 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=85.77  E-value=0.26  Score=32.27  Aligned_cols=55  Identities=24%  Similarity=0.588  Sum_probs=27.8

Q ss_pred             cccccccccccccccccccccCce-----EeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI-----FCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i-----~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      .|+.|+.+........||..|+.-     +|..|-..-..|-.-+..--.|..|+..++.
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~Le~LkACGAvdYFC~~c~gLiSK   62 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQPLEVLKACGAVDYFCNHCHGLISK   62 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB-EEEEETTEEEEE-TTTT-EE-T
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccHHHHHHHhcccceeeccCCceeec
Confidence            588888887777778888888764     5666655433222223334556666665543


No 30 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=85.73  E-value=0.4  Score=27.20  Aligned_cols=25  Identities=40%  Similarity=1.079  Sum_probs=18.4

Q ss_pred             cccccccccccc-------cccccccccCceE
Q psy1895          79 TCRACDKEFTVT-------RRRHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~~~-------~rkhhCr~CG~i~  103 (140)
                      .|+.|+..|.+-       .++..|..||.+|
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            688899988743       3466788888776


No 31 
>KOG2164|consensus
Probab=84.48  E-value=0.26  Score=43.18  Aligned_cols=51  Identities=29%  Similarity=0.573  Sum_probs=39.1

Q ss_pred             ccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      ..|++|=.++.+-.+-    +||+|||..|.-+....+ .....+-|..|+..+..
T Consensus       187 ~~CPICL~~~~~p~~t----~CGHiFC~~CiLqy~~~s-~~~~~~~CPiC~s~I~~  237 (513)
T KOG2164|consen  187 MQCPICLEPPSVPVRT----NCGHIFCGPCILQYWNYS-AIKGPCSCPICRSTITL  237 (513)
T ss_pred             CcCCcccCCCCccccc----ccCceeeHHHHHHHHhhh-cccCCccCCchhhhccc
Confidence            5899999988865553    499999999987655444 35667889999988754


No 32 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.46  E-value=0.79  Score=33.36  Aligned_cols=26  Identities=27%  Similarity=0.353  Sum_probs=20.6

Q ss_pred             ccccccccccccc-cccccccccCceE
Q psy1895          78 ITCRACDKEFTVT-RRRHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~-~rkhhCr~CG~i~  103 (140)
                      ..|+.|+++|=-| +.-..|..||.+|
T Consensus        10 r~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300        10 RICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             ccCCCcCccccccCCCCccCCCcCCcc
Confidence            4899999999854 5566788888876


No 33 
>KOG0320|consensus
Probab=82.72  E-value=0.15  Score=39.16  Aligned_cols=47  Identities=23%  Similarity=0.721  Sum_probs=33.2

Q ss_pred             ccccccccccccccccc-cccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          78 ITCRACDKEFTVTRRRH-HCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkh-hCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      -.|.+|-.+|+   .+. ---.||+|||..|....+      +..++|..|.+.|..
T Consensus       132 ~~CPiCl~~~s---ek~~vsTkCGHvFC~~Cik~al------k~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  132 YKCPICLDSVS---EKVPVSTKCGHVFCSQCIKDAL------KNTNKCPTCRKKITH  179 (187)
T ss_pred             cCCCceecchh---hccccccccchhHHHHHHHHHH------HhCCCCCCcccccch
Confidence            35777766665   222 346899999999987643      467899999987754


No 34 
>KOG3576|consensus
Probab=82.44  E-value=0.26  Score=38.97  Aligned_cols=32  Identities=44%  Similarity=1.010  Sum_probs=23.7

Q ss_pred             ccCcCCccccccccccc---cccc---------cccccccCceE
Q psy1895          72 AKDKEAITCRACDKEFT---VTRR---------RHHCRNCGEIF  103 (140)
Q Consensus        72 ~~~~~~~~C~~C~~~F~---~~~r---------khhCr~CG~i~  103 (140)
                      -+|.+.-.|.+|++.|+   +++|         ||-|..||+.|
T Consensus       112 ssd~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgf  155 (267)
T KOG3576|consen  112 SSDQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGF  155 (267)
T ss_pred             CCCCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcc
Confidence            34566678999999998   3433         67788888876


No 35 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=80.72  E-value=0.46  Score=27.42  Aligned_cols=33  Identities=24%  Similarity=0.595  Sum_probs=24.3

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCee
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      .|.+|...|..-..-.-. .||++||..|...++
T Consensus         2 ~C~IC~~~~~~~~~~~~l-~C~H~fh~~Ci~~~~   34 (44)
T PF13639_consen    2 ECPICLEEFEDGEKVVKL-PCGHVFHRSCIKEWL   34 (44)
T ss_dssp             CETTTTCBHHTTSCEEEE-TTSEEEEHHHHHHHH
T ss_pred             CCcCCChhhcCCCeEEEc-cCCCeeCHHHHHHHH
Confidence            689999999753333334 499999999987654


No 36 
>PF12773 DZR:  Double zinc ribbon
Probab=80.25  E-value=1.3  Score=26.25  Aligned_cols=29  Identities=24%  Similarity=0.622  Sum_probs=18.7

Q ss_pred             CcCCccccccccccc-cccccccccccCce
Q psy1895          74 DKEAITCRACDKEFT-VTRRRHHCRNCGEI  102 (140)
Q Consensus        74 ~~~~~~C~~C~~~F~-~~~rkhhCr~CG~i  102 (140)
                      +.++..|..|+.++. .......|..||..
T Consensus         9 ~~~~~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen    9 PDDAKFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             CccccCChhhcCChhhccCCCCCCcCCcCC
Confidence            344678888888877 23334567777664


No 37 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=79.38  E-value=1.8  Score=26.34  Aligned_cols=33  Identities=24%  Similarity=0.624  Sum_probs=20.5

Q ss_pred             ccccc--ccccccccccc----ccccccCceEeCCCCCC
Q psy1895          78 ITCRA--CDKEFTVTRRR----HHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        78 ~~C~~--C~~~F~~~~rk----hhCr~CG~i~C~~Cs~~  110 (140)
                      ..|+.  |+..|..-...    ..|..||..||..|...
T Consensus        19 ~~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~   57 (64)
T PF01485_consen   19 RWCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEP   57 (64)
T ss_dssp             C--TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSE
T ss_pred             cCCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCcc
Confidence            46765  88877643332    67999999999999764


No 38 
>KOG0978|consensus
Probab=78.92  E-value=0.73  Score=42.04  Aligned_cols=44  Identities=25%  Similarity=0.811  Sum_probs=31.8

Q ss_pred             ccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHH
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVK  130 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~  130 (140)
                      -.|+.|+..+--    --=..||++||..|...+.     ....|-|..|...
T Consensus       644 LkCs~Cn~R~Kd----~vI~kC~H~FC~~Cvq~r~-----etRqRKCP~Cn~a  687 (698)
T KOG0978|consen  644 LKCSVCNTRWKD----AVITKCGHVFCEECVQTRY-----ETRQRKCPKCNAA  687 (698)
T ss_pred             eeCCCccCchhh----HHHHhcchHHHHHHHHHHH-----HHhcCCCCCCCCC
Confidence            468999875541    0124799999999987643     5678999999754


No 39 
>PRK00420 hypothetical protein; Validated
Probab=78.01  E-value=1.5  Score=31.12  Aligned_cols=25  Identities=16%  Similarity=0.380  Sum_probs=16.1

Q ss_pred             cccccccccccc-ccccccccccCce
Q psy1895          78 ITCRACDKEFTV-TRRRHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~~-~~rkhhCr~CG~i  102 (140)
                      .+|+.|+.+|.- -..+..|..||.+
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCe
Confidence            589999988764 3344445555554


No 40 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=77.72  E-value=0.22  Score=27.71  Aligned_cols=42  Identities=31%  Similarity=0.734  Sum_probs=25.9

Q ss_pred             ccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHH
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNV  129 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~  129 (140)
                      |.+|...|   .....-..||+.||..|.......     ....|..|..
T Consensus         2 C~iC~~~~---~~~~~~~~C~H~~c~~C~~~~~~~-----~~~~Cp~C~~   43 (45)
T cd00162           2 CPICLEEF---REPVVLLPCGHVFCRSCIDKWLKS-----GKNTCPLCRT   43 (45)
T ss_pred             CCcCchhh---hCceEecCCCChhcHHHHHHHHHh-----CcCCCCCCCC
Confidence            67777776   233344569999999998654321     2344666543


No 41 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=75.88  E-value=1.8  Score=25.46  Aligned_cols=24  Identities=25%  Similarity=0.674  Sum_probs=17.0

Q ss_pred             cccccccccccccc--cccccccCce
Q psy1895          79 TCRACDKEFTVTRR--RHHCRNCGEI  102 (140)
Q Consensus        79 ~C~~C~~~F~~~~r--khhCr~CG~i  102 (140)
                      .|..|+..|.+-..  ..+|..||.-
T Consensus         5 ~C~~CG~~~~~~~~~~~~~Cp~CG~~   30 (46)
T PRK00398          5 KCARCGREVELDEYGTGVRCPYCGYR   30 (46)
T ss_pred             ECCCCCCEEEECCCCCceECCCCCCe
Confidence            58889998875444  4678877763


No 42 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=73.70  E-value=2.2  Score=23.20  Aligned_cols=26  Identities=27%  Similarity=0.629  Sum_probs=14.0

Q ss_pred             eEeCCCCCCeeeCCCCCCCcccCcccHH
Q psy1895         102 IFCNMCSDNKMALPSAAKPVRVCDECNV  129 (140)
Q Consensus       102 i~C~~Cs~~~~~lp~~~~~~RVC~~C~~  129 (140)
                      -||..|.....+.+  ....|+|..|-.
T Consensus         4 rfC~~CG~~t~~~~--~g~~r~C~~Cg~   29 (32)
T PF09297_consen    4 RFCGRCGAPTKPAP--GGWARRCPSCGH   29 (32)
T ss_dssp             SB-TTT--BEEE-S--SSS-EEESSSS-
T ss_pred             cccCcCCccccCCC--CcCEeECCCCcC
Confidence            36777776655544  478899998854


No 43 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=73.12  E-value=2.2  Score=23.78  Aligned_cols=12  Identities=33%  Similarity=0.911  Sum_probs=7.6

Q ss_pred             cccccccccccc
Q psy1895          79 TCRACDKEFTVT   90 (140)
Q Consensus        79 ~C~~C~~~F~~~   90 (140)
                      .|..|++.|.+-
T Consensus         4 ~CP~C~~~~~v~   15 (38)
T TIGR02098         4 QCPNCKTSFRVV   15 (38)
T ss_pred             ECCCCCCEEEeC
Confidence            477777766643


No 44 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=72.85  E-value=2.1  Score=22.54  Aligned_cols=23  Identities=35%  Similarity=0.840  Sum_probs=12.0

Q ss_pred             cccccccccccccccccccccCceE
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~  103 (140)
                      .|+.|++.-...  -.-|.+||..|
T Consensus         2 ~CP~C~~~V~~~--~~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPES--AKFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchhh--cCcCCCCCCCC
Confidence            466666644322  23466666654


No 45 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=72.12  E-value=0.91  Score=37.64  Aligned_cols=49  Identities=22%  Similarity=0.498  Sum_probs=31.4

Q ss_pred             ccccccccccccccc---cccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhhc
Q psy1895          78 ITCRACDKEFTVTRR---RHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLVE  133 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r---khhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~~  133 (140)
                      ..|+.|...--+...   -.+  .||+.||..|.......     +...|..|...+..
T Consensus         4 ~~CP~Ck~~~y~np~~kl~i~--~CGH~~C~sCv~~l~~~-----~~~~CP~C~~~lrk   55 (309)
T TIGR00570         4 QGCPRCKTTKYRNPSLKLMVN--VCGHTLCESCVDLLFVR-----GSGSCPECDTPLRK   55 (309)
T ss_pred             CCCCcCCCCCccCcccccccC--CCCCcccHHHHHHHhcC-----CCCCCCCCCCccch
Confidence            369999984222222   334  79999999998874322     22368888766543


No 46 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=71.18  E-value=2  Score=33.29  Aligned_cols=41  Identities=22%  Similarity=0.438  Sum_probs=33.2

Q ss_pred             cccccCceEeCCCCCC-eeeCCCC------CCCcccCcccHHHhhccc
Q psy1895          95 HCRNCGEIFCNMCSDN-KMALPSA------AKPVRVCDECNVKLVEKL  135 (140)
Q Consensus        95 hCr~CG~i~C~~Cs~~-~~~lp~~------~~~~RVC~~C~~~l~~~~  135 (140)
                      .|...|+.||..|-.. ...+|..      -++..||+..+..|....
T Consensus         2 ~C~Y~G~yyC~~CH~~~~~vIParil~~WDf~~~pVs~~a~~~L~~~~   49 (202)
T PF13901_consen    2 FCDYTGKYYCSSCHWNDTSVIPARILHNWDFRPYPVSRFAKQFLDQIW   49 (202)
T ss_pred             ccCCCCCcCCCCCCCCCceeccHHHHHhcCCCccHHHHHHHHHHHHhc
Confidence            5889999999999887 4566654      688899999999886543


No 47 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=71.14  E-value=1.4  Score=24.80  Aligned_cols=29  Identities=31%  Similarity=0.769  Sum_probs=18.9

Q ss_pred             ccccccccccccccccccccCceEeCCCCCCe
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMCSDNK  111 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~  111 (140)
                      |.+|...+   .....--.||++||..|....
T Consensus         1 C~iC~~~~---~~~~~~~~CGH~fC~~C~~~~   29 (39)
T PF13923_consen    1 CPICLDEL---RDPVVVTPCGHSFCKECIEKY   29 (39)
T ss_dssp             ETTTTSB----SSEEEECTTSEEEEHHHHHHH
T ss_pred             CCCCCCcc---cCcCEECCCCCchhHHHHHHH
Confidence            45564433   234456789999999997654


No 48 
>PHA02768 hypothetical protein; Provisional
Probab=70.48  E-value=2.5  Score=26.32  Aligned_cols=25  Identities=24%  Similarity=0.507  Sum_probs=16.8

Q ss_pred             cccccccccccc------cc----cccccccCceE
Q psy1895          79 TCRACDKEFTVT------RR----RHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~~~------~r----khhCr~CG~i~  103 (140)
                      .|..|++.|+..      .|    .+.|-.||++|
T Consensus         7 ~C~~CGK~Fs~~~~L~~H~r~H~k~~kc~~C~k~f   41 (55)
T PHA02768          7 ECPICGEIYIKRKSMITHLRKHNTNLKLSNCKRIS   41 (55)
T ss_pred             CcchhCCeeccHHHHHHHHHhcCCcccCCccccee
Confidence            699999999722      22    33477777765


No 49 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=70.28  E-value=0.83  Score=35.45  Aligned_cols=56  Identities=16%  Similarity=0.412  Sum_probs=36.7

Q ss_pred             cCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCC----------CCCCcccCcccHHHhh
Q psy1895          73 KDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPS----------AAKPVRVCDECNVKLV  132 (140)
Q Consensus        73 ~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~----------~~~~~RVC~~C~~~l~  132 (140)
                      +....-.|.+|...|.--    .--.||++||..|...+.....          ..+....|..|...+.
T Consensus        14 ~~~~~~~CpICld~~~dP----VvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is   79 (193)
T PLN03208         14 DSGGDFDCNICLDQVRDP----VVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVS   79 (193)
T ss_pred             cCCCccCCccCCCcCCCc----EEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCC
Confidence            333456899999877521    2257999999999876432211          0234568999987764


No 50 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=68.73  E-value=1.6  Score=25.63  Aligned_cols=30  Identities=27%  Similarity=0.830  Sum_probs=13.8

Q ss_pred             ccccccccccccccccccccCceEeCCCCCC
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      |.+|.. |+.-...--=-.||++||..|...
T Consensus         1 CpIc~e-~~~~~n~P~~L~CGH~~c~~cl~~   30 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLPCGHVFCKDCLQK   30 (43)
T ss_dssp             -TTT-----TTSS-EEE-SSS-EEEHHHHHH
T ss_pred             CCcccc-ccCCCCCCEEEeCccHHHHHHHHH
Confidence            566666 654222222346999999888654


No 51 
>KOG1814|consensus
Probab=68.53  E-value=9.3  Score=33.05  Aligned_cols=43  Identities=23%  Similarity=0.773  Sum_probs=32.5

Q ss_pred             CccccCcCCcccccccccccccc--ccccccccCceEeCCCCCCee
Q psy1895          69 AQWAKDKEAITCRACDKEFTVTR--RRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~F~~~~--rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      ..|+..+ ...|+.|.....-..  -|.||-.||..||.-|+.--.
T Consensus       361 ekwl~~N-~krCP~C~v~IEr~eGCnKM~C~~c~~~fc~~c~~~l~  405 (445)
T KOG1814|consen  361 EKWLESN-SKRCPKCKVVIERSEGCNKMHCTKCGTYFCWICAELLY  405 (445)
T ss_pred             HHHHHhc-CCCCCcccceeecCCCccceeeccccccceeehhhhcC
Confidence            3576543 568999988765443  478999999999999987544


No 52 
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=67.46  E-value=2.9  Score=26.47  Aligned_cols=16  Identities=38%  Similarity=0.999  Sum_probs=8.6

Q ss_pred             ccccccccc--ccccCce
Q psy1895          87 FTVTRRRHH--CRNCGEI  102 (140)
Q Consensus        87 F~~~~rkhh--Cr~CG~i  102 (140)
                      |+-.+++.|  ||.||+.
T Consensus         8 ~GKrnk~tH~~CRRCGr~   25 (61)
T COG2126           8 FGKRNKKTHIRCRRCGRR   25 (61)
T ss_pred             ccccCCcceehhhhccch
Confidence            444444444  7777654


No 53 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=65.36  E-value=7.6  Score=28.32  Aligned_cols=20  Identities=15%  Similarity=0.293  Sum_probs=13.4

Q ss_pred             ccccCcCCcccccccccccc
Q psy1895          70 QWAKDKEAITCRACDKEFTV   89 (140)
Q Consensus        70 ~W~~~~~~~~C~~C~~~F~~   89 (140)
                      .+.++..-+.|..|+..+-.
T Consensus        84 ~~~~~~~~sRC~~CN~~L~~  103 (147)
T PF01927_consen   84 KLRLDPIFSRCPKCNGPLRP  103 (147)
T ss_pred             ccccCCCCCccCCCCcEeee
Confidence            33445556789999987653


No 54 
>KOG0823|consensus
Probab=64.67  E-value=1.6  Score=34.69  Aligned_cols=32  Identities=22%  Similarity=0.609  Sum_probs=21.7

Q ss_pred             cccCceEeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          97 RNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        97 r~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      -.||+.||+.|.-++..+-.   -...|..|...+
T Consensus        63 TlCGHLFCWpClyqWl~~~~---~~~~cPVCK~~V   94 (230)
T KOG0823|consen   63 TLCGHLFCWPCLYQWLQTRP---NSKECPVCKAEV   94 (230)
T ss_pred             eecccceehHHHHHHHhhcC---CCeeCCcccccc
Confidence            48999999999987765433   234556665544


No 55 
>KOG0317|consensus
Probab=64.58  E-value=1.9  Score=35.49  Aligned_cols=45  Identities=29%  Similarity=0.614  Sum_probs=28.3

