BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy1910
(153 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2KT2|A Chain A, Structure Of Nmera, The N-Terminal Hma Domain Of Tn501
Mercuric Reductase
pdb|2KT3|A Chain A, Structure Of Hg-Nmera, Hg(Ii) Complex Of The N-Terminal
Domain Of Tn501 Mercuric Reductase
Length = 69
Score = 27.3 bits (59), Expect = 3.8, Method: Compositional matrix adjust.
Identities = 15/35 (42%), Positives = 21/35 (60%), Gaps = 1/35 (2%)
Query: 7 IGSWLLFWPCGWSISMAAVPGCLPDLHTLALFGLG 41
+ S L+ +P G + +A VPG PD T A+ GLG
Sbjct: 28 VQSALVSYPKGTA-QLAIVPGTSPDALTAAVAGLG 61
>pdb|3NCY|Q Chain Q, X-Ray Crystal Structure Of An Arginine Agmatine Antiporter
(Adic) In Complex With A Fab Fragment
pdb|3NCY|P Chain P, X-Ray Crystal Structure Of An Arginine Agmatine Antiporter
(Adic) In Complex With A Fab Fragment
Length = 219
Score = 26.6 bits (57), Expect = 5.5, Method: Compositional matrix adjust.
Identities = 11/35 (31%), Positives = 19/35 (54%)
Query: 2 RLDKPIGSWLLFWPCGWSISMAAVPGCLPDLHTLA 36
RLD G W +W G S+++++ P ++ LA
Sbjct: 98 RLDGNYGGWFAYWGQGTSVTVSSAKTTPPSVYPLA 132
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.324 0.139 0.459
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,800,552
Number of Sequences: 62578
Number of extensions: 112298
Number of successful extensions: 234
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 230
Number of HSP's gapped (non-prelim): 5
length of query: 153
length of database: 14,973,337
effective HSP length: 90
effective length of query: 63
effective length of database: 9,341,317
effective search space: 588502971
effective search space used: 588502971
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 47 (22.7 bits)