Q ss_pred             ccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      ..|..|=..    +.--.|-.||+|||+.|..-+..    .++.  |..|.....
T Consensus       240 ~kC~LCLe~----~~~pSaTpCGHiFCWsCI~~w~~----ek~e--CPlCR~~~~  284 (293)
T KOG0317|consen  240 RKCSLCLEN----RSNPSATPCGHIFCWSCILEWCS----EKAE--CPLCREKFQ  284 (293)
T ss_pred             CceEEEecC----CCCCCcCcCcchHHHHHHHHHHc----cccC--CCcccccCC
Confidence            467777541    22334999999999999765432    1222  777766543


No 56 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=64.24  E-value=2.4  Score=26.62  Aligned_cols=15  Identities=40%  Similarity=1.035  Sum_probs=12.0

Q ss_pred             cccccccccCceEeC
Q psy1895          91 RRRHHCRNCGEIFCN  105 (140)
Q Consensus        91 ~rkhhCr~CG~i~C~  105 (140)
                      .---+|-+||+|+|.
T Consensus        16 ~~~~NCl~CGkIiC~   30 (57)
T PF06221_consen   16 PYAPNCLNCGKIICE   30 (57)
T ss_pred             cccccccccChhhcc
Confidence            335789999999986


No 57 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=63.76  E-value=3.5  Score=24.55  Aligned_cols=14  Identities=36%  Similarity=0.935  Sum_probs=10.0

Q ss_pred             cccccccccccccc
Q psy1895          79 TCRACDKEFTVTRR   92 (140)
Q Consensus        79 ~C~~C~~~F~~~~r   92 (140)
                      .|..|+..|..+..
T Consensus         7 ~C~~Cg~~fe~~~~   20 (52)
T TIGR02605         7 RCTACGHRFEVLQK   20 (52)
T ss_pred             EeCCCCCEeEEEEe
Confidence            47788888876644


No 58 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=63.68  E-value=4.6  Score=36.75  Aligned_cols=33  Identities=24%  Similarity=0.707  Sum_probs=25.3

Q ss_pred             CcCCccccccccccccccccccccccCce------EeCCCCCC
Q psy1895          74 DKEAITCRACDKEFTVTRRRHHCRNCGEI------FCNMCSDN  110 (140)
Q Consensus        74 ~~~~~~C~~C~~~F~~~~rkhhCr~CG~i------~C~~Cs~~  110 (140)
                      ...+..|..|+.++..    ..|..||..      ||..|...
T Consensus        12 ~~~akFC~~CG~~l~~----~~Cp~CG~~~~~~~~fC~~CG~~   50 (645)
T PRK14559         12 PNNNRFCQKCGTSLTH----KPCPQCGTEVPVDEAHCPNCGAE   50 (645)
T ss_pred             CCCCccccccCCCCCC----CcCCCCCCCCCcccccccccCCc
Confidence            3456789999998853    369999987      88888765


No 59 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=63.06  E-value=3.8  Score=28.93  Aligned_cols=25  Identities=20%  Similarity=0.549  Sum_probs=17.8

Q ss_pred             CccccccccccccccccccccccCc
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      .-.|..|+..|........|..||.
T Consensus        70 ~~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (115)
T TIGR00100        70 ECECEDCSEEVSPEIDLYRCPKCHG   94 (115)
T ss_pred             EEEcccCCCEEecCCcCccCcCCcC
Confidence            3578999988887655555776664


No 60 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=62.85  E-value=6.7  Score=24.59  Aligned_cols=28  Identities=29%  Similarity=0.593  Sum_probs=21.4

Q ss_pred             CCcccccccccccc--ccccccccccCceE
Q psy1895          76 EAITCRACDKEFTV--TRRRHHCRNCGEIF  103 (140)
Q Consensus        76 ~~~~C~~C~~~F~~--~~rkhhCr~CG~i~  103 (140)
                      ....|..|+..-..  ..|.+.|..||..+
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFEM   56 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCEE
Confidence            34579999987654  67788899999864


No 61 
>KOG4739|consensus
Probab=62.70  E-value=2.5  Score=33.76  Aligned_cols=43  Identities=21%  Similarity=0.580  Sum_probs=28.6

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      +|..|...=+  ....+=-.|++|||..|.....        .++|..|...+
T Consensus         5 hCn~C~~~~~--~~~f~LTaC~HvfC~~C~k~~~--------~~~C~lCkk~i   47 (233)
T KOG4739|consen    5 HCNKCFRFPS--QDPFFLTACRHVFCEPCLKASS--------PDVCPLCKKSI   47 (233)
T ss_pred             EeccccccCC--CCceeeeechhhhhhhhcccCC--------cccccccccee
Confidence            5777766322  3333445899999999987532        12999998764


No 62 
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=62.35  E-value=3.1  Score=23.51  Aligned_cols=16  Identities=44%  Similarity=0.846  Sum_probs=10.7

Q ss_pred             CCcccCcccHHHhhcc
Q psy1895         119 KPVRVCDECNVKLVEK  134 (140)
Q Consensus       119 ~~~RVC~~C~~~l~~~  134 (140)
                      +..-+|+.|-..|.++
T Consensus        19 ~~~~~Cd~cg~~L~qR   34 (36)
T PF05191_consen   19 KVEGVCDNCGGELVQR   34 (36)
T ss_dssp             SSTTBCTTTTEBEBEE
T ss_pred             CCCCccCCCCCeeEeC
Confidence            4557788887766554


No 63 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=62.10  E-value=43  Score=22.12  Aligned_cols=33  Identities=21%  Similarity=0.487  Sum_probs=23.0

Q ss_pred             cCCccccccccccccccccccccccCceEeCCCCC
Q psy1895          75 KEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSD  109 (140)
Q Consensus        75 ~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~  109 (140)
                      .+...|..|+++|+.  ....--.||.+|-..|..
T Consensus        76 ~~~~~C~vC~k~l~~--~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   76 TESTKCSVCGKPLGN--SVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCCCCccCcCCcCCC--ceEEEeCCCeEEeccccc
Confidence            334579999999874  333444778888877754


No 64 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=61.83  E-value=2.7  Score=29.56  Aligned_cols=24  Identities=33%  Similarity=0.855  Sum_probs=17.1

Q ss_pred             ccccccccccccccccccccccCc
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      -.|..|+..|.+-.....|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFDFSCPRCGS   94 (113)
T ss_dssp             EEETTTS-EEECHHCCHH-SSSSS
T ss_pred             EECCCCCCEEecCCCCCCCcCCcC
Confidence            569999999987766677777775


No 65 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=61.82  E-value=4.7  Score=23.79  Aligned_cols=23  Identities=30%  Similarity=0.859  Sum_probs=15.0

Q ss_pred             cccccccccccc-cccccccccCc
Q psy1895          79 TCRACDKEFTVT-RRRHHCRNCGE  101 (140)
Q Consensus        79 ~C~~C~~~F~~~-~rkhhCr~CG~  101 (140)
                      .|..|+..|.+- .....|+.||.
T Consensus         4 ~C~~Cg~~~~~~~~~~irC~~CG~   27 (44)
T smart00659        4 ICGECGRENEIKSKDVVRCRECGY   27 (44)
T ss_pred             ECCCCCCEeecCCCCceECCCCCc
Confidence            488899988865 23344666653


No 66 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=61.70  E-value=7.5  Score=23.47  Aligned_cols=32  Identities=31%  Similarity=0.697  Sum_probs=22.6

Q ss_pred             ccc--cccccccc----ccccccccccCceEeCCCCCC
Q psy1895          79 TCR--ACDKEFTV----TRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        79 ~C~--~C~~~F~~----~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      -|+  .|+.....    ......|..||..||..|...
T Consensus        20 ~CP~~~C~~~~~~~~~~~~~~v~C~~C~~~fC~~C~~~   57 (64)
T smart00647       20 WCPAPDCSAAIIVTEEEGCNRVTCPKCGFSFCFRCKVP   57 (64)
T ss_pred             CCCCCCCcceEEecCCCCCCeeECCCCCCeECCCCCCc
Confidence            355  66554433    345677999999999999764


No 67 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=60.97  E-value=3.9  Score=34.29  Aligned_cols=41  Identities=22%  Similarity=0.575  Sum_probs=31.8

Q ss_pred             ccccCcCCccccccccccc----------cccccccccccCceEeCCCCCC
Q psy1895          70 QWAKDKEAITCRACDKEFT----------VTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        70 ~W~~~~~~~~C~~C~~~F~----------~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      .|-.......|..|+-+|.          +...++.|..|..-||..|-.+
T Consensus       355 p~~~~~ks~~Cf~CQ~~fp~~~~~~~~~~~ss~rY~Ce~CK~~FC~dCdvf  405 (421)
T COG5151         355 PEGTNPKSTHCFVCQGPFPKPPVSPFDESTSSGRYQCELCKSTFCSDCDVF  405 (421)
T ss_pred             cCCCCCCCccceeccCCCCCCCCCcccccccccceechhhhhhhhhhhHHH
Confidence            4455555678999999885          3466899999999999999643


No 68 
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=60.76  E-value=1.4  Score=25.60  Aligned_cols=15  Identities=33%  Similarity=0.944  Sum_probs=12.4

Q ss_pred             ccCceEeCCCCCCee
Q psy1895          98 NCGEIFCNMCSDNKM  112 (140)
Q Consensus        98 ~CG~i~C~~Cs~~~~  112 (140)
                      .||++||..|.....
T Consensus        15 ~CGH~FC~~Cl~~~~   29 (42)
T PF15227_consen   15 PCGHSFCRSCLERLW   29 (42)
T ss_dssp             SSSSEEEHHHHHHHH
T ss_pred             CCcCHHHHHHHHHHH
Confidence            799999999977643


No 69 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=60.10  E-value=6.1  Score=24.43  Aligned_cols=26  Identities=23%  Similarity=0.678  Sum_probs=15.3

Q ss_pred             c-ccCcCCcccccccccccccccccc-ccccC
Q psy1895          71 W-AKDKEAITCRACDKEFTVTRRRHH-CRNCG  100 (140)
Q Consensus        71 W-~~~~~~~~C~~C~~~F~~~~rkhh-Cr~CG  100 (140)
                      | ........|..|+.    +...|| |..||
T Consensus        19 ~kl~~p~l~~C~~cG~----~~~~H~vc~~cG   46 (55)
T TIGR01031        19 AKLTAPTLVVCPNCGE----FKLPHRVCPSCG   46 (55)
T ss_pred             ccccCCcceECCCCCC----cccCeeECCccC
Confidence            5 44445556777777    334444 77776


No 70 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=59.86  E-value=6.9  Score=23.70  Aligned_cols=27  Identities=30%  Similarity=0.619  Sum_probs=17.3

Q ss_pred             Cccccccccccc-cccccccccccCceE
Q psy1895          77 AITCRACDKEFT-VTRRRHHCRNCGEIF  103 (140)
Q Consensus        77 ~~~C~~C~~~F~-~~~rkhhCr~CG~i~  103 (140)
                      ...|+.|+..|- .-..+.+|..||..+
T Consensus        20 ~~fCP~Cg~~~m~~~~~r~~C~~Cgyt~   47 (50)
T PRK00432         20 NKFCPRCGSGFMAEHLDRWHCGKCGYTE   47 (50)
T ss_pred             cCcCcCCCcchheccCCcEECCCcCCEE
Confidence            347888888422 334467788887654


No 71 
>KOG3173|consensus
Probab=58.38  E-value=5.2  Score=30.26  Aligned_cols=29  Identities=34%  Similarity=0.878  Sum_probs=23.0

Q ss_pred             CCccccccccccccccccccccccCceEeCCC
Q psy1895          76 EAITCRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      ....|..|.++-++..  .+|| ||.+||...
T Consensus       104 ~~~rC~~C~kk~gltg--f~Cr-CG~~fC~~H  132 (167)
T KOG3173|consen  104 KKKRCFKCRKKVGLTG--FKCR-CGNTFCGTH  132 (167)
T ss_pred             cchhhhhhhhhhcccc--cccc-cCCcccccc
Confidence            3456999999888877  8886 899998754


No 72 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=58.22  E-value=3.5  Score=23.00  Aligned_cols=30  Identities=27%  Similarity=0.612  Sum_probs=19.7

Q ss_pred             ccccccccccccccccccccCceEeCCCCCCee
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      |.+|...|....   .=..||+.||..|....+
T Consensus         1 C~iC~~~~~~~~---~~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen    1 CPICLEPFEDPV---ILLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSSBCSSEE---EETTTSEEEEHHHHHHHH
T ss_pred             CCcCCccccCCC---EEecCCCcchHHHHHHHH
Confidence            456666555332   345899999999977644


No 73 
>PF14353 CpXC:  CpXC protein
Probab=57.76  E-value=5.2  Score=28.28  Aligned_cols=11  Identities=36%  Similarity=1.038  Sum_probs=8.1

Q ss_pred             cccccccCceE
Q psy1895          93 RHHCRNCGEIF  103 (140)
Q Consensus        93 khhCr~CG~i~  103 (140)
                      .+.|..||..+
T Consensus        38 ~~~CP~Cg~~~   48 (128)
T PF14353_consen   38 SFTCPSCGHKF   48 (128)
T ss_pred             EEECCCCCCce
Confidence            57788888765


No 74 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=57.56  E-value=9.9  Score=20.26  Aligned_cols=28  Identities=21%  Similarity=0.509  Sum_probs=21.7

Q ss_pred             cccccccccccccccccccccCceEeCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      .|..|++..+-+. -++|..|+-.+-..|
T Consensus         2 ~C~~C~~~~~~~~-~Y~C~~c~f~lh~~C   29 (30)
T PF03107_consen    2 WCDVCRRKIDGFY-FYHCSECCFTLHVRC   29 (30)
T ss_pred             CCCCCCCCcCCCE-eEEeCCCCCeEcCcc
Confidence            4888988887666 899998887666555


No 75 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=56.96  E-value=7.2  Score=22.46  Aligned_cols=9  Identities=22%  Similarity=0.719  Sum_probs=6.4

Q ss_pred             ccccccccc
Q psy1895          79 TCRACDKEF   87 (140)
Q Consensus        79 ~C~~C~~~F   87 (140)
                      .|+.|+...
T Consensus         2 ~Cp~Cg~~~   10 (43)
T PF08271_consen    2 KCPNCGSKE   10 (43)
T ss_dssp             SBTTTSSSE
T ss_pred             CCcCCcCCc
Confidence            477787765


No 76 
>PHA02926 zinc finger-like protein; Provisional
Probab=56.90  E-value=2  Score=34.33  Aligned_cols=54  Identities=19%  Similarity=0.408  Sum_probs=32.8

Q ss_pred             ccccccccccccccccccc------cccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          78 ITCRACDKEFTVTRRRHHC------RNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhC------r~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      ..|.+|-....-- +...+      ..|+++||-.|-..+........-.+-|..|...+.
T Consensus       171 ~eCgICmE~I~eK-~~~~eRrFGIL~~CnHsFCl~CIr~Wr~~r~~~~~~rsCPiCR~~f~  230 (242)
T PHA02926        171 KECGICYEVVYSK-RLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFR  230 (242)
T ss_pred             CCCccCccccccc-cccccccccccCCCCchHHHHHHHHHHHhccccCcCCcCCCCcceee
Confidence            5788887532100 11122      489999999998876543222344677888876543


No 77 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=56.80  E-value=6.5  Score=21.29  Aligned_cols=23  Identities=26%  Similarity=0.928  Sum_probs=15.3

Q ss_pred             ccccccccccccccccccccccCceEeC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCN  105 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~  105 (140)
                      ..|.+|+.     ..++.|..||..+|+
T Consensus         3 ~~C~vC~~-----~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    3 KLCSVCGN-----PAKYRCPRCGARYCS   25 (30)
T ss_dssp             EEETSSSS-----EESEE-TTT--EESS
T ss_pred             CCCccCcC-----CCEEECCCcCCceeC
Confidence            35778877     456889999999886


No 78 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=56.71  E-value=5.6  Score=22.18  Aligned_cols=13  Identities=31%  Similarity=0.871  Sum_probs=8.3

Q ss_pred             ccccccccccccc
Q psy1895          79 TCRACDKEFTVTR   91 (140)
Q Consensus        79 ~C~~C~~~F~~~~   91 (140)
                      .|..|+..|.++.
T Consensus         7 ~C~~Cg~~fe~~~   19 (41)
T smart00834        7 RCEDCGHTFEVLQ   19 (41)
T ss_pred             EcCCCCCEEEEEE
Confidence            4677777776543


No 79 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=55.25  E-value=6.1  Score=27.80  Aligned_cols=24  Identities=17%  Similarity=0.598  Sum_probs=16.8

Q ss_pred             ccccccccccccccccccccccCc
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      -.|..|+..|..-....-|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIHQHDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecCCcCccCcCCCC
Confidence            468888888877555555777764


No 80 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=54.46  E-value=8.6  Score=28.08  Aligned_cols=24  Identities=29%  Similarity=0.989  Sum_probs=19.5

Q ss_pred             ccccccccccccccccccccccCceEeCC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNM  106 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~  106 (140)
                      ..|+.|+..|.+.    -| .||+++|..
T Consensus        78 PgCP~CGn~~~fa----~C-~CGkl~Ci~  101 (131)
T PF15616_consen   78 PGCPHCGNQYAFA----VC-GCGKLFCID  101 (131)
T ss_pred             CCCCCCcChhcEE----Ee-cCCCEEEeC
Confidence            5799999998863    46 799999954


No 81 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=54.10  E-value=8.4  Score=21.53  Aligned_cols=27  Identities=26%  Similarity=0.751  Sum_probs=12.1

Q ss_pred             EeCCCCCC-eeeCCC-CCCCcccCcccHH
Q psy1895         103 FCNMCSDN-KMALPS-AAKPVRVCDECNV  129 (140)
Q Consensus       103 ~C~~Cs~~-~~~lp~-~~~~~RVC~~C~~  129 (140)
                      ||..|... ...+|. ...+-.||..|-.
T Consensus         2 fC~~CG~~l~~~ip~gd~r~R~vC~~Cg~   30 (34)
T PF14803_consen    2 FCPQCGGPLERRIPEGDDRERLVCPACGF   30 (34)
T ss_dssp             B-TTT--B-EEE--TT-SS-EEEETTTTE
T ss_pred             ccccccChhhhhcCCCCCccceECCCCCC
Confidence            34444433 233443 3777789998854


No 82 
>PRK12495 hypothetical protein; Provisional
Probab=53.70  E-value=17  Score=28.93  Aligned_cols=12  Identities=17%  Similarity=0.562  Sum_probs=9.1

Q ss_pred             Cccccccccccc
Q psy1895          77 AITCRACDKEFT   88 (140)
Q Consensus        77 ~~~C~~C~~~F~   88 (140)
                      ..+|..|+.+.-
T Consensus        42 a~hC~~CG~PIp   53 (226)
T PRK12495         42 NAHCDECGDPIF   53 (226)
T ss_pred             hhhcccccCccc
Confidence            357999998755


No 83 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=53.66  E-value=9.5  Score=21.03  Aligned_cols=23  Identities=26%  Similarity=0.767  Sum_probs=13.4

Q ss_pred             ccccccccccccc-ccccccccCc
Q psy1895          79 TCRACDKEFTVTR-RRHHCRNCGE  101 (140)
Q Consensus        79 ~C~~C~~~F~~~~-rkhhCr~CG~  101 (140)
                      .|..|++.|.+-. ....|+.||.
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCC
Confidence            3777888877432 2345777774


No 84 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=52.81  E-value=7.2  Score=27.61  Aligned_cols=24  Identities=21%  Similarity=0.678  Sum_probs=15.9

Q ss_pred             ccccccccccccccccc-cccccCc
Q psy1895          78 ITCRACDKEFTVTRRRH-HCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkh-hCr~CG~  101 (140)
                      -.|..|+..|.+..... +|..||.
T Consensus        72 ~~C~~Cg~~~~~~~~~~~~CP~Cgs   96 (117)
T PRK00564         72 LECKDCSHVFKPNALDYGVCEKCHS   96 (117)
T ss_pred             EEhhhCCCccccCCccCCcCcCCCC
Confidence            46888888887754333 3766664


No 85 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.59  E-value=3.2  Score=33.79  Aligned_cols=44  Identities=30%  Similarity=0.631  Sum_probs=27.6

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHH
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVK  130 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~  130 (140)
                      .|..|-..-    ..--|..||++||..|.-..    ...+..-.|..|...
T Consensus       217 kC~lC~e~~----~~ps~t~CgHlFC~~Cl~~~----~t~~k~~~CplCRak  260 (271)
T COG5574         217 KCFLCLEEP----EVPSCTPCGHLFCLSCLLIS----WTKKKYEFCPLCRAK  260 (271)
T ss_pred             ceeeeeccc----CCcccccccchhhHHHHHHH----HHhhccccCchhhhh
Confidence            577776632    23468999999999997541    112334446666544


No 86 
>PRK01253 preprotein translocase subunit SecG; Reviewed
Probab=52.33  E-value=3.6  Score=25.49  Aligned_cols=24  Identities=33%  Similarity=0.495  Sum_probs=20.5

Q ss_pred             CCCCCCccchhhhHHHhhhhhhhc
Q psy1895           1 MTSGGLKRSFDDHVKMNKIAEHVK   24 (140)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~   24 (140)
                      |+|+|+.+-||++..--|++|..-
T Consensus        11 ~ssAGL~ryy~ed~~~iKi~P~~V   34 (54)
T PRK01253         11 MSSAGLIRYFEEETEAIKIDPKTV   34 (54)
T ss_pred             cccchhhhhhhcccCccccCCeee
Confidence            789999999999888888888743


No 87 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=51.72  E-value=6.3  Score=24.86  Aligned_cols=27  Identities=26%  Similarity=0.774  Sum_probs=17.1

Q ss_pred             cccccccCceEeCCCCCCeeeCCCCCCCcccC-cccHHHhhc
Q psy1895          93 RHHCRNCGEIFCNMCSDNKMALPSAAKPVRVC-DECNVKLVE  133 (140)
Q Consensus        93 khhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC-~~C~~~l~~  133 (140)
                      ..||..||..           +|.   ..+.| +.|-+.+..
T Consensus         3 HkHC~~CG~~-----------Ip~---~~~fCS~~C~~~~~k   30 (59)
T PF09889_consen    3 HKHCPVCGKP-----------IPP---DESFCSPKCREEYRK   30 (59)
T ss_pred             CCcCCcCCCc-----------CCc---chhhhCHHHHHHHHH
Confidence            3678888874           232   46777 477766543


No 88 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=50.89  E-value=7.4  Score=22.47  Aligned_cols=9  Identities=44%  Similarity=1.280  Sum_probs=4.2

Q ss_pred             ccccccccc
Q psy1895          80 CRACDKEFT   88 (140)
Q Consensus        80 C~~C~~~F~   88 (140)
                      |..|+..|.
T Consensus         8 C~~Cg~~fe   16 (42)
T PF09723_consen    8 CEECGHEFE   16 (42)
T ss_pred             eCCCCCEEE
Confidence            444444444


No 89 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=50.80  E-value=5.9  Score=22.03  Aligned_cols=8  Identities=50%  Similarity=1.688  Sum_probs=2.5

Q ss_pred             cccccCce
Q psy1895          95 HCRNCGEI  102 (140)
Q Consensus        95 hCr~CG~i  102 (140)
                      +|..||.+
T Consensus        13 rC~~Cg~~   20 (37)
T PF12172_consen   13 RCRDCGRV   20 (37)
T ss_dssp             E-TTT--E
T ss_pred             EcCCCCCE
Confidence            35555554


No 90 
>PF01907 Ribosomal_L37e:  Ribosomal protein L37e;  InterPro: IPR001569 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families consists of proteins of 56 to 96 amino-acid residues that share a highly conserved region located in the N-terminal part.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A19_A 4A1D_A 4A18_A 4A1B_A 1S1I_Y 3O5H_d 3IZS_l 3O58_d 2ZKR_2 3IZR_l ....
Probab=50.50  E-value=9.8  Score=23.72  Aligned_cols=7  Identities=57%  Similarity=1.550  Sum_probs=3.9

Q ss_pred             ccccCce
Q psy1895          96 CRNCGEI  102 (140)
Q Consensus        96 Cr~CG~i  102 (140)
                      ||.||..
T Consensus        18 CrRCG~~   24 (55)
T PF01907_consen   18 CRRCGRR   24 (55)
T ss_dssp             -TTTSSE
T ss_pred             ecccCCe
Confidence            6666655


No 91 
>KOG1829|consensus
Probab=49.12  E-value=9.3  Score=34.39  Aligned_cols=56  Identities=23%  Similarity=0.567  Sum_probs=41.0

Q ss_pred             CCccccccccccc--cccccccccccCceEeCCCCCCeeeC-CCC------CCCcccCcccHHHh
Q psy1895          76 EAITCRACDKEFT--VTRRRHHCRNCGEIFCNMCSDNKMAL-PSA------AKPVRVCDECNVKL  131 (140)
Q Consensus        76 ~~~~C~~C~~~F~--~~~rkhhCr~CG~i~C~~Cs~~~~~l-p~~------~~~~RVC~~C~~~l  131 (140)
                      ..-.|..|+..++  ++.+-.-|+.+|.-||..|-.+...+ |..      -.+..||+.=+..|
T Consensus       339 Q~~~CAgC~~~i~~~~~~~~R~C~y~G~y~C~~Ch~~~~svIPARVl~~WDf~~y~Vs~~a~~~L  403 (580)
T KOG1829|consen  339 QNFRCAGCGHTIGPDLEQRPRLCRYLGKYFCDCCHQNDKSVIPARVLHNWDFTKYPVSNFAKQFL  403 (580)
T ss_pred             cCceecccCCCcccccccchhHhhhhhhhhCchhcccCcccccccceecccCcccccchhHHHHH
Confidence            3347999999998  45666679999999999998875544 543      46667776555444


No 92 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=49.12  E-value=8.4  Score=23.44  Aligned_cols=23  Identities=30%  Similarity=0.862  Sum_probs=14.9

Q ss_pred             cccccccccccc--cccccccccCc
Q psy1895          79 TCRACDKEFTVT--RRRHHCRNCGE  101 (140)
Q Consensus        79 ~C~~C~~~F~~~--~rkhhCr~CG~  101 (140)
                      .|..|++.|.+.  .+-..|..||.
T Consensus         8 ~C~~Cg~~~~~~~~~~~irCp~Cg~   32 (49)
T COG1996           8 KCARCGREVELDQETRGIRCPYCGS   32 (49)
T ss_pred             EhhhcCCeeehhhccCceeCCCCCc
Confidence            588999999744  33344666654


No 93 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=48.91  E-value=7  Score=26.57  Aligned_cols=25  Identities=28%  Similarity=0.671  Sum_probs=18.0

Q ss_pred             ccccccccccc---------cccccccccccCce
Q psy1895          78 ITCRACDKEFT---------VTRRRHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~---------~~~rkhhCr~CG~i  102 (140)
                      +.|..|+++..         .+.-|.+||.|+.-
T Consensus        34 S~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~   67 (92)
T PF06750_consen   34 SHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAP   67 (92)
T ss_pred             CcCcCCCCcCcccccchHHHHHHhCCCCcccCCC
Confidence            57888888754         44557888888763


No 94 
>PF10497 zf-4CXXC_R1:  Zinc-finger domain of monoamine-oxidase A repressor R1;  InterPro: IPR018866  R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type []. 
Probab=48.63  E-value=5.4  Score=27.85  Aligned_cols=52  Identities=23%  Similarity=0.572  Sum_probs=32.5

Q ss_pred             CCccccccccccccccccccc------ccc---CceEeCCCCCCeeeCCC---CCCCcccCcccHH
Q psy1895          76 EAITCRACDKEFTVTRRRHHC------RNC---GEIFCNMCSDNKMALPS---AAKPVRVCDECNV  129 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~~rkhhC------r~C---G~i~C~~Cs~~~~~lp~---~~~~~RVC~~C~~  129 (140)
                      ....|..|..+-.  ..+..|      ..|   ...||..|...+...-.   ...+..+|..|..
T Consensus         6 ~g~~CHqCrqKt~--~~~~~C~~~~~~~~C~~~~~~fC~~CL~~ryge~~~ev~~~~~W~CP~Crg   69 (105)
T PF10497_consen    6 NGKTCHQCRQKTL--DFKTICTGHWKNSSCRGCRGKFCGGCLRNRYGENVEEVLEDPNWKCPKCRG   69 (105)
T ss_pred             CCCCchhhcCCCC--CCceEcCCCCCCCCCccCcceehHhHHHHHHhhhHHHHhcCCceECCCCCC
Confidence            3457888888533  222334      555   89999999877543211   1456778888765


No 95 
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=47.82  E-value=12  Score=30.38  Aligned_cols=35  Identities=29%  Similarity=0.636  Sum_probs=26.8

Q ss_pred             ccccCcCCccccccccccccc-------cccccccccCceEe
Q psy1895          70 QWAKDKEAITCRACDKEFTVT-------RRRHHCRNCGEIFC  104 (140)
Q Consensus        70 ~W~~~~~~~~C~~C~~~F~~~-------~rkhhCr~CG~i~C  104 (140)
                      .|-.-++++.|..|.++|...       .-..||..|++.|=
T Consensus       125 rvp~rKeVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~  166 (278)
T PF15135_consen  125 RVPQRKEVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFR  166 (278)
T ss_pred             ccCcccccccccccccccCCCccccccceeeeecccccccch
Confidence            345667788999999998743       33689999999873


No 96 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=47.45  E-value=9.7  Score=21.24  Aligned_cols=26  Identities=27%  Similarity=0.623  Sum_probs=13.4

Q ss_pred             eEeCCCCCCeeeCCCCCCCcccCcccH
Q psy1895         102 IFCNMCSDNKMALPSAAKPVRVCDECN  128 (140)
Q Consensus       102 i~C~~Cs~~~~~lp~~~~~~RVC~~C~  128 (140)
                      .||..|.+-..+-......+ +|..|-
T Consensus         2 ~FCp~C~nlL~p~~~~~~~~-~C~~C~   27 (35)
T PF02150_consen    2 RFCPECGNLLYPKEDKEKRV-ACRTCG   27 (35)
T ss_dssp             -BETTTTSBEEEEEETTTTE-EESSSS
T ss_pred             eeCCCCCccceEcCCCccCc-CCCCCC
Confidence            47777776543322223333 677773


No 97 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=46.64  E-value=10  Score=27.53  Aligned_cols=13  Identities=31%  Similarity=1.071  Sum_probs=8.3

Q ss_pred             ccccccccccccc
Q psy1895          78 ITCRACDKEFTVT   90 (140)
Q Consensus        78 ~~C~~C~~~F~~~   90 (140)
                      -.|..|+..|.+-
T Consensus        71 ~~C~~CG~~~~~~   83 (135)
T PRK03824         71 LKCRNCGNEWSLK   83 (135)
T ss_pred             EECCCCCCEEecc
Confidence            4577777666654


No 98 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=46.12  E-value=14  Score=29.13  Aligned_cols=26  Identities=27%  Similarity=0.718  Sum_probs=19.4

Q ss_pred             cCCccccccccccccccccccccccCceE
Q psy1895          75 KEAITCRACDKEFTVTRRRHHCRNCGEIF  103 (140)
Q Consensus        75 ~~~~~C~~C~~~F~~~~rkhhCr~CG~i~  103 (140)
                      .....|..|+.   +..|...|..||..+
T Consensus       307 ~tS~~C~~cg~---~~~r~~~C~~cg~~~  332 (364)
T COG0675         307 YTSKTCPCCGH---LSGRLFKCPRCGFVH  332 (364)
T ss_pred             CCcccccccCC---ccceeEECCCCCCee
Confidence            44478999999   446677888888764


No 99 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=45.75  E-value=12  Score=19.24  Aligned_cols=7  Identities=29%  Similarity=0.918  Sum_probs=3.5

Q ss_pred             ccccccc
Q psy1895          79 TCRACDK   85 (140)
Q Consensus        79 ~C~~C~~   85 (140)
                      .|..|++
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3555555


No 100
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=45.74  E-value=10  Score=28.15  Aligned_cols=28  Identities=21%  Similarity=0.496  Sum_probs=20.5

Q ss_pred             CCcccccccccccc---ccccccccccCceE
Q psy1895          76 EAITCRACDKEFTV---TRRRHHCRNCGEIF  103 (140)
Q Consensus        76 ~~~~C~~C~~~F~~---~~rkhhCr~CG~i~  103 (140)
                      .-=.|+.|+..|++   +.--.+|..||...
T Consensus       108 ~~Y~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~L  138 (158)
T TIGR00373       108 MFFICPNMCVRFTFNEAMELNFTCPRCGAML  138 (158)
T ss_pred             CeEECCCCCcEeeHHHHHHcCCcCCCCCCEe
Confidence            34469999999984   44567788888763


No 101
>PF10170 C6_DPF:  Cysteine-rich domain;  InterPro: IPR018785  This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. 
Probab=45.24  E-value=12  Score=25.92  Aligned_cols=34  Identities=26%  Similarity=0.518  Sum_probs=26.5

Q ss_pred             cccccccCceEeCC--CCCCeeeCCCCCCCcccCcccHHHhhcc
Q psy1895          93 RHHCRNCGEIFCNM--CSDNKMALPSAAKPVRVCDECNVKLVEK  134 (140)
Q Consensus        93 khhCr~CG~i~C~~--Cs~~~~~lp~~~~~~RVC~~C~~~l~~~  134 (140)
                      --+|..||+.+|..  ||-+.        ..|.|..|...-...
T Consensus        49 Ga~CS~C~~~VC~~~~CSlFY--------tkrFC~pC~~~~~~~   84 (97)
T PF10170_consen   49 GAPCSICGKPVCVGQDCSLFY--------TKRFCLPCVKRNLKA   84 (97)
T ss_pred             CccccccCCceEcCCCccEEe--------eCceeHHHHHHHHHH
Confidence            46899999999964  98774        459999998765543


No 102
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=45.23  E-value=11  Score=26.56  Aligned_cols=24  Identities=25%  Similarity=0.695  Sum_probs=15.0

Q ss_pred             cccccccccccccccc-ccccccCc
Q psy1895          78 ITCRACDKEFTVTRRR-HHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rk-hhCr~CG~  101 (140)
                      -.|..|+..|...... ..|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~~CP~Cgs   95 (114)
T PRK03681         71 CWCETCQQYVTLLTQRVRRCPQCHG   95 (114)
T ss_pred             EEcccCCCeeecCCccCCcCcCcCC
Confidence            4588888877764332 34666664


No 103
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=44.56  E-value=2.7  Score=24.80  Aligned_cols=44  Identities=20%  Similarity=0.563  Sum_probs=28.4

Q ss_pred             ccccccccccccccccccccccCce-EeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEI-FCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i-~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      ..|.+|...+..    ..-..||+. ||..|......      ....|..|.+.+
T Consensus         3 ~~C~iC~~~~~~----~~~~pCgH~~~C~~C~~~~~~------~~~~CP~Cr~~i   47 (50)
T PF13920_consen    3 EECPICFENPRD----VVLLPCGHLCFCEECAERLLK------RKKKCPICRQPI   47 (50)
T ss_dssp             SB-TTTSSSBSS----EEEETTCEEEEEHHHHHHHHH------TTSBBTTTTBB-
T ss_pred             CCCccCCccCCc----eEEeCCCChHHHHHHhHHhcc------cCCCCCcCChhh
Confidence            368888886542    344579999 99999876543      445666665544


No 104
>PRK12496 hypothetical protein; Provisional
Probab=44.45  E-value=14  Score=27.71  Aligned_cols=11  Identities=27%  Similarity=0.984  Sum_probs=5.6

Q ss_pred             cccccccCceE
Q psy1895          93 RHHCRNCGEIF  103 (140)
Q Consensus        93 khhCr~CG~i~  103 (140)
                      ++.|..||+.|
T Consensus       127 ~~~C~gC~~~~  137 (164)
T PRK12496        127 RKVCKGCKKKY  137 (164)
T ss_pred             eEECCCCCccc
Confidence            44455555544


No 105
>KOG1314|consensus
Probab=43.96  E-value=10  Score=32.35  Aligned_cols=33  Identities=27%  Similarity=0.819  Sum_probs=23.1

Q ss_pred             cCCccccCcCCc-----cccccccccccccccccccccCc
Q psy1895          67 TEAQWAKDKEAI-----TCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        67 ~~~~W~~~~~~~-----~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      ..+.|.|....+     .|..|+. | ---|.||||.|.+
T Consensus        76 vp~~wkPe~~~D~~~lqfCk~Cqg-Y-KapRSHHCrkCnr  113 (414)
T KOG1314|consen   76 VPLGWKPENPKDEMFLQFCKKCQG-Y-KAPRSHHCRKCNR  113 (414)
T ss_pred             CCCCCCCCCChhHHHHHHHhhccC-c-CCCccccchHHHH
Confidence            347899865554     5888876 2 2367899999865


No 106
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=43.85  E-value=14  Score=25.07  Aligned_cols=26  Identities=23%  Similarity=0.390  Sum_probs=17.9

Q ss_pred             cccccccccccccccccccccCceEe
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFC  104 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C  104 (140)
                      .|..|+..+........|+.||...=
T Consensus         2 fC~~Cg~~l~~~~~~~~C~~C~~~~~   27 (104)
T TIGR01384         2 FCPKCGSLMTPKNGVYVCPSCGYEKE   27 (104)
T ss_pred             CCcccCcccccCCCeEECcCCCCccc
Confidence            57888887765545667888876643


No 107
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=43.65  E-value=13  Score=27.18  Aligned_cols=8  Identities=38%  Similarity=1.734  Sum_probs=4.6

Q ss_pred             ccccCceE
Q psy1895          96 CRNCGEIF  103 (140)
Q Consensus        96 Cr~CG~i~  103 (140)
                      |..||.+|
T Consensus        32 C~~CG~v~   39 (140)
T COG1545          32 CKKCGRVY   39 (140)
T ss_pred             cCCCCeEE
Confidence            55666554


No 108
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=43.61  E-value=21  Score=22.44  Aligned_cols=15  Identities=40%  Similarity=0.767  Sum_probs=11.9

Q ss_pred             CCCcccCcccHHHhh
Q psy1895         118 AKPVRVCDECNVKLV  132 (140)
Q Consensus       118 ~~~~RVC~~C~~~l~  132 (140)
                      .++..||..|..+..
T Consensus        41 p~~~PVCP~Ck~iye   55 (58)
T PF11238_consen   41 PKPFPVCPECKEIYE   55 (58)
T ss_pred             CCCCCCCcCHHHHHH
Confidence            566899999988754


No 109
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=42.62  E-value=15  Score=21.24  Aligned_cols=15  Identities=33%  Similarity=1.006  Sum_probs=9.5

Q ss_pred             cccccccCceEeCCC
Q psy1895          93 RHHCRNCGEIFCNMC  107 (140)
Q Consensus        93 khhCr~CG~i~C~~C  107 (140)
                      ...|+.||..||...
T Consensus        13 ~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKH   27 (43)
T ss_dssp             HEE-TTTS-EE-TTT
T ss_pred             CeECCCCCcccCccc
Confidence            467999999998765


No 110
>KOG3896|consensus
Probab=42.24  E-value=13  Score=31.55  Aligned_cols=31  Identities=23%  Similarity=0.585  Sum_probs=25.5

Q ss_pred             ccccccccccccccccccCceEeCCCCCCeee
Q psy1895          82 ACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMA  113 (140)
Q Consensus        82 ~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~  113 (140)
                      .|+ .|..+..-..||.|-++-|..|+.+.+.
T Consensus        14 ~cg-~~~pl~~L~FCRyC~klrc~~Cv~hEvd   44 (449)
T KOG3896|consen   14 TCG-KFRPLPDLVFCRYCFKLRCDDCVLHEVD   44 (449)
T ss_pred             ecc-ccccccceeeeecccccccccccccccc
Confidence            355 6888888899999999999999887654


No 111
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=41.23  E-value=6.6  Score=22.10  Aligned_cols=16  Identities=44%  Similarity=0.949  Sum_probs=6.5

Q ss_pred             cccccccc-cccccccc
Q psy1895          80 CRACDKEF-TVTRRRHH   95 (140)
Q Consensus        80 C~~C~~~F-~~~~rkhh   95 (140)
                      |..|.+.+ +...|++|
T Consensus         2 C~~C~~Ey~~p~~RR~~   18 (35)
T PF07503_consen    2 CDDCLKEYFDPSNRRFH   18 (35)
T ss_dssp             -HHHHHHHCSTTSTTTT
T ss_pred             CHHHHHHHcCCCCCccc
Confidence            34444443 34444444


No 112
>COG1773 Rubredoxin [Energy production and conversion]
Probab=41.18  E-value=13  Score=23.15  Aligned_cols=37  Identities=24%  Similarity=0.579  Sum_probs=20.4

Q ss_pred             ccccccccCceEeCCCCCCeeeCCCC-----CCCcccCcccH
Q psy1895          92 RRHHCRNCGEIFCNMCSDNKMALPSA-----AKPVRVCDECN  128 (140)
Q Consensus        92 rkhhCr~CG~i~C~~Cs~~~~~lp~~-----~~~~RVC~~C~  128 (140)
                      +++.|+.||.||=..=-.....++..     ...-.+|..|-
T Consensus         2 ~~~~C~~CG~vYd~e~Gdp~~gi~pgT~fedlPd~w~CP~Cg   43 (55)
T COG1773           2 KRWRCSVCGYVYDPEKGDPRCGIAPGTPFEDLPDDWVCPECG   43 (55)
T ss_pred             CceEecCCceEeccccCCccCCCCCCCchhhCCCccCCCCCC
Confidence            46889999999843322222222221     23346777775


No 113
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=41.04  E-value=13  Score=28.49  Aligned_cols=15  Identities=40%  Similarity=0.933  Sum_probs=7.6

Q ss_pred             cccccccccccCceE
Q psy1895          89 VTRRRHHCRNCGEIF  103 (140)
Q Consensus        89 ~~~rkhhCr~CG~i~  103 (140)
                      .+..+..|..|+++|
T Consensus       135 v~~w~~rC~GC~~~f  149 (177)
T COG1439         135 VRKWRLRCHGCKRIF  149 (177)
T ss_pred             EeeeeEEEecCceec
Confidence            344445555555554


No 114
>PRK04023 DNA polymerase II large subunit; Validated
Probab=40.73  E-value=24  Score=34.04  Aligned_cols=46  Identities=24%  Similarity=0.528  Sum_probs=31.1

Q ss_pred             cCCccccccccccccccccccccccCce-----EeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          75 KEAITCRACDKEFTVTRRRHHCRNCGEI-----FCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        75 ~~~~~C~~C~~~F~~~~rkhhCr~CG~i-----~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      .....|..|+...    -...|..||..     ||..|-....        .-.|..|-..+.
T Consensus       624 Vg~RfCpsCG~~t----~~frCP~CG~~Te~i~fCP~CG~~~~--------~y~CPKCG~El~  674 (1121)
T PRK04023        624 IGRRKCPSCGKET----FYRRCPFCGTHTEPVYRCPRCGIEVE--------EDECEKCGREPT  674 (1121)
T ss_pred             ccCccCCCCCCcC----CcccCCCCCCCCCcceeCccccCcCC--------CCcCCCCCCCCC
Confidence            3456899999974    33679999964     8999954321        134877765544


No 115
>KOG3362|consensus
Probab=40.66  E-value=11  Score=28.08  Aligned_cols=26  Identities=27%  Similarity=0.783  Sum_probs=20.3

Q ss_pred             CCccccccccccccccccccccccCceEeCC
Q psy1895          76 EAITCRACDKEFTVTRRRHHCRNCGEIFCNM  106 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~  106 (140)
                      ....|.+|+     +-.++-|-+||.-+|+-
T Consensus       117 ~r~fCaVCG-----~~S~ysC~~CG~kyCsv  142 (156)
T KOG3362|consen  117 LRKFCAVCG-----YDSKYSCVNCGTKYCSV  142 (156)
T ss_pred             cchhhhhcC-----CCchhHHHhcCCceeec
Confidence            457899999     24468999999988863


No 116
>PF06741 LsmAD:  LsmAD domain;  InterPro: IPR009604 This entry represents a conserved region approximately 250 residues long located on eukaryotic ataxin-2 []. Ataxin-2 is a protein of unknown function, within which expansion of a polyglutamine tract (due to expansion of unstable CAG repeats in the coding region of the SCA2 gene) causes spinocerebellar ataxia type 2 (SCA2), a late-onset neurodegenerative disorder []. The expanded polyglutamine repeat in ataxin-2 causes disruption of the normal morphology of the Golgi complex and increased incidence of cell death []. Ataxin-2 is predicted to consist of mostly non-globular domains [].
Probab=40.58  E-value=24  Score=23.07  Aligned_cols=36  Identities=17%  Similarity=0.314  Sum_probs=24.0

Q ss_pred             CCccchhhhHHHhhhhhhhcchhhhhHHHHHHHHHHHH
Q psy1895           5 GLKRSFDDHVKMNKIAEHVKDNVSDDKYKESELALEEL   42 (140)
Q Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~l~~~   42 (140)
                      |.+.+||+..+|-+++..-.  .-++.+.++++--.++
T Consensus         2 GV~stydE~lYTT~Ld~~~~--~~k~~~~~A~riA~EI   37 (72)
T PF06741_consen    2 GVKSTYDENLYTTPLDRSDP--DYKEREAEAERIAREI   37 (72)
T ss_pred             CCCCccCchhceeeccCCCc--chHHHHHHHHHHHHHH
Confidence            78999999999999988643  3344444444433343


No 117
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=40.50  E-value=12  Score=28.49  Aligned_cols=28  Identities=29%  Similarity=0.710  Sum_probs=19.8

Q ss_pred             CCcccccccccccc---ccccccccccCceE
Q psy1895          76 EAITCRACDKEFTV---TRRRHHCRNCGEIF  103 (140)
Q Consensus        76 ~~~~C~~C~~~F~~---~~rkhhCr~CG~i~  103 (140)
                      .-=.|+.|+..|++   +.--.+|..||...
T Consensus       116 ~~Y~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L  146 (178)
T PRK06266        116 MFFFCPNCHIRFTFDEAMEYGFRCPQCGEML  146 (178)
T ss_pred             CEEECCCCCcEEeHHHHhhcCCcCCCCCCCC
Confidence            34469999999984   44456788887653


No 118
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=40.25  E-value=16  Score=26.52  Aligned_cols=28  Identities=32%  Similarity=0.703  Sum_probs=19.2

Q ss_pred             cCcCCccccccccccccccccccccccCce
Q psy1895          73 KDKEAITCRACDKEFTVTRRRHHCRNCGEI  102 (140)
Q Consensus        73 ~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i  102 (140)
                      .......|..|...  .-.|-|||+.||+-
T Consensus        44 ~~~~~~~C~~C~~~--kp~Rs~HC~~C~~C   71 (174)
T PF01529_consen   44 ENGELKYCSTCKII--KPPRSHHCRVCNRC   71 (174)
T ss_pred             cCCCCEECcccCCc--CCCcceeccccccc
Confidence            33445678888764  44578999988764


No 119
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=39.99  E-value=21  Score=20.87  Aligned_cols=8  Identities=38%  Similarity=0.937  Sum_probs=4.1

Q ss_pred             cccCcccH
Q psy1895         121 VRVCDECN  128 (140)
Q Consensus       121 ~RVC~~C~  128 (140)
                      ..||..|-
T Consensus        20 ~~vC~~Cg   27 (52)
T smart00661       20 RFVCRKCG   27 (52)
T ss_pred             EEECCcCC
Confidence            45555553


No 120
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=39.35  E-value=18  Score=21.97  Aligned_cols=22  Identities=32%  Similarity=0.794  Sum_probs=16.5

Q ss_pred             ccccccccccccccccccccccCc
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      ..|..|++.-.  .+-.+||.||.
T Consensus        15 ~ICrkC~ARnp--~~A~~CRKCg~   36 (48)
T PRK04136         15 KICMRCNARNP--WRATKCRKCGY   36 (48)
T ss_pred             cchhcccCCCC--ccccccccCCC
Confidence            46899988654  45678998885


No 121
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=39.20  E-value=18  Score=23.27  Aligned_cols=41  Identities=24%  Similarity=0.759  Sum_probs=16.5

Q ss_pred             cccccccccccccccccc-cccCceEeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          79 TCRACDKEFTVTRRRHHC-RNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhC-r~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      .|..|..   ++ +.-.| -.|.++||+.|.+..+     +.   -|..|+...
T Consensus         9 rCs~C~~---~l-~~pv~l~~CeH~fCs~Ci~~~~-----~~---~CPvC~~Pa   50 (65)
T PF14835_consen    9 RCSICFD---IL-KEPVCLGGCEHIFCSSCIRDCI-----GS---ECPVCHTPA   50 (65)
T ss_dssp             S-SSS-S------SS-B---SSS--B-TTTGGGGT-----TT---B-SSS--B-
T ss_pred             CCcHHHH---Hh-cCCceeccCccHHHHHHhHHhc-----CC---CCCCcCChH
Confidence            3555544   33 34445 7899999999986532     11   277776543


No 122
>PHA02929 N1R/p28-like protein; Provisional
Probab=39.06  E-value=6.2  Score=31.55  Aligned_cols=51  Identities=20%  Similarity=0.444  Sum_probs=32.5

Q ss_pred             CCcccccccccccccc---c-cccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          76 EAITCRACDKEFTVTR---R-RHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~~---r-khhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      ....|.+|...|.--.   + -..=..||++||..|...+..      ....|..|...+.
T Consensus       173 ~~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~------~~~tCPlCR~~~~  227 (238)
T PHA02929        173 KDKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKK------EKNTCPVCRTPFI  227 (238)
T ss_pred             CCCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHh------cCCCCCCCCCEee
Confidence            3468999999765211   0 011237999999999876542      2346777766554


No 123
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=39.03  E-value=22  Score=22.02  Aligned_cols=25  Identities=28%  Similarity=0.651  Sum_probs=13.4

Q ss_pred             ccccccccccccccccccccccCce
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i  102 (140)
                      ..|..|+.+|..-.-..-|.-||.+
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCCCCc
Confidence            4577777777543333444444443


No 124
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=38.88  E-value=5.9  Score=20.40  Aligned_cols=13  Identities=31%  Similarity=0.917  Sum_probs=9.7

Q ss_pred             ccccccccccccc
Q psy1895          79 TCRACDKEFTVTR   91 (140)
Q Consensus        79 ~C~~C~~~F~~~~   91 (140)
                      .|..|+++|..-.
T Consensus         4 ~C~~CgR~F~~~~   16 (25)
T PF13913_consen    4 PCPICGRKFNPDR   16 (25)
T ss_pred             cCCCCCCEECHHH
Confidence            5888888887433


No 125
>PRK11595 DNA utilization protein GntX; Provisional
Probab=38.79  E-value=7.7  Score=30.23  Aligned_cols=29  Identities=24%  Similarity=0.779  Sum_probs=20.0

Q ss_pred             cccccccccccccccccccccCce------EeCCCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI------FCNMCSD  109 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i------~C~~Cs~  109 (140)
                      .|..|...|.++  .++|..||..      +|..|..
T Consensus        22 lC~~C~~~l~~~--~~~C~~Cg~~~~~~~~~C~~C~~   56 (227)
T PRK11595         22 ICSVCSRALRTL--KTCCPQCGLPATHPHLPCGRCLQ   56 (227)
T ss_pred             ccHHHHhhCCcc--cCcCccCCCcCCCCCCCcHHHHc
Confidence            678887777764  4678888864      3666644


No 126
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=38.59  E-value=18  Score=21.88  Aligned_cols=11  Identities=36%  Similarity=0.878  Sum_probs=8.6

Q ss_pred             ccCcccHHHhh
Q psy1895         122 RVCDECNVKLV  132 (140)
Q Consensus       122 RVC~~C~~~l~  132 (140)
                      -||..|+..+.
T Consensus        21 ~iC~~C~~Kl~   31 (51)
T PF14471_consen   21 YICKDCLKKLS   31 (51)
T ss_pred             cchHHHHHHhc
Confidence            58888888873


No 127
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=38.44  E-value=16  Score=27.45  Aligned_cols=15  Identities=53%  Similarity=1.134  Sum_probs=9.7

Q ss_pred             cccccccccccCceE
Q psy1895          89 VTRRRHHCRNCGEIF  103 (140)
Q Consensus        89 ~~~rkhhCr~CG~i~  103 (140)
                      .++|+.+|..||.-|
T Consensus        24 aIRRRReC~~C~~RF   38 (156)
T COG1327          24 AIRRRRECLECGERF   38 (156)
T ss_pred             hhhhhhccccccccc
Confidence            456666777777654


No 128
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=38.34  E-value=20  Score=33.15  Aligned_cols=32  Identities=28%  Similarity=0.808  Sum_probs=18.4

Q ss_pred             cccccccccccccc--cccccccCce-----EeCCCCCC
Q psy1895          79 TCRACDKEFTVTRR--RHHCRNCGEI-----FCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~~~r--khhCr~CG~i-----~C~~Cs~~  110 (140)
                      .|..|...+++-..  .-.|+.||.-     .|..|.+.
T Consensus       446 ~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~  484 (730)
T COG1198         446 ECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSE  484 (730)
T ss_pred             cCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCC
Confidence            46677776665433  3336666665     55555554


No 129
>KOG0119|consensus
Probab=37.15  E-value=54  Score=29.22  Aligned_cols=40  Identities=18%  Similarity=0.128  Sum_probs=24.0

Q ss_pred             cchhhhHHHhhhhhhhcchhhhhHHHHHHHHHHHHHhhhh
Q psy1895           8 RSFDDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLS   47 (140)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~l~~~~~~l~   47 (140)
                      ++-|+.-.+.+..|.|.-.|.-+..|.++.+++.+...++
T Consensus       190 ~~~~d~~~~~~~~epLH~~Isadt~eki~~Ai~vienli~  229 (554)
T KOG0119|consen  190 GRSDDLSYIPKENEPLHCLISADTQEKIKKAIAVIENLIQ  229 (554)
T ss_pred             cCCcccccccccccceeEEEecchHHHHHHHHHHHHHHHH
Confidence            3444444555666667777777766666666665554443


No 130
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=37.00  E-value=14  Score=22.18  Aligned_cols=30  Identities=27%  Similarity=0.706  Sum_probs=19.9

Q ss_pred             cccccccccccccccccccccC---ceEeCCCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCG---EIFCNMCSD  109 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG---~i~C~~Cs~  109 (140)
                      .|..|+. ..+...|+||..|.   --+|..|-.
T Consensus         2 ~Cd~C~~-~pI~G~R~~C~~C~~~d~DlC~~C~~   34 (48)
T cd02341           2 KCDSCGI-EPIPGTRYHCSECDDGDFDLCQDCVV   34 (48)
T ss_pred             CCCCCCC-CccccceEECCCCCCCCCccCHHHHh
Confidence            3777877 22447789999987   446666643


No 131
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=36.56  E-value=19  Score=20.24  Aligned_cols=32  Identities=19%  Similarity=0.413  Sum_probs=20.7

Q ss_pred             CccccccccccccccccccccccCceEeCCCC
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGEIFCNMCS  108 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs  108 (140)
                      ...|..|++.+..+..-..|+.|+.++=..|.
T Consensus        11 ~~~C~~C~~~i~~~~~~~~C~~C~~~~H~~C~   42 (49)
T smart00109       11 PTKCCVCRKSIWGSFQGLRCSWCKVKCHKKCA   42 (49)
T ss_pred             CCCccccccccCcCCCCcCCCCCCchHHHHHH
Confidence            45799999887654335668887765444443


No 132
>KOG2462|consensus
Probab=36.18  E-value=13  Score=30.52  Aligned_cols=54  Identities=20%  Similarity=0.611  Sum_probs=31.9

Q ss_pred             Cccccccccccc---cc---------cccccccccCceEeCCCCCCeeeCCC-CCCCcccCcccHHHh
Q psy1895          77 AITCRACDKEFT---VT---------RRRHHCRNCGEIFCNMCSDNKMALPS-AAKPVRVCDECNVKL  131 (140)
Q Consensus        77 ~~~C~~C~~~F~---~~---------~rkhhCr~CG~i~C~~Cs~~~~~lp~-~~~~~RVC~~C~~~l  131 (140)
                      .-.|.+|++.|+   +|         .+-..|..||+.|=++ |+-++-+-. ++...--|..|.+..
T Consensus       187 ~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADR-SNLRAHmQTHS~~K~~qC~~C~KsF  253 (279)
T KOG2462|consen  187 PCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADR-SNLRAHMQTHSDVKKHQCPRCGKSF  253 (279)
T ss_pred             CcccccccccccchHHhhcccccccCCCCccCCcccchhcch-HHHHHHHHhhcCCccccCcchhhHH
Confidence            457999999998   33         2344588888877332 111211111 134467788887654


No 133
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=36.08  E-value=25  Score=18.20  Aligned_cols=8  Identities=50%  Similarity=1.265  Sum_probs=4.9

Q ss_pred             cccccccC
Q psy1895          93 RHHCRNCG  100 (140)
Q Consensus        93 khhCr~CG  100 (140)
                      .+.|.+||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35577776


No 134
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=36.07  E-value=50  Score=23.99  Aligned_cols=30  Identities=23%  Similarity=0.686  Sum_probs=18.1

Q ss_pred             CcCCccccccccccccccc--------cccccccCceE
Q psy1895          74 DKEAITCRACDKEFTVTRR--------RHHCRNCGEIF  103 (140)
Q Consensus        74 ~~~~~~C~~C~~~F~~~~r--------khhCr~CG~i~  103 (140)
                      +...=.|+.|+..|++..-        ...|..||..+
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLLDMDGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEE
Confidence            3344579999999985322        24555665543


No 135
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=35.71  E-value=14  Score=20.72  Aligned_cols=29  Identities=24%  Similarity=0.611  Sum_probs=18.5

Q ss_pred             ccccccccccccccccccccccCceEeCCCCCC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      ..|..+....    -...|..|+..+|..|...
T Consensus         4 ~~C~~H~~~~----~~~~C~~C~~~~C~~C~~~   32 (42)
T PF00643_consen    4 PKCPEHPEEP----LSLFCEDCNEPLCSECTVS   32 (42)
T ss_dssp             SB-SSTTTSB----EEEEETTTTEEEEHHHHHT
T ss_pred             ccCccCCccc----eEEEecCCCCccCccCCCC
Confidence            4566666531    2356888888888888543


No 136
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=34.74  E-value=16  Score=26.13  Aligned_cols=24  Identities=29%  Similarity=0.675  Sum_probs=21.2

Q ss_pred             cccccccccccccccccccccCce
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI  102 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i  102 (140)
                      .|+.|++..-.+.|-.-|-+|++.
T Consensus        71 ~CP~C~K~TKmLGr~D~CM~C~~p   94 (114)
T PF11023_consen   71 ECPNCGKQTKMLGRVDACMHCKEP   94 (114)
T ss_pred             ECCCCCChHhhhchhhccCcCCCc
Confidence            699999999899998889998875


No 137
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=34.72  E-value=29  Score=20.34  Aligned_cols=35  Identities=20%  Similarity=0.548  Sum_probs=25.8

Q ss_pred             CCcccccccccc-ccccccccccccCceEeCCCCCC
Q psy1895          76 EAITCRACDKEF-TVTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        76 ~~~~C~~C~~~F-~~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      ....|..|++.. ++...-..|..|+.++=..|...
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~~~   45 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLVCHKKCLSK   45 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-EEETTGGCT
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCChHhhhhhhh
Confidence            456899999987 56677788999999887777665


No 138
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=34.53  E-value=8.8  Score=19.93  Aligned_cols=15  Identities=33%  Similarity=0.864  Sum_probs=11.1

Q ss_pred             cccCceEeCCCCCCe
Q psy1895          97 RNCGEIFCNMCSDNK  111 (140)
Q Consensus        97 r~CG~i~C~~Cs~~~  111 (140)
                      ..||++||..|....
T Consensus        14 ~~C~H~~c~~C~~~~   28 (39)
T smart00184       14 LPCGHTFCRSCIRKW   28 (39)
T ss_pred             ecCCChHHHHHHHHH
Confidence            458888888887643


No 139
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=34.31  E-value=21  Score=20.01  Aligned_cols=11  Identities=36%  Similarity=0.890  Sum_probs=4.7

Q ss_pred             ccccccccccc
Q psy1895          78 ITCRACDKEFT   88 (140)
Q Consensus        78 ~~C~~C~~~F~   88 (140)
                      ..|..|+++|.
T Consensus         4 ~~C~eC~~~f~   14 (34)
T PF01286_consen    4 PKCDECGKPFM   14 (34)
T ss_dssp             EE-TTT--EES
T ss_pred             chHhHhCCHHH
Confidence            45666666664


No 140
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=34.27  E-value=6.7  Score=24.21  Aligned_cols=43  Identities=26%  Similarity=0.744  Sum_probs=31.6

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      .|..|+..|.+ ..-..|..||+--|+.|-..         ..-.|..|..++
T Consensus         9 ~CDLCn~~~p~-~~LRQCvlCGRWaC~sCW~d---------eYY~CksC~Gii   51 (57)
T PF14445_consen    9 SCDLCNSSHPI-SELRQCVLCGRWACNSCWQD---------EYYTCKSCNGII   51 (57)
T ss_pred             hHHhhcccCcH-HHHHHHhhhchhhhhhhhhh---------hHhHHHhhhchh
Confidence            58889998874 34468999999999999754         335666776554


No 141
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=33.92  E-value=20  Score=21.41  Aligned_cols=13  Identities=23%  Similarity=0.759  Sum_probs=10.2

Q ss_pred             cccccccCceEeC
Q psy1895          93 RHHCRNCGEIFCN  105 (140)
Q Consensus        93 khhCr~CG~i~C~  105 (140)
                      |+.|+.||.|+=.
T Consensus         1 ky~C~~CgyvYd~   13 (47)
T PF00301_consen    1 KYQCPVCGYVYDP   13 (47)
T ss_dssp             EEEETTTSBEEET
T ss_pred             CcCCCCCCEEEcC
Confidence            5789999998743


No 142
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=33.68  E-value=19  Score=20.93  Aligned_cols=30  Identities=23%  Similarity=0.682  Sum_probs=21.4

Q ss_pred             cccccccccccccccccccccC-ceEeCCCCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCG-EIFCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG-~i~C~~Cs~~  110 (140)
                      .|..|+.  .+...+++|..|- --+|..|-..
T Consensus         2 ~Cd~C~~--~i~G~ry~C~~C~d~dLC~~C~~~   32 (43)
T cd02340           2 ICDGCQG--PIVGVRYKCLVCPDYDLCESCEAK   32 (43)
T ss_pred             CCCCCCC--cCcCCeEECCCCCCccchHHhhCc
Confidence            4788888  4566788999884 5577777443


No 143
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=33.48  E-value=25  Score=20.68  Aligned_cols=15  Identities=27%  Similarity=0.718  Sum_probs=11.8

Q ss_pred             Ccccccccccccccc
Q psy1895          77 AITCRACDKEFTVTR   91 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~   91 (140)
                      ...|..|+++|+...
T Consensus         8 ~K~C~~C~rpf~WRK   22 (42)
T PF10013_consen    8 SKICPVCGRPFTWRK   22 (42)
T ss_pred             CCcCcccCCcchHHH
Confidence            358999999998543


No 144
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=33.37  E-value=22  Score=24.36  Aligned_cols=7  Identities=57%  Similarity=1.588  Sum_probs=3.5

Q ss_pred             ccccCce
Q psy1895          96 CRNCGEI  102 (140)
Q Consensus        96 Cr~CG~i  102 (140)
                      |+.||..
T Consensus        19 CrRCG~~   25 (91)
T PTZ00073         19 CRRCGKR   25 (91)
T ss_pred             hcccCcc
Confidence            5555543


No 145
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=33.19  E-value=24  Score=25.32  Aligned_cols=10  Identities=30%  Similarity=1.152  Sum_probs=5.0

Q ss_pred             cccccccccc
Q psy1895          79 TCRACDKEFT   88 (140)
Q Consensus        79 ~C~~C~~~F~   88 (140)
                      .|..|+..+.
T Consensus       125 ~C~~C~~~~~  134 (157)
T PF10263_consen  125 RCPSCGREYK  134 (157)
T ss_pred             EcCCCCCEee
Confidence            4555554443


No 146
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=33.08  E-value=33  Score=23.78  Aligned_cols=43  Identities=23%  Similarity=0.492  Sum_probs=26.2

Q ss_pred             CccccccccccccccccccccccCceEeCCCCCCe-eeCCCCCCCcc
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNK-MALPSAAKPVR  122 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~-~~lp~~~~~~R  122 (140)
                      .-.|..|+. ..+...+.+  .=+++.|..|..+. ..++....|+-
T Consensus        21 ~f~CP~Cge-~~v~v~~~k--~~~h~~C~~CG~y~~~~V~~l~epID   64 (99)
T PRK14892         21 IFECPRCGK-VSISVKIKK--NIAIITCGNCGLYTEFEVPSVYDEVD   64 (99)
T ss_pred             EeECCCCCC-eEeeeecCC--CcceEECCCCCCccCEECCccccchh
Confidence            456888884 454433333  56788999998774 33444455543


No 147
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=32.98  E-value=19  Score=20.85  Aligned_cols=21  Identities=33%  Similarity=0.833  Sum_probs=14.8

Q ss_pred             ccccccccccccccccccccccC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCG  100 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG  100 (140)
                      ..|..|++.  +...+++|..|.
T Consensus         5 ~~C~~C~~~--i~g~ry~C~~C~   25 (44)
T smart00291        5 YSCDTCGKP--IVGVRYHCLVCP   25 (44)
T ss_pred             cCCCCCCCC--CcCCEEECCCCC
Confidence            368889884  445677888774


No 148
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=32.89  E-value=15  Score=17.65  Aligned_cols=10  Identities=40%  Similarity=1.112  Sum_probs=7.2

Q ss_pred             cccccccccc
Q psy1895          79 TCRACDKEFT   88 (140)
Q Consensus        79 ~C~~C~~~F~   88 (140)
                      .|..|++.|.
T Consensus         2 ~C~~C~~~f~   11 (23)
T PF00096_consen    2 KCPICGKSFS   11 (23)
T ss_dssp             EETTTTEEES
T ss_pred             CCCCCCCccC
Confidence            3777887776


No 149
>KOG4080|consensus
Probab=32.50  E-value=21  Score=27.19  Aligned_cols=14  Identities=29%  Similarity=0.619  Sum_probs=10.5

Q ss_pred             CCcccCcccHHHhh
Q psy1895         119 KPVRVCDECNVKLV  132 (140)
Q Consensus       119 ~~~RVC~~C~~~l~  132 (140)
                      ...-.|+.||..+.
T Consensus       104 ~a~~LC~~Cy~kV~  117 (176)
T KOG4080|consen  104 PAHTLCDYCYAKVH  117 (176)
T ss_pred             cccccHHHHHHHHH
Confidence            45678999998764


No 150
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=32.47  E-value=20  Score=30.82  Aligned_cols=48  Identities=21%  Similarity=0.605  Sum_probs=31.9

Q ss_pred             cCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          75 KEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        75 ~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      ...-.|.+|...|..-    .--.||+.||..|......      ....|..|...+.
T Consensus        24 e~~l~C~IC~d~~~~P----vitpCgH~FCs~CI~~~l~------~~~~CP~Cr~~~~   71 (397)
T TIGR00599        24 DTSLRCHICKDFFDVP----VLTSCSHTFCSLCIRRCLS------NQPKCPLCRAEDQ   71 (397)
T ss_pred             ccccCCCcCchhhhCc----cCCCCCCchhHHHHHHHHh------CCCCCCCCCCccc
Confidence            3446899999877521    1358999999999875432      1236777766543


No 151
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=32.22  E-value=29  Score=19.91  Aligned_cols=11  Identities=27%  Similarity=0.748  Sum_probs=6.8

Q ss_pred             ccccccccccc
Q psy1895          78 ITCRACDKEFT   88 (140)
Q Consensus        78 ~~C~~C~~~F~   88 (140)
                      ..|..|+..|.
T Consensus         3 ~~C~~Cg~~l~   13 (47)
T PF13005_consen    3 RACPDCGGELK   13 (47)
T ss_pred             CcCCCCCceee
Confidence            35666666665


No 152
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=31.78  E-value=17  Score=22.29  Aligned_cols=29  Identities=31%  Similarity=0.613  Sum_probs=15.1

Q ss_pred             ccccccccccccccccccccCceEeCCCCCC
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      |..|+..++..-|+.-  .=+..+|+.|.-+
T Consensus         2 C~~C~~~~Tp~WR~g~--~~~~~LCNaCgl~   30 (54)
T cd00202           2 CSNCGTTTTPLWRRGP--SGGSTLCNACGLY   30 (54)
T ss_pred             CCCCCCCCCcccccCC--CCcchHHHHHHHH
Confidence            6666666665444432  3344555555444


No 153
>KOG1812|consensus
Probab=31.59  E-value=21  Score=30.42  Aligned_cols=32  Identities=31%  Similarity=0.890  Sum_probs=22.6

Q ss_pred             ccccccccccccccc--cccccccCceEeCCCCCC
Q psy1895          78 ITCRACDKEFTVTRR--RHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r--khhCr~CG~i~C~~Cs~~  110 (140)
                      ..|+.|+...-+...  .-+|| ||.-||..|-..
T Consensus       307 r~CpkC~~~ie~~~GCnhm~Cr-C~~~fcy~C~~~  340 (384)
T KOG1812|consen  307 RQCPKCKFMIELSEGCNHMTCR-CGHQFCYMCGGD  340 (384)
T ss_pred             CcCcccceeeeecCCcceEEee-ccccchhhcCcc
Confidence            468888775444333  34499 999999999843


No 154
>PF07130 YebG:  YebG protein;  InterPro: IPR009813 This family consists of several bacterial YebG proteins of around 75 residues in length. The exact function of this protein is unknown but it is thought to be involved in the SOS response. The induction of the yebG gene occurs as cell enter into the stationary growth phase and is dependent on is dependent on cyclic AMP and H-NS [].; PDB: 3ERM_E.
Probab=31.41  E-value=86  Score=20.73  Aligned_cols=43  Identities=26%  Similarity=0.272  Sum_probs=30.3

Q ss_pred             hhhHHHhhhhhhhcchhhhhHHHHHHHHHHHHHhhhhhhHHHH
Q psy1895          11 DDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQV   53 (140)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~r~~~~~~~~~l~~~~~~l~~s~~~~   53 (140)
                      |..=||..+++++.+.+.......-+...++++.-|...+..+
T Consensus        26 DAyDKmLd~Ad~L~~~L~~~~~~lde~~~E~l~l~LA~~kd~~   68 (75)
T PF07130_consen   26 DAYDKMLDLADNLTDFLEQSVLGLDEAQAEELALYLAENKDEL   68 (75)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHSTT--HHHHHHHHHHHHTTHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHCHHHH
Confidence            4556889999999998888777666777777777666555433


No 155
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=31.41  E-value=20  Score=30.24  Aligned_cols=9  Identities=44%  Similarity=1.180  Sum_probs=4.0

Q ss_pred             Ccccccccc
Q psy1895          77 AITCRACDK   85 (140)
Q Consensus        77 ~~~C~~C~~   85 (140)
                      +..|..|..
T Consensus       252 av~C~~C~y  260 (344)
T PF09332_consen  252 AVTCKQCKY  260 (344)
T ss_dssp             EEEETTT--
T ss_pred             EEEcCCCCC
Confidence            345666643


No 156
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=31.32  E-value=28  Score=21.03  Aligned_cols=25  Identities=36%  Similarity=0.747  Sum_probs=16.4

Q ss_pred             ccccccccccc-----cc---cccccccccCce
Q psy1895          78 ITCRACDKEFT-----VT---RRRHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~-----~~---~rkhhCr~CG~i  102 (140)
                      ..|..|+-..+     -+   ....+|.+||+|
T Consensus        23 ~~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   23 GTCSGCHMELPPQELNEIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             CccCCCCEEcCHHHHHHHHcCCCeEECcCCCcc
Confidence            47999988765     11   234667787776


No 157
>KOG1311|consensus
Probab=31.06  E-value=22  Score=28.60  Aligned_cols=23  Identities=26%  Similarity=0.598  Sum_probs=16.7

Q ss_pred             CccccccccccccccccccccccCc
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGE  101 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~  101 (140)
                      ...|..|+.-  .-.|-|||+.|+.
T Consensus       113 ~~~C~~C~~~--rPpRs~HCsvC~~  135 (299)
T KOG1311|consen  113 WKYCDTCQLY--RPPRSSHCSVCNN  135 (299)
T ss_pred             eEEcCcCccc--CCCCcccchhhcc
Confidence            4678888774  5577888888765


No 158
>KOG2807|consensus
Probab=31.02  E-value=32  Score=29.08  Aligned_cols=51  Identities=24%  Similarity=0.595  Sum_probs=32.8

Q ss_pred             cccCcCCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccH
Q psy1895          71 WAKDKEAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECN  128 (140)
Q Consensus        71 W~~~~~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~  128 (140)
                      |........|..|+... .-..++.|..|-.+||.+|-.+-      ......|..|-
T Consensus       324 ~~~~~~~~~Cf~C~~~~-~~~~~y~C~~Ck~~FCldCDv~i------HesLh~CpgCe  374 (378)
T KOG2807|consen  324 ETEYNGSRFCFACQGEL-LSSGRYRCESCKNVFCLDCDVFI------HESLHNCPGCE  374 (378)
T ss_pred             ccccCCCcceeeecccc-CCCCcEEchhccceeeccchHHH------HhhhhcCCCcC
Confidence            33333344699994322 34557889999999999996542      24456666664


No 159
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=30.88  E-value=23  Score=25.77  Aligned_cols=25  Identities=28%  Similarity=0.725  Sum_probs=17.6

Q ss_pred             ccccccccccccccc-----cccccccCce
Q psy1895          78 ITCRACDKEFTVTRR-----RHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r-----khhCr~CG~i  102 (140)
                      -.|..|+.+-+.+.+     -.+|..||..
T Consensus        98 VlC~~C~sPdT~l~k~~r~~~l~C~ACGa~  127 (133)
T TIGR00311        98 VICRECNRPDTRIIKEGRVSLLKCEACGAK  127 (133)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEecccCCCC
Confidence            369999999886655     2357777653


No 160
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=30.58  E-value=30  Score=25.76  Aligned_cols=15  Identities=47%  Similarity=0.933  Sum_probs=9.7

Q ss_pred             cccccccccccCceE
Q psy1895          89 VTRRRHHCRNCGEIF  103 (140)
Q Consensus        89 ~~~rkhhCr~CG~i~  103 (140)
                      .++|+..|..||+-|
T Consensus        24 ~IRRRReC~~C~~RF   38 (147)
T TIGR00244        24 SIRRRRECLECHERF   38 (147)
T ss_pred             eeeecccCCccCCcc
Confidence            456666777777655


No 161
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=29.94  E-value=16  Score=23.69  Aligned_cols=39  Identities=31%  Similarity=0.638  Sum_probs=25.2

Q ss_pred             ccccccCceEeCCCCCCe-e-------eCCC--C--CCCcccCcccHHHhh
Q psy1895          94 HHCRNCGEIFCNMCSDNK-M-------ALPS--A--AKPVRVCDECNVKLV  132 (140)
Q Consensus        94 hhCr~CG~i~C~~Cs~~~-~-------~lp~--~--~~~~RVC~~C~~~l~  132 (140)
                      --|..||..+|...+... .       |+|.  .  .-|--+|..|+..+.
T Consensus        17 avCivCG~GlC~~H~~~e~~~~~~g~yp~~~~~~~~~l~RilC~~C~~a~~   67 (68)
T PF09947_consen   17 AVCIVCGAGLCMDHSKREEIPVWEGGYPFPSKKLKKPLPRILCPECHAALK   67 (68)
T ss_pred             ehHHhcCchhhHHHHhhhheeeeccCCCCccccccCCCCeeecHHHHHHhh
Confidence            458889999988877642 1       1221  1  345568999998653


No 162
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=29.61  E-value=21  Score=20.79  Aligned_cols=30  Identities=30%  Similarity=0.724  Sum_probs=20.1

Q ss_pred             cccccccccccccccccccccC-ceEeCCCCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCG-EIFCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG-~i~C~~Cs~~  110 (140)
                      .|..|.++  +...+.+|..|. -.+|..|-..
T Consensus         2 ~C~~C~~~--i~g~r~~C~~C~d~dLC~~Cf~~   32 (46)
T cd02249           2 SCDGCLKP--IVGVRYHCLVCEDFDLCSSCYAK   32 (46)
T ss_pred             CCcCCCCC--CcCCEEECCCCCCCcCHHHHHCc
Confidence            47888883  445788888886 4466666443


No 163
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=29.50  E-value=31  Score=24.53  Aligned_cols=26  Identities=27%  Similarity=0.647  Sum_probs=19.7

Q ss_pred             ccccccccccccccccccccCceEeCCC
Q psy1895          80 CRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        80 C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      |+.|+.++.  ..+.+|.+||-.+-+.-
T Consensus         1 CPvCg~~l~--vt~l~C~~C~t~i~G~F   26 (113)
T PF09862_consen    1 CPVCGGELV--VTRLKCPSCGTEIEGEF   26 (113)
T ss_pred             CCCCCCceE--EEEEEcCCCCCEEEeee
Confidence            888998655  56788999998876543


No 164
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=29.00  E-value=15  Score=26.73  Aligned_cols=20  Identities=35%  Similarity=0.796  Sum_probs=11.5

Q ss_pred             CcCCccccccccccccccccc
Q psy1895          74 DKEAITCRACDKEFTVTRRRH   94 (140)
Q Consensus        74 ~~~~~~C~~C~~~F~~~~rkh   94 (140)
                      ..+.-.|..|+++|..+ +||
T Consensus        69 ~~d~i~clecGk~~k~L-krH   88 (132)
T PF05443_consen   69 TPDYIICLECGKKFKTL-KRH   88 (132)
T ss_dssp             -SS-EE-TBT--EESBH-HHH
T ss_pred             ccCeeEEccCCcccchH-HHH
Confidence            34456899999999998 444


No 165
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=28.79  E-value=28  Score=19.54  Aligned_cols=24  Identities=21%  Similarity=0.591  Sum_probs=14.3

Q ss_pred             cccccccccc-cccccccccccCce
Q psy1895          79 TCRACDKEFT-VTRRRHHCRNCGEI  102 (140)
Q Consensus        79 ~C~~C~~~F~-~~~rkhhCr~CG~i  102 (140)
                      .|..|+..|. .-...+-|..||.+
T Consensus        10 ~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen   10 PCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             cCCCCCCeEeEccCCEEEhhhCceE
Confidence            4888888744 33445556666654


No 166
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=28.42  E-value=45  Score=27.73  Aligned_cols=55  Identities=27%  Similarity=0.581  Sum_probs=35.4

Q ss_pred             Cccccccccc--cccc-------cccccccccCc------eEeCCCCCCeeeC-----CCC--CCCcccCcccHHHhh
Q psy1895          77 AITCRACDKE--FTVT-------RRRHHCRNCGE------IFCNMCSDNKMAL-----PSA--AKPVRVCDECNVKLV  132 (140)
Q Consensus        77 ~~~C~~C~~~--F~~~-------~rkhhCr~CG~------i~C~~Cs~~~~~l-----p~~--~~~~RVC~~C~~~l~  132 (140)
                      ...|+.|+..  .+++       .|..||..|+.      +-|..|-... .+     ...  ...+-+|+.|..-+.
T Consensus       187 ~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~~-~l~y~~~~~~~~~~r~e~C~~C~~YlK  263 (309)
T PRK03564        187 RQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVRVKCSNCEQSG-KLHYWSLDSEQAAVKAESCGDCGTYLK  263 (309)
T ss_pred             CCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccCccCCCCCCCC-ceeeeeecCCCcceEeeecccccccce
Confidence            4689999986  2322       46678999984      5788887642 22     211  234578999976553


No 167
>KOG3795|consensus
Probab=28.09  E-value=29  Score=26.95  Aligned_cols=23  Identities=30%  Similarity=0.772  Sum_probs=16.9

Q ss_pred             cccccccccccccCc---eEeCCCCC
Q psy1895          87 FTVTRRRHHCRNCGE---IFCNMCSD  109 (140)
Q Consensus        87 F~~~~rkhhCr~CG~---i~C~~Cs~  109 (140)
                      |.....||.|+.||.   .||-.|.-
T Consensus         9 ~d~ieGRs~C~~C~~SRkFfCY~C~V   34 (230)
T KOG3795|consen    9 FDPIEGRSTCPGCKSSRKFFCYDCRV   34 (230)
T ss_pred             cCcccccccCCCCCCcceEEEEeecc
Confidence            455667788888885   48988864


No 168
>PHA00733 hypothetical protein
Probab=28.03  E-value=1.2e+02  Score=21.57  Aligned_cols=26  Identities=27%  Similarity=0.671  Sum_probs=16.8

Q ss_pred             cccccccccccccc----------ccccccccCceE
Q psy1895          78 ITCRACDKEFTVTR----------RRHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~~----------rkhhCr~CG~i~  103 (140)
                      -.|..|++.|....          ..+.|..||+.|
T Consensus        74 y~C~~Cgk~Fss~s~L~~H~r~h~~~~~C~~CgK~F  109 (128)
T PHA00733         74 YVCPLCLMPFSSSVSLKQHIRYTEHSKVCPVCGKEF  109 (128)
T ss_pred             ccCCCCCCcCCCHHHHHHHHhcCCcCccCCCCCCcc
Confidence            47999999987221          234566666665


No 169
>PHA00732 hypothetical protein
Probab=27.97  E-value=47  Score=21.88  Aligned_cols=9  Identities=22%  Similarity=0.586  Sum_probs=4.7

Q ss_pred             ccccccccc
Q psy1895          80 CRACDKEFT   88 (140)
Q Consensus        80 C~~C~~~F~   88 (140)
                      |..|++.|.
T Consensus         4 C~~Cgk~F~   12 (79)
T PHA00732          4 CPICGFTTV   12 (79)
T ss_pred             CCCCCCccC
Confidence            555555554


No 170
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=27.66  E-value=40  Score=29.60  Aligned_cols=33  Identities=27%  Similarity=0.745  Sum_probs=19.9

Q ss_pred             cccccccccccc--cccccccccCce-----EeCCCCCCe
Q psy1895          79 TCRACDKEFTVT--RRRHHCRNCGEI-----FCNMCSDNK  111 (140)
Q Consensus        79 ~C~~C~~~F~~~--~rkhhCr~CG~i-----~C~~Cs~~~  111 (140)
                      .|..|..+.+.-  ...-.|..||..     .|..|.+..
T Consensus       224 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~~  263 (505)
T TIGR00595       224 CCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGSED  263 (505)
T ss_pred             CCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCCCe
Confidence            366666655532  334558888766     577776643


No 171
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=27.65  E-value=40  Score=20.85  Aligned_cols=16  Identities=25%  Similarity=0.594  Sum_probs=11.1

Q ss_pred             cccccccccCceEeCC
Q psy1895          91 RRRHHCRNCGEIFCNM  106 (140)
Q Consensus        91 ~rkhhCr~CG~i~C~~  106 (140)
                      .+..-|-.||.++|.+
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            3445688999999885


No 172
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=27.46  E-value=49  Score=27.43  Aligned_cols=56  Identities=25%  Similarity=0.618  Sum_probs=34.1

Q ss_pred             Ccccccccccc--ccc--------cccccccccCc------eEeCCCCCCe----eeCCC--CCCCcc--cCcccHHHhh
Q psy1895          77 AITCRACDKEF--TVT--------RRRHHCRNCGE------IFCNMCSDNK----MALPS--AAKPVR--VCDECNVKLV  132 (140)
Q Consensus        77 ~~~C~~C~~~F--~~~--------~rkhhCr~CG~------i~C~~Cs~~~----~~lp~--~~~~~R--VC~~C~~~l~  132 (140)
                      ...|++|+..=  +++        .|..||..|+.      +-|..|-...    ..+..  ....+|  +|+.|..-+.
T Consensus       184 ~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~~~l~y~~~e~~~~~~~~r~e~C~~C~~YlK  263 (305)
T TIGR01562       184 RTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYVRVKCSHCEESKHLAYLSLEHDAEKAVLKAETCDSCQGYLK  263 (305)
T ss_pred             CCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCcccccCccCCCCCCCCceeeEeecCCCCCcceEEeeccccccchh
Confidence            45899999853  222        35678998884      5788886642    11111  112345  9999976553


No 173
>KOG2593|consensus
Probab=27.40  E-value=93  Score=27.16  Aligned_cols=34  Identities=26%  Similarity=0.617  Sum_probs=26.3

Q ss_pred             Cccccccccccccc---------cccccccccCceEeCCCCCC
Q psy1895          77 AITCRACDKEFTVT---------RRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        77 ~~~C~~C~~~F~~~---------~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      .=.|+.|+++|+.|         ....||-+||.-+=..|+..
T Consensus       128 ~Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gelveDe~~~  170 (436)
T KOG2593|consen  128 GYVCPNCQKKYTSLEALQLLDNETGEFHCENCGGELVEDENKL  170 (436)
T ss_pred             cccCCccccchhhhHHHHhhcccCceEEEecCCCchhcccccC
Confidence            34799999999832         35889999998887777653


No 174
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=27.40  E-value=44  Score=19.36  Aligned_cols=30  Identities=20%  Similarity=0.805  Sum_probs=18.5

Q ss_pred             CccccCcCCccccccccc--ccccc-ccccccccCc
Q psy1895          69 AQWAKDKEAITCRACDKE--FTVTR-RRHHCRNCGE  101 (140)
Q Consensus        69 ~~W~~~~~~~~C~~C~~~--F~~~~-rkhhCr~CG~  101 (140)
                      ..|...   ..|+.|+..  +.+.. .++.|+.|++
T Consensus        13 ~RW~~g---~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   13 IRWPDG---FVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             hcCCCC---CCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            457655   469999873  22222 5667888764


No 175
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=27.16  E-value=20  Score=20.98  Aligned_cols=22  Identities=32%  Similarity=0.803  Sum_probs=12.4

Q ss_pred             ccccccccccccccccccccccC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCG  100 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG  100 (140)
                      ..|..|+.. .+...|++|..|.
T Consensus         5 ~~C~~C~~~-~i~g~Ry~C~~C~   26 (46)
T PF00569_consen    5 YTCDGCGTD-PIIGVRYHCLVCP   26 (46)
T ss_dssp             CE-SSS-SS-SEESSEEEESSSS
T ss_pred             eECcCCCCC-cCcCCeEECCCCC
Confidence            468888873 3334567777764


No 176
>KOG0153|consensus
Probab=26.84  E-value=29  Score=29.47  Aligned_cols=23  Identities=26%  Similarity=0.563  Sum_probs=18.0

Q ss_pred             ccCcCCccccccccccccccccc
Q psy1895          72 AKDKEAITCRACDKEFTVTRRRH   94 (140)
Q Consensus        72 ~~~~~~~~C~~C~~~F~~~~rkh   94 (140)
                      .......+|.+|.++|++|+.+-
T Consensus        36 tK~~~gkECKICtrPfT~Frw~p   58 (377)
T KOG0153|consen   36 TKEPYGKECKICTRPFTIFRWCP   58 (377)
T ss_pred             eccccCCccceecCcceEEEecc
Confidence            45556689999999999986643


No 177
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=26.21  E-value=61  Score=28.24  Aligned_cols=40  Identities=18%  Similarity=0.372  Sum_probs=23.4

Q ss_pred             ccccccccccCceEeCCCCCCeeeCCCC-----CCCcccCcccHH
Q psy1895          90 TRRRHHCRNCGEIFCNMCSDNKMALPSA-----AKPVRVCDECNV  129 (140)
Q Consensus        90 ~~rkhhCr~CG~i~C~~Cs~~~~~lp~~-----~~~~RVC~~C~~  129 (140)
                      -..++.|+.||.++=..=......+|..     -..--+|..|-.
T Consensus       422 ~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCC
Confidence            4567889999999854322222223332     122468888853


No 178
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional
Probab=26.05  E-value=2e+02  Score=25.45  Aligned_cols=44  Identities=27%  Similarity=0.408  Sum_probs=26.5

Q ss_pred             CCCc-cchhhhHHHhhhhhh-hcchhhhhHHHHHHHHHHHHHhhhh
Q psy1895           4 GGLK-RSFDDHVKMNKIAEH-VKDNVSDDKYKESELALEELGAQLS   47 (140)
Q Consensus         4 ~~~~-~~~~~~~~~~~~~~~-~~~~~~r~~~~~~~~~l~~~~~~l~   47 (140)
                      ||++ ..|+++|-..++.++ .+..-++++++.+.+.++.+..++.
T Consensus        55 ~~vV~~~FddkVnqSALteqQ~kasELEKqLaaLrqElq~~saq~~  100 (475)
T PRK13729         55 TGVVDTTFDDKVRQHATTEMQVTAAQMQKQYEEIRRELDVLNKQRG  100 (475)
T ss_pred             cceecchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhh
Confidence            3444 478888888877766 4666666666665555554434333


No 179
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=25.88  E-value=38  Score=24.76  Aligned_cols=24  Identities=33%  Similarity=0.870  Sum_probs=17.1

Q ss_pred             ccccccccccccccccccccccCceEeCCCCC
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSD  109 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~  109 (140)
                      .+|+.|+.+.  |.      .=|.|||.-|-.
T Consensus        29 ~hCp~Cg~PL--F~------KdG~v~CPvC~~   52 (131)
T COG1645          29 KHCPKCGTPL--FR------KDGEVFCPVCGY   52 (131)
T ss_pred             hhCcccCCcc--ee------eCCeEECCCCCc
Confidence            3799999963  32      347888888873


No 180
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=25.71  E-value=50  Score=22.56  Aligned_cols=26  Identities=35%  Similarity=0.878  Sum_probs=18.0

Q ss_pred             ccccccccccccccc----cccccccCceEeC
Q psy1895          78 ITCRACDKEFTVTRR----RHHCRNCGEIFCN  105 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r----khhCr~CG~i~C~  105 (140)
                      ..|+.|.++ . ..|    .-.|+.||..|=.
T Consensus        36 ~~Cp~C~~~-~-VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          36 HVCPFCGRT-T-VKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CcCCCCCCc-c-eeeeccCeEEcCCCCCeecc
Confidence            479999997 3 222    3458899988744


No 181
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=25.66  E-value=22  Score=21.72  Aligned_cols=15  Identities=20%  Similarity=0.749  Sum_probs=12.0

Q ss_pred             ccccccccccccccc
Q psy1895          78 ITCRACDKEFTVTRR   92 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r   92 (140)
                      ..|..|+++|+..++
T Consensus        13 KICpvCqRPFsWRkK   27 (54)
T COG4338          13 KICPVCQRPFSWRKK   27 (54)
T ss_pred             hhhhhhcCchHHHHH
Confidence            489999999996543


No 182
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=25.55  E-value=23  Score=33.40  Aligned_cols=32  Identities=34%  Similarity=0.994  Sum_probs=0.0

Q ss_pred             ccccccccCce----EeCCCCCCeeeCCCCCCCcccCcccHHH
Q psy1895          92 RRHHCRNCGEI----FCNMCSDNKMALPSAAKPVRVCDECNVK  130 (140)
Q Consensus        92 rkhhCr~CG~i----~C~~Cs~~~~~lp~~~~~~RVC~~C~~~  130 (140)
                      -...|..||..    .|..|..++       .|+++|..|-..
T Consensus       654 ~~r~Cp~Cg~~t~~~~Cp~CG~~T-------~~~~~Cp~C~~~  689 (900)
T PF03833_consen  654 GRRRCPKCGKETFYNRCPECGSHT-------EPVYVCPDCGIE  689 (900)
T ss_dssp             -------------------------------------------
T ss_pred             ecccCcccCCcchhhcCcccCCcc-------ccceeccccccc
Confidence            34556666654    566665553       345555555443


No 183
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=25.45  E-value=38  Score=20.28  Aligned_cols=16  Identities=31%  Similarity=0.532  Sum_probs=12.7

Q ss_pred             CCCcccCcccHHHhhc
Q psy1895         118 AKPVRVCDECNVKLVE  133 (140)
Q Consensus       118 ~~~~RVC~~C~~~l~~  133 (140)
                      +.|.-+|..|++.|+=
T Consensus         3 GAPFv~C~~C~~lLql   18 (46)
T PF11331_consen    3 GAPFVVCSSCFELLQL   18 (46)
T ss_pred             CCCEeECccHHHHHcC
Confidence            4578899999998863


No 184
>KOG1356|consensus
Probab=25.31  E-value=32  Score=32.44  Aligned_cols=34  Identities=24%  Similarity=0.530  Sum_probs=26.6

Q ss_pred             CccccccccccccccccccccccCceEeCCCCCCee
Q psy1895          77 AITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      ...|..|.+  ++|+-.--|+.||..||-.|...+.
T Consensus       229 ~~mC~~C~~--tlfn~hw~C~~C~~~~Cl~C~r~~~  262 (889)
T KOG1356|consen  229 REMCDRCET--TLFNIHWRCPRCGFGVCLDCYRKWY  262 (889)
T ss_pred             chhhhhhcc--cccceeEEccccCCeeeecchhhcc
Confidence            357999998  3444445599999999999998875


No 185
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=25.30  E-value=38  Score=17.17  Aligned_cols=9  Identities=33%  Similarity=0.929  Sum_probs=3.9

Q ss_pred             ccccccCce
Q psy1895          94 HHCRNCGEI  102 (140)
Q Consensus        94 hhCr~CG~i  102 (140)
                      +.|..||+.
T Consensus        15 ~~C~~C~k~   23 (26)
T PF13465_consen   15 YKCPYCGKS   23 (26)
T ss_dssp             EEESSSSEE
T ss_pred             CCCCCCcCe
Confidence            344444443


No 186
>PRK14873 primosome assembly protein PriA; Provisional
Probab=25.14  E-value=40  Score=30.82  Aligned_cols=32  Identities=28%  Similarity=0.798  Sum_probs=17.7

Q ss_pred             ccccccccccccc--ccccccccCce----EeCCCCCC
Q psy1895          79 TCRACDKEFTVTR--RRHHCRNCGEI----FCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~~~--rkhhCr~CG~i----~C~~Cs~~  110 (140)
                      .|..|..+.++-.  ..-.|+.||..    .|..|.+.
T Consensus       394 ~C~~C~~~L~~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~  431 (665)
T PRK14873        394 RCRHCTGPLGLPSAGGTPRCRWCGRAAPDWRCPRCGSD  431 (665)
T ss_pred             ECCCCCCceeEecCCCeeECCCCcCCCcCccCCCCcCC
Confidence            4556666665432  23457777753    45555554


No 187
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=25.10  E-value=34  Score=25.07  Aligned_cols=24  Identities=25%  Similarity=0.639  Sum_probs=16.9

Q ss_pred             ccccccccccccccc-----cccccccCc
Q psy1895          78 ITCRACDKEFTVTRR-----RHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r-----khhCr~CG~  101 (140)
                      -.|..|+.+-+.+.+     -.+|..||.
T Consensus       103 VlC~~C~spdT~l~k~~r~~~l~C~ACGa  131 (138)
T PRK03988        103 VICPECGSPDTKLIKEGRIWVLKCEACGA  131 (138)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCC
Confidence            369999999886655     234666665


No 188
>KOG1813|consensus
Probab=25.10  E-value=38  Score=28.17  Aligned_cols=28  Identities=32%  Similarity=0.825  Sum_probs=21.0

Q ss_pred             cccccccccccccccccccccCceEeCCCCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~  110 (140)
                      .|.+|.+.|--=    -=-.||+.||..|...
T Consensus       243 ~c~icr~~f~~p----Vvt~c~h~fc~~ca~~  270 (313)
T KOG1813|consen  243 KCFICRKYFYRP----VVTKCGHYFCEVCALK  270 (313)
T ss_pred             cccccccccccc----hhhcCCceeehhhhcc
Confidence            499999987521    1247999999999865


No 189
>KOG3183|consensus
Probab=24.93  E-value=26  Score=28.18  Aligned_cols=51  Identities=22%  Similarity=0.538  Sum_probs=29.2

Q ss_pred             cccc--ccccccccccccccccccCceEeCCCCCCeeeC-CCC---CCCcccCcccHHHh
Q psy1895          78 ITCR--ACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMAL-PSA---AKPVRVCDECNVKL  131 (140)
Q Consensus        78 ~~C~--~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~l-p~~---~~~~RVC~~C~~~l  131 (140)
                      .+|.  .|..- .|+  -.+|-.|+.+||...-++...- |..   ...+.+|..|...+
T Consensus         9 kHCs~~~Ckql-DFL--Pf~Cd~C~~~FC~eHrsye~H~Cp~~~~~~~~v~icp~cs~pv   65 (250)
T KOG3183|consen    9 KHCSVPYCKQL-DFL--PFKCDGCSGIFCLEHRSYESHHCPKGLRIDVQVPICPLCSKPV   65 (250)
T ss_pred             cccCcchhhhc-ccc--ceeeCCccchhhhccchHhhcCCCcccccceeecccCCCCCCC
Confidence            4565  56552 222  2478888888887766553221 211   56677787776543


No 190
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=24.91  E-value=37  Score=24.84  Aligned_cols=26  Identities=19%  Similarity=0.585  Sum_probs=19.9

Q ss_pred             cccccccccccccc-ccccccccCceE
Q psy1895          78 ITCRACDKEFTVTR-RRHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~~-rkhhCr~CG~i~  103 (140)
                      ..|..|+++..... ....|..|+..+
T Consensus        35 ~aC~~C~kkv~~~~~~~~~C~~C~~~~   61 (166)
T cd04476          35 PACPGCNKKVVEEGNGTYRCEKCNKSV   61 (166)
T ss_pred             ccccccCcccEeCCCCcEECCCCCCcC
Confidence            47999999876554 678888888764


No 191
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=24.78  E-value=44  Score=20.42  Aligned_cols=24  Identities=29%  Similarity=0.693  Sum_probs=10.3

Q ss_pred             cccccccc-ccc-cccccccccccCc
Q psy1895          78 ITCRACDK-EFT-VTRRRHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~-~F~-~~~rkhhCr~CG~  101 (140)
                      ..|+.|+. .|= .-..|.+|-.||.
T Consensus        20 ~~CPrCG~gvfmA~H~dR~~CGkCgy   45 (51)
T COG1998          20 RFCPRCGPGVFMADHKDRWACGKCGY   45 (51)
T ss_pred             ccCCCCCCcchhhhcCceeEeccccc
Confidence            34666653 221 1223444555543


No 192
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=24.75  E-value=34  Score=24.98  Aligned_cols=24  Identities=25%  Similarity=0.653  Sum_probs=15.0

Q ss_pred             ccccccccccccc--cccccccccCc
Q psy1895          78 ITCRACDKEFTVT--RRRHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~--~rkhhCr~CG~  101 (140)
                      +.|..|++.|---  .=...|..||.
T Consensus         2 H~Ct~Cg~~f~dgs~eil~GCP~CGg   27 (131)
T PF09845_consen    2 HQCTKCGRVFEDGSKEILSGCPECGG   27 (131)
T ss_pred             cccCcCCCCcCCCcHHHHccCcccCC
Confidence            4688888887622  22345777774


No 193
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=24.68  E-value=34  Score=24.05  Aligned_cols=24  Identities=25%  Similarity=0.610  Sum_probs=17.3

Q ss_pred             ccccccccccccccc-----cccccccCc
Q psy1895          78 ITCRACDKEFTVTRR-----RHHCRNCGE  101 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r-----khhCr~CG~  101 (140)
                      -.|..|+.+-+.+.+     -.+|..||.
T Consensus        81 VlC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       81 VLCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             EECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            379999999886665     344777774


No 194
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=24.50  E-value=42  Score=18.16  Aligned_cols=10  Identities=40%  Similarity=0.956  Sum_probs=8.0

Q ss_pred             ccccccCceE
Q psy1895          94 HHCRNCGEIF  103 (140)
Q Consensus        94 hhCr~CG~i~  103 (140)
                      +.|..||.++
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            5688999886


No 195
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=24.44  E-value=32  Score=20.48  Aligned_cols=27  Identities=33%  Similarity=0.946  Sum_probs=16.8

Q ss_pred             ccccccc-ccccccccccccccCce-EeCCC
Q psy1895          79 TCRACDK-EFTVTRRRHHCRNCGEI-FCNMC  107 (140)
Q Consensus        79 ~C~~C~~-~F~~~~rkhhCr~CG~i-~C~~C  107 (140)
                      .|..|.+ ++.  ..|.+|-.|... +|..|
T Consensus         2 ~C~~C~~~~i~--g~R~~C~~C~dydLC~~C   30 (49)
T cd02345           2 SCSACRKQDIS--GIRFPCQVCRDYSLCLGC   30 (49)
T ss_pred             cCCCCCCCCce--EeeEECCCCCCcCchHHH
Confidence            4778887 555  456778777543 44444


No 196
>PRK06260 threonine synthase; Validated
Probab=24.41  E-value=48  Score=27.95  Aligned_cols=24  Identities=29%  Similarity=0.772  Sum_probs=18.8

Q ss_pred             cccccccccccccccccccccCce
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI  102 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i  102 (140)
                      .|..|++.|..-...+.|..||..
T Consensus         5 ~C~~cg~~~~~~~~~~~Cp~cg~~   28 (397)
T PRK06260          5 KCIECGKEYDPDEIIYTCPECGGL   28 (397)
T ss_pred             EECCCCCCCCCCCccccCCCCCCe
Confidence            688999999866566779888764


No 197
>PRK05978 hypothetical protein; Provisional
Probab=24.40  E-value=42  Score=24.95  Aligned_cols=26  Identities=38%  Similarity=0.866  Sum_probs=18.7

Q ss_pred             ccccccccc--cc-cccccccccccCceE
Q psy1895          78 ITCRACDKE--FT-VTRRRHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~--F~-~~~rkhhCr~CG~i~  103 (140)
                      ..|+.|++.  |. +++=+.+|..||.-|
T Consensus        34 grCP~CG~G~LF~g~Lkv~~~C~~CG~~~   62 (148)
T PRK05978         34 GRCPACGEGKLFRAFLKPVDHCAACGEDF   62 (148)
T ss_pred             CcCCCCCCCcccccccccCCCccccCCcc
Confidence            468999873  44 455577799998865


No 198
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=24.32  E-value=60  Score=29.67  Aligned_cols=45  Identities=22%  Similarity=0.654  Sum_probs=30.0

Q ss_pred             cccccccccccccccccccccCce----EeCCCCCCeeeCCCCCCCcccCcccHHHh
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI----FCNMCSDNKMALPSAAKPVRVCDECNVKL  131 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i----~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l  131 (140)
                      .|+.|+..-.  ..-..|..||..    +|..|...   +   ....+.|..|-..+
T Consensus         3 ~Cp~Cg~~n~--~~akFC~~CG~~l~~~~Cp~CG~~---~---~~~~~fC~~CG~~~   51 (645)
T PRK14559          3 ICPQCQFENP--NNNRFCQKCGTSLTHKPCPQCGTE---V---PVDEAHCPNCGAET   51 (645)
T ss_pred             cCCCCCCcCC--CCCccccccCCCCCCCcCCCCCCC---C---CcccccccccCCcc
Confidence            6888888633  333468888876    47777654   2   24567899886554


No 199
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=24.23  E-value=44  Score=32.98  Aligned_cols=28  Identities=43%  Similarity=1.108  Sum_probs=0.0

Q ss_pred             cccccccC----ceEeCCCCCCeeeCCCCCCCcccCccc
Q psy1895          93 RHHCRNCG----EIFCNMCSDNKMALPSAAKPVRVCDEC  127 (140)
Q Consensus        93 khhCr~CG----~i~C~~Cs~~~~~lp~~~~~~RVC~~C  127 (140)
                      +..|..||    ..||..|...       ..++.+|..|
T Consensus       667 ~rkCPkCG~~t~~~fCP~CGs~-------te~vy~CPsC  698 (1337)
T PRK14714        667 RRRCPSCGTETYENRCPDCGTH-------TEPVYVCPDC  698 (1337)
T ss_pred             EEECCCCCCccccccCcccCCc-------CCCceeCccC


No 200
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=24.16  E-value=63  Score=20.51  Aligned_cols=32  Identities=28%  Similarity=0.732  Sum_probs=21.8

Q ss_pred             Ccccccccccccccc--ccccccccCceEeCCCC
Q psy1895          77 AITCRACDKEFTVTR--RRHHCRNCGEIFCNMCS  108 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~--rkhhCr~CG~i~C~~Cs  108 (140)
                      ...|..|+.......  -++-|.+||.+.=.+|.
T Consensus         9 ~~~CtSCg~~i~p~e~~v~F~CPnCGe~~I~Rc~   42 (61)
T COG2888           9 PPVCTSCGREIAPGETAVKFPCPNCGEVEIYRCA   42 (61)
T ss_pred             CceeccCCCEeccCCceeEeeCCCCCceeeehhh
Confidence            467999999875433  35669999976544443


No 201
>PF01190 Pollen_Ole_e_I:  Pollen proteins Ole e I like;  InterPro: IPR006041 Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation.  The allergens in this family include allergens with the following designations: Ole e 1. A number of plant pollen proteins, whose biological function is not yet known, are structurally related []. These proteins are most probably secreted and consist of about 145 residues. There are six cysteines which are conserved in the sequence of these proteins. They seem to be involved in disulphide bonds. 
Probab=24.07  E-value=48  Score=22.08  Aligned_cols=10  Identities=40%  Similarity=1.258  Sum_probs=8.9

Q ss_pred             CceEeCCCCC
Q psy1895         100 GEIFCNMCSD  109 (140)
Q Consensus       100 G~i~C~~Cs~  109 (140)
                      |.|+|..|..
T Consensus         3 G~V~C~~C~~   12 (97)
T PF01190_consen    3 GVVYCDDCSS   12 (97)
T ss_pred             EEEEeCCCCC
Confidence            7899999988


No 202
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=24.05  E-value=41  Score=24.10  Aligned_cols=26  Identities=15%  Similarity=0.088  Sum_probs=19.1

Q ss_pred             cccccccccccccccc-ccccccCceE
Q psy1895          78 ITCRACDKEFTVTRRR-HHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rk-hhCr~CG~i~  103 (140)
                      ..|+.|+++|--++|. ..|..||+.|
T Consensus        10 ridPetg~KFYDLNrdPiVsPytG~s~   36 (129)
T COG4530          10 RIDPETGKKFYDLNRDPIVSPYTGKSY   36 (129)
T ss_pred             ccCccccchhhccCCCccccCcccccc
Confidence            4689999999866664 4477777765


No 203
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=23.97  E-value=27  Score=20.97  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=6.0

Q ss_pred             ccccccccccc
Q psy1895          79 TCRACDKEFTV   89 (140)
Q Consensus        79 ~C~~C~~~F~~   89 (140)
                      .|+.|+++|+-
T Consensus        22 ~CPlC~r~l~~   32 (54)
T PF04423_consen   22 CCPLCGRPLDE   32 (54)
T ss_dssp             E-TTT--EE-H
T ss_pred             cCCCCCCCCCH
Confidence            79999999973


No 204
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=23.96  E-value=36  Score=20.38  Aligned_cols=30  Identities=7%  Similarity=0.062  Sum_probs=19.9

Q ss_pred             cccccccccccccccccccccCceEeCCCCCCee
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      .|.+|...|.-    -....||++||..|....+
T Consensus         3 ~Cpi~~~~~~~----Pv~~~~G~v~~~~~i~~~~   32 (63)
T smart00504        3 LCPISLEVMKD----PVILPSGQTYERRAIEKWL   32 (63)
T ss_pred             CCcCCCCcCCC----CEECCCCCEEeHHHHHHHH
Confidence            46777776542    2345789999988876543


No 205
>KOG1315|consensus
Probab=23.91  E-value=39  Score=28.07  Aligned_cols=10  Identities=30%  Similarity=0.909  Sum_probs=4.6

Q ss_pred             CcccCcccHH
Q psy1895         120 PVRVCDECNV  129 (140)
Q Consensus       120 ~~RVC~~C~~  129 (140)
                      -.+||..|+-
T Consensus       125 HCsvC~rCvL  134 (307)
T KOG1315|consen  125 HCSVCNRCVL  134 (307)
T ss_pred             cchhhhhhhh
Confidence            3445555543


No 206
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=23.85  E-value=39  Score=16.99  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=3.8

Q ss_pred             ccccccccc
Q psy1895          80 CRACDKEFT   88 (140)
Q Consensus        80 C~~C~~~F~   88 (140)
                      |..|+++..
T Consensus         2 Cp~CG~~~~   10 (23)
T PF13240_consen    2 CPNCGAEIE   10 (23)
T ss_pred             CcccCCCCC
Confidence            344444433


No 207
>PRK03954 ribonuclease P protein component 4; Validated
Probab=23.48  E-value=2.3e+02  Score=20.26  Aligned_cols=10  Identities=20%  Similarity=0.647  Sum_probs=7.5

Q ss_pred             cccccccccc
Q psy1895          78 ITCRACDKEF   87 (140)
Q Consensus        78 ~~C~~C~~~F   87 (140)
                      ..|..|...+
T Consensus        65 ~~CK~C~t~L   74 (121)
T PRK03954         65 RYCKRCHSFL   74 (121)
T ss_pred             HHhhcCCCee
Confidence            4788888765


No 208
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=23.39  E-value=31  Score=24.33  Aligned_cols=11  Identities=55%  Similarity=1.503  Sum_probs=9.6

Q ss_pred             cccccccCceE
Q psy1895          93 RHHCRNCGEIF  103 (140)
Q Consensus        93 khhCr~CG~i~  103 (140)
                      -|.|-+||.+|
T Consensus         2 pH~CtrCG~vf   12 (112)
T COG3364           2 PHQCTRCGEVF   12 (112)
T ss_pred             Cceeccccccc
Confidence            37899999998


No 209
>PRK07591 threonine synthase; Validated
Probab=23.34  E-value=50  Score=28.18  Aligned_cols=25  Identities=28%  Similarity=0.776  Sum_probs=19.5

Q ss_pred             ccccccccccccccccccccccCceE
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~  103 (140)
                      -.|..|++.|..-.. ..|..||..+
T Consensus        19 l~C~~Cg~~~~~~~~-~~C~~cg~~l   43 (421)
T PRK07591         19 LKCRECGAEYPLGPI-HVCEECFGPL   43 (421)
T ss_pred             EEeCCCCCcCCCCCC-ccCCCCCCeE
Confidence            479999999986544 7898888654


No 210
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=23.30  E-value=55  Score=20.27  Aligned_cols=8  Identities=63%  Similarity=1.506  Sum_probs=3.5

Q ss_pred             CcccCccc
Q psy1895         120 PVRVCDEC  127 (140)
Q Consensus       120 ~~RVC~~C  127 (140)
                      +.+||..|
T Consensus        39 ~H~vC~~C   46 (57)
T PRK12286         39 PHRVCPSC   46 (57)
T ss_pred             CeEECCCC
Confidence            34444444


No 211
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=23.07  E-value=84  Score=19.83  Aligned_cols=27  Identities=30%  Similarity=0.768  Sum_probs=19.8

Q ss_pred             Ccccccccccccccc--ccccccccCceE
Q psy1895          77 AITCRACDKEFTVTR--RRHHCRNCGEIF  103 (140)
Q Consensus        77 ~~~C~~C~~~F~~~~--rkhhCr~CG~i~  103 (140)
                      ...|..|+.......  -+..|.+||.+.
T Consensus         7 ~~~CtSCg~~i~~~~~~~~F~CPnCG~~~   35 (59)
T PRK14890          7 PPKCTSCGIEIAPREKAVKFLCPNCGEVI   35 (59)
T ss_pred             CccccCCCCcccCCCccCEeeCCCCCCee
Confidence            347999998776444  367799999873


No 212
>PF01147 Crust_neurohorm:  Crustacean CHH/MIH/GIH neurohormone family;  InterPro: IPR001166 Arthropod express a family of neuropeptides [] which so far consist of the following types of neurohormones:  Crustacean hyperglycemic hormone (CHH). CHH is primarily involved in blood sugar regulation, but also plays a role in the control of molting and reproduction. Molt-inhibiting hormone (MIH). MIH inhibits Y-organs where molting hormone (ecdysteroid) is secreted. A molting cycle is initiated when MIH secretion diminishes or stops. Gonad-inhibiting hormone (GIH), also known as vitellogenesis-inhibiting hormone (VIH) because of its role in inhibiting vitellogenesis in female animals. Mandibular organ-inhibiting hormone (MOIH). MOIH represses the synthesis of methyl farnesoate, the precursor of insect juvenile hormone III in the mandibular organ. Ion transport peptide (ITP) from locust. ITP stimulates salt and water reabsorption and inhibits acid secretion in the ileum of the locust.  Caenorhabditis elegans hypothetical protein ZC168.2.  These neurohormones are peptides of 70 to 80 residues which are processed from larger size precursors. They contain six conserved cysteines that are involved in disulphide bonds, as shown in the following schematic representation. ; GO: 0005184 neuropeptide hormone activity, 0005576 extracellular region; PDB: 1J0T_A.
Probab=23.05  E-value=22  Score=23.32  Aligned_cols=16  Identities=44%  Similarity=0.708  Sum_probs=12.0

Q ss_pred             CCCcccCcccHHHhhc
Q psy1895         118 AKPVRVCDECNVKLVE  133 (140)
Q Consensus       118 ~~~~RVC~~C~~~l~~  133 (140)
                      .+-.|||+.||...-.
T Consensus        17 ~kldrVC~DCyNl~R~   32 (73)
T PF01147_consen   17 KKLDRVCDDCYNLFRE   32 (73)
T ss_dssp             HHHHHHHHHHHHHHT-
T ss_pred             HHHHHHHHHHHHHHcC
Confidence            4557999999998643


No 213
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=22.95  E-value=32  Score=15.98  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=6.2

Q ss_pred             ccccccccccc
Q psy1895          79 TCRACDKEFTV   89 (140)
Q Consensus        79 ~C~~C~~~F~~   89 (140)
                      .|..|+..|..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            47788887763


No 214
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=22.74  E-value=57  Score=23.50  Aligned_cols=10  Identities=20%  Similarity=0.963  Sum_probs=5.8

Q ss_pred             cccccccccc
Q psy1895          79 TCRACDKEFT   88 (140)
Q Consensus        79 ~C~~C~~~F~   88 (140)
                      .|..|+..+.
T Consensus       114 ~C~~C~~~~~  123 (146)
T smart00731      114 RCTGCGQRYL  123 (146)
T ss_pred             ECCCCCCCCc
Confidence            4666666554


No 215
>PRK04351 hypothetical protein; Provisional
Probab=22.71  E-value=51  Score=24.34  Aligned_cols=13  Identities=31%  Similarity=0.570  Sum_probs=7.1

Q ss_pred             CCcccCcccHHHh
Q psy1895         119 KPVRVCDECNVKL  131 (140)
Q Consensus       119 ~~~RVC~~C~~~l  131 (140)
                      ...-+|..|...|
T Consensus       130 ~~~yrCg~C~g~L  142 (149)
T PRK04351        130 TKRYRCGKCRGKL  142 (149)
T ss_pred             CCcEEeCCCCcEe
Confidence            3445666665554


No 216
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=22.50  E-value=36  Score=20.11  Aligned_cols=28  Identities=21%  Similarity=0.685  Sum_probs=16.0

Q ss_pred             cccccccccccccccccccccCce-EeCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEI-FCNMC  107 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i-~C~~C  107 (140)
                      .|-.|+. +.+.-.|++|..|... +|..|
T Consensus         2 ~CDgCg~-~PI~G~RykC~~C~dyDLC~~C   30 (43)
T cd02342           2 QCDGCGV-LPITGPRYKSKVKEDYDLCTIC   30 (43)
T ss_pred             CCCCCCC-CcccccceEeCCCCCCccHHHH
Confidence            3666665 3455667777766443 44444


No 217
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.49  E-value=44  Score=23.78  Aligned_cols=11  Identities=45%  Similarity=0.809  Sum_probs=8.4

Q ss_pred             cccccccccccc
Q psy1895          78 ITCRACDKEFTV   89 (140)
Q Consensus        78 ~~C~~C~~~F~~   89 (140)
                      -.| .|+..|.+
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            468 89988765


No 218
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=22.46  E-value=55  Score=20.54  Aligned_cols=14  Identities=21%  Similarity=0.669  Sum_probs=6.5

Q ss_pred             ccccccccccCceE
Q psy1895          90 TRRRHHCRNCGEIF  103 (140)
Q Consensus        90 ~~rkhhCr~CG~i~  103 (140)
                      ....-.|..||+.|
T Consensus        50 ~eg~L~Cp~c~r~Y   63 (68)
T PF03966_consen   50 VEGELICPECGREY   63 (68)
T ss_dssp             TTTEEEETTTTEEE
T ss_pred             cCCEEEcCCCCCEE
Confidence            33344455555544


No 219
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=22.40  E-value=41  Score=19.07  Aligned_cols=11  Identities=36%  Similarity=0.951  Sum_probs=6.1

Q ss_pred             cccccccCceE
Q psy1895          93 RHHCRNCGEIF  103 (140)
Q Consensus        93 khhCr~CG~i~  103 (140)
                      -+.|..||.|+
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            46799999886


No 220
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=22.34  E-value=42  Score=21.40  Aligned_cols=7  Identities=57%  Similarity=1.559  Sum_probs=3.5

Q ss_pred             ccccCce
Q psy1895          96 CRNCGEI  102 (140)
Q Consensus        96 Cr~CG~i  102 (140)
                      ||.||..
T Consensus        20 CrRCG~~   26 (62)
T PRK04179         20 CRRCGRH   26 (62)
T ss_pred             hcccCcc
Confidence            5555543


No 221
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=21.99  E-value=55  Score=18.96  Aligned_cols=22  Identities=32%  Similarity=0.951  Sum_probs=12.6

Q ss_pred             cccccccccccccccccccccCceEeCCC
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIFCNMC  107 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~C~~C  107 (140)
                      .|..|+.+.  ++-+     =|.+||..|
T Consensus        19 ~Cp~C~~PL--~~~k-----~g~~~Cv~C   40 (41)
T PF06677_consen   19 HCPDCGTPL--MRDK-----DGKIYCVSC   40 (41)
T ss_pred             ccCCCCCee--EEec-----CCCEECCCC
Confidence            688896543  2211     256677666


No 222
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=21.83  E-value=61  Score=21.15  Aligned_cols=14  Identities=43%  Similarity=1.087  Sum_probs=8.7

Q ss_pred             cccccccc--ccCceE
Q psy1895          90 TRRRHHCR--NCGEIF  103 (140)
Q Consensus        90 ~~rkhhCr--~CG~i~  103 (140)
                      ..+.+.|.  .||..|
T Consensus        24 ~~~Y~qC~N~eCg~tF   39 (72)
T PRK09678         24 KERYHQCQNVNCSATF   39 (72)
T ss_pred             heeeeecCCCCCCCEE
Confidence            34455577  777766


No 223
>KOG4323|consensus
Probab=21.82  E-value=46  Score=29.26  Aligned_cols=53  Identities=21%  Similarity=0.475  Sum_probs=32.0

Q ss_pred             cccccccc-ccccccccccccccCceEeCCCCCCee--eCCCCCCCcccCcccHHH
Q psy1895          78 ITCRACDK-EFTVTRRRHHCRNCGEIFCNMCSDNKM--ALPSAAKPVRVCDECNVK  130 (140)
Q Consensus        78 ~~C~~C~~-~F~~~~rkhhCr~CG~i~C~~Cs~~~~--~lp~~~~~~RVC~~C~~~  130 (140)
                      .+|..|+. .++.++|...|+.|+.-|=..|..-.+  .+-....-+-.|+.|...
T Consensus       169 ~qc~vC~~g~~~~~NrmlqC~~C~~~fHq~Chqp~i~~~l~~D~~~~w~C~~C~~~  224 (464)
T KOG4323|consen  169 LQCSVCYCGGPGAGNRMLQCDKCRQWYHQACHQPLIKDELAGDPFYEWFCDVCNRG  224 (464)
T ss_pred             ceeeeeecCCcCccceeeeecccccHHHHHhccCCCCHhhccCccceEeehhhccc
Confidence            35888884 677888999999999875444432211  111113445667777543


No 224
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=21.74  E-value=62  Score=20.07  Aligned_cols=27  Identities=22%  Similarity=0.674  Sum_probs=13.6

Q ss_pred             cccccccc---cccccccccccccCceEeC
Q psy1895          79 TCRACDKE---FTVTRRRHHCRNCGEIFCN  105 (140)
Q Consensus        79 ~C~~C~~~---F~~~~rkhhCr~CG~i~C~  105 (140)
                      .|..|...   |+--.....|..||.++|.
T Consensus         9 kCp~C~~~q~vFSha~t~V~C~~Cg~~L~~   38 (55)
T PF01667_consen    9 KCPGCYNIQTVFSHAQTVVKCVVCGTVLAQ   38 (55)
T ss_dssp             E-TTT-SEEEEETT-SS-EE-SSSTSEEEE
T ss_pred             ECCCCCCeeEEEecCCeEEEcccCCCEecC
Confidence            46777664   5544455567777777663


No 225
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=21.66  E-value=32  Score=17.15  Aligned_cols=11  Identities=36%  Similarity=1.008  Sum_probs=8.8

Q ss_pred             ccccccccccc
Q psy1895          79 TCRACDKEFTV   89 (140)
Q Consensus        79 ~C~~C~~~F~~   89 (140)
                      .|..|++.|..
T Consensus         3 ~C~~C~~~F~~   13 (27)
T PF13912_consen    3 ECDECGKTFSS   13 (27)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCccCCccCC
Confidence            58889998873


No 226
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=21.57  E-value=47  Score=22.46  Aligned_cols=13  Identities=23%  Similarity=0.618  Sum_probs=10.8

Q ss_pred             ccccCceEeCCCC
Q psy1895          96 CRNCGEIFCNMCS  108 (140)
Q Consensus        96 Cr~CG~i~C~~Cs  108 (140)
                      |+.||++++-.+.
T Consensus        76 C~~Cg~i~~~~~~   88 (116)
T cd07153          76 CTKCGKVIDFEDC   88 (116)
T ss_pred             eCCCCCEEEecCc
Confidence            9999999986654


No 227
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=21.36  E-value=47  Score=26.79  Aligned_cols=55  Identities=33%  Similarity=0.684  Sum_probs=27.2

Q ss_pred             Ccccccccccc--ccc-------cccccccccCc------eEeCCCCCCee-eCC-----CC-CCCcccCcccHHHh
Q psy1895          77 AITCRACDKEF--TVT-------RRRHHCRNCGE------IFCNMCSDNKM-ALP-----SA-AKPVRVCDECNVKL  131 (140)
Q Consensus        77 ~~~C~~C~~~F--~~~-------~rkhhCr~CG~------i~C~~Cs~~~~-~lp-----~~-~~~~RVC~~C~~~l  131 (140)
                      ...|++|+..=  +.+       .|..||..||.      +-|..|.+... .+.     .. ...+-||+.|..-+
T Consensus       172 ~g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R~~Cp~Cg~~~~~~l~~~~~e~~~~~rve~C~~C~~Yl  248 (290)
T PF04216_consen  172 RGYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVRIKCPYCGNTDHEKLEYFTVEGEPAYRVEVCESCGSYL  248 (290)
T ss_dssp             -SS-TTT---EEEEEEE------EEEEEETTT--EEE--TTS-TTT---SS-EEE--------SEEEEEETTTTEEE
T ss_pred             CCcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecCCCCcCCCCCCCcceeeEecCCCCcEEEEECCcccchH
Confidence            35899999952  222       36678999985      47888876421 111     11 45678999997654


No 228
>PF07776 zf-AD:  Zinc-finger associated domain (zf-AD)  ;  InterPro: IPR012934 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The zf-AD domain, also known as ZAD, forms an atypical treble-cleft-like zinc co-ordinating fold. The zf-AD domain is thought to be involved in mediating dimer formation, but does not bind to DNA [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005634 nucleus; PDB: 1PZW_A.
Probab=20.98  E-value=30  Score=20.86  Aligned_cols=16  Identities=31%  Similarity=0.706  Sum_probs=12.6

Q ss_pred             CCCcccCcccHHHhhc
Q psy1895         118 AKPVRVCDECNVKLVE  133 (140)
Q Consensus       118 ~~~~RVC~~C~~~l~~  133 (140)
                      ..|..||..|+..|..
T Consensus        42 ~lp~~IC~~C~~~l~~   57 (75)
T PF07776_consen   42 DLPQQICSSCWEKLQQ   57 (75)
T ss_dssp             SS-SEEEHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHH
Confidence            5677899999998864


No 229
>KOG2932|consensus
Probab=20.95  E-value=45  Score=28.13  Aligned_cols=46  Identities=22%  Similarity=0.629  Sum_probs=34.0

Q ss_pred             CCccccccccccccccccccccccCceEeCCCCCCeeeCCCCCCCcccCcccHHHhh
Q psy1895          76 EAITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKMALPSAAKPVRVCDECNVKLV  132 (140)
Q Consensus        76 ~~~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~~lp~~~~~~RVC~~C~~~l~  132 (140)
                      .+..|..|..+.-++-|..-   |.+|||-.|...        .+.+.|..|-+.++
T Consensus        89 ~VHfCd~Cd~PI~IYGRmIP---CkHvFCl~CAr~--------~~dK~Cp~C~d~Vq  134 (389)
T KOG2932|consen   89 RVHFCDRCDFPIAIYGRMIP---CKHVFCLECARS--------DSDKICPLCDDRVQ  134 (389)
T ss_pred             ceEeecccCCcceeeecccc---cchhhhhhhhhc--------CccccCcCcccHHH
Confidence            36789999999888888764   567999999764        24567777766553


No 230
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=20.90  E-value=40  Score=22.39  Aligned_cols=30  Identities=27%  Similarity=0.656  Sum_probs=16.0

Q ss_pred             ccccccccccccccc---cccccccCce---EeCCC
Q psy1895          78 ITCRACDKEFTVTRR---RHHCRNCGEI---FCNMC  107 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r---khhCr~CG~i---~C~~C  107 (140)
                      ..|.+|+.++....+   .-||..+|.|   .|..|
T Consensus        23 ~~C~iC~~~~~~~~~~~~vDHdH~tG~vRGlLC~~C   58 (81)
T PF02945_consen   23 GRCAICGKPLPGESRKLVVDHDHKTGRVRGLLCRSC   58 (81)
T ss_dssp             TE-TTT-SEEETTCGGCEEEE-TTTTBEEEEEEHHH
T ss_pred             CcCcCCCCCcccCCCcceecCCCCCCCchhhhhhHH
Confidence            379999995543233   3468888775   44444


No 231
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=20.75  E-value=41  Score=19.85  Aligned_cols=10  Identities=20%  Similarity=0.707  Sum_probs=6.0

Q ss_pred             cccCcccHHH
Q psy1895         121 VRVCDECNVK  130 (140)
Q Consensus       121 ~RVC~~C~~~  130 (140)
                      .-+|..||..
T Consensus        23 ~dLC~~CF~~   32 (45)
T cd02336          23 YDLCPSCYQE   32 (45)
T ss_pred             cccChHHHhC
Confidence            4566666653


No 232
>PRK10061 DNA damage-inducible protein YebG; Provisional
Probab=20.70  E-value=95  Score=21.50  Aligned_cols=43  Identities=19%  Similarity=0.135  Sum_probs=32.8

Q ss_pred             hhhHHHhhhhhhhcchhhhhHHHHHHHHHHHHHhhhhhhHHHH
Q psy1895          11 DDHVKMNKIAEHVKDNVSDDKYKESELALEELGAQLSKSKLQV   53 (140)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~r~~~~~~~~~l~~~~~~l~~s~~~~   53 (140)
                      |..-||..+++++.+.+.......-++..++++.-|...+..+
T Consensus        26 DAyDKMLD~Ad~L~~~L~~s~~~ldE~q~E~L~l~LA~nKd~l   68 (96)
T PRK10061         26 DAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLWLAEQKDVL   68 (96)
T ss_pred             HHHHHHHHHHHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHH
Confidence            5566899999999999988877666777788877776655544


No 233
>PRK02935 hypothetical protein; Provisional
Probab=20.33  E-value=48  Score=23.45  Aligned_cols=25  Identities=24%  Similarity=0.687  Sum_probs=21.1

Q ss_pred             cccccccccccccccccccccCceE
Q psy1895          79 TCRACDKEFTVTRRRHHCRNCGEIF  103 (140)
Q Consensus        79 ~C~~C~~~F~~~~rkhhCr~CG~i~  103 (140)
                      .|+.|++.=..+.|-.-|-+|++..
T Consensus        72 ~CP~C~K~TKmLGrvD~CM~C~~PL   96 (110)
T PRK02935         72 ICPSCEKPTKMLGRVDACMHCNQPL   96 (110)
T ss_pred             ECCCCCchhhhccceeecCcCCCcC
Confidence            7999999888888888888888753


No 234
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=20.24  E-value=54  Score=19.77  Aligned_cols=12  Identities=42%  Similarity=0.988  Sum_probs=9.6

Q ss_pred             cccccccCceEe
Q psy1895          93 RHHCRNCGEIFC  104 (140)
Q Consensus        93 khhCr~CG~i~C  104 (140)
                      ++.|..||.|+=
T Consensus         1 ~y~C~~CgyiYd   12 (50)
T cd00730           1 KYECRICGYIYD   12 (50)
T ss_pred             CcCCCCCCeEEC
Confidence            467999999883


No 235
>PRK08197 threonine synthase; Validated
Probab=20.22  E-value=61  Score=27.28  Aligned_cols=24  Identities=21%  Similarity=0.832  Sum_probs=18.4

Q ss_pred             ccccccccccccccccccccccCce
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEI  102 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i  102 (140)
                      -.|..|++.|..-.....| .||..
T Consensus         8 ~~C~~Cg~~~~~~~~~~~C-~cg~~   31 (394)
T PRK08197          8 LECSKCGETYDADQVHNLC-KCGKP   31 (394)
T ss_pred             EEECCCCCCCCCCCcceec-CCCCe
Confidence            3699999999876666678 78754


No 236
>PHA02942 putative transposase; Provisional
Probab=20.22  E-value=82  Score=26.74  Aligned_cols=28  Identities=25%  Similarity=0.777  Sum_probs=18.4

Q ss_pred             CCccccccccccc-cccccccccccCceE
Q psy1895          76 EAITCRACDKEFT-VTRRRHHCRNCGEIF  103 (140)
Q Consensus        76 ~~~~C~~C~~~F~-~~~rkhhCr~CG~i~  103 (140)
                      ....|+.|+..-. +-.|.+.|..||...
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            3456888886422 334667898898864


No 237
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=20.14  E-value=47  Score=25.63  Aligned_cols=26  Identities=23%  Similarity=0.498  Sum_probs=18.8

Q ss_pred             ccccccccccccccc-----cccccccCceE
Q psy1895          78 ITCRACDKEFTVTRR-----RHHCRNCGEIF  103 (140)
Q Consensus        78 ~~C~~C~~~F~~~~r-----khhCr~CG~i~  103 (140)
                      -.|..|+.+-+.+.+     -.+|..||..-
T Consensus        99 V~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~  129 (201)
T PRK12336         99 VICSECGLPDTRLVKEDRVLMLRCDACGAHR  129 (201)
T ss_pred             EECCCCCCCCcEEEEcCCeEEEEcccCCCCc
Confidence            379999999986655     23577777653


No 238
>PRK05580 primosome assembly protein PriA; Validated
Probab=20.07  E-value=67  Score=29.29  Aligned_cols=32  Identities=34%  Similarity=0.889  Sum_probs=18.9

Q ss_pred             ccccccccccc--ccccccccccCce-----EeCCCCCC
Q psy1895          79 TCRACDKEFTV--TRRRHHCRNCGEI-----FCNMCSDN  110 (140)
Q Consensus        79 ~C~~C~~~F~~--~~rkhhCr~CG~i-----~C~~Cs~~  110 (140)
                      .|..|..+++.  ..+.-.|+.||..     .|..|.+.
T Consensus       392 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~  430 (679)
T PRK05580        392 ECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGST  430 (679)
T ss_pred             CCCCCCCceeEECCCCeEECCCCcCCCCCCCCCCCCcCC
Confidence            45666665553  2344458888765     47777554


No 239
>KOG2177|consensus
Probab=20.01  E-value=22  Score=26.89  Aligned_cols=31  Identities=29%  Similarity=0.668  Sum_probs=23.9

Q ss_pred             ccccccccccccccccccccccCceEeCCCCCCee
Q psy1895          78 ITCRACDKEFTVTRRRHHCRNCGEIFCNMCSDNKM  112 (140)
Q Consensus        78 ~~C~~C~~~F~~~~rkhhCr~CG~i~C~~Cs~~~~  112 (140)
                      -.|.+|-..|..-    .--.||+.||..|.....
T Consensus        14 ~~C~iC~~~~~~p----~~l~C~H~~c~~C~~~~~   44 (386)
T KOG2177|consen   14 LTCPICLEYFREP----VLLPCGHNFCRACLTRSW   44 (386)
T ss_pred             ccChhhHHHhhcC----ccccccchHhHHHHHHhc
Confidence            4799999988754    556799999999976543


Done!