Diaphorina citri psyllid: psy1915

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-

IFAYLNYLTPKTRLEIIELLIKGLKRLEYRGYDSSGNNELEGDHLARHIAIMEGAFALCFKSKLFPGECVATRRGSPLLVGIKTKTRLATDHIPILYGKATRQLLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADSLMALRYCKARGALIVGVTNTVGSSISRESHCGIHINAGPEIGVASTKAYTSQFISLVMFALVMCEDRISLQTRRNEIIKGLKVIHEQIREVLQMDSEVQQLAKEMYEQKSMLLMGRGYNYATCMEGALKIKELTYMHSEGIMAGELKHGPLALIDNSMPVIMILTRDPVYVKCMNALLQVIARDGRPIVICEKGDTETQALATKTLEVPHTVDCL

ccccccccccccHHHHHHHHHHccEEEEEcccccccccccccHHHHHHHHHHHccHHHHHHHccccccccccccccccccccEEEEEEEEEEcHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccEEEEEEccHHHHHHHHHHHHHHHccccEEEEEcccccccHHccccccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEEEcccccHHHHHHHHHHHHHcccCEEEEEEccccHHHHccccEEEcccccccc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

IFAYLNYLTPKTRLEIIELLIKGLKRLEYRGYDSSGNNELEGDHLARHIAIMEGAFALCFKSKLFPGECVATRRGSPLLVGIKTKTRLATDHIPILYGKATRQLLEELTELPVMVELASDFLDRNTPVFRDDVCFFISQSGETADSLMALRYCKARGALIVGVTNTVGSSISRESHCGIHINAGPEIGVASTKAYTSQFISLVMFALVMCEDRISLQTRRNEIIKGLKVxxxxxxxxxxxxxxxxxxxxxMYEQKSMLLMGRGYNYATCMEGALKIKELTYMHSEGIMAGELKHGPLALIDNSMPVIMILTRDPVYVKCMNALLQVIARDGRPIVICEKGDTETQALATKTLEVPHTVDCL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2	Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.	confident	Q4KMC4
Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1	Controls the flux of glucose into the hexosamine pathway. Most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins.	confident	Q06210
Glutamine--fructose-6-phosphate aminotransferase [isomerizing]	Involved in amino sugar synthesis (formation of chitin, supplies the amino sugars of asparagine-linked oligosaccharides of glycoproteins).	confident	P14742

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051289 [BP]	protein homotetramerization	probable	GO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0016597 [MF]	amino acid binding	probable	GO:0043168, GO:0003674, GO:0031406, GO:0005488, GO:0043167
GO:0006042 [BP]	glucosamine biosynthetic process	probable	GO:1901576, GO:0071704, GO:1901137, GO:0006041, GO:1901135, GO:0046349, GO:0006040, GO:0009058, GO:0008150, GO:0008152, GO:1901073, GO:1901071
GO:0006002 [BP]	fructose 6-phosphate metabolic process	probable	GO:1901135, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004360 [MF]	glutamine-fructose-6-phosphate transaminase (isomerizing) activity	probable	GO:0070548, GO:0003824, GO:0008483, GO:0016740, GO:0003674, GO:0016769
GO:0006541 [BP]	glutamine metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:1901564, GO:0006082, GO:0044237, GO:0006520, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0009064, GO:0043436, GO:1901605
GO:0007528 [BP]	neuromuscular junction development	probable	GO:0050808, GO:0030154, GO:0048468, GO:0014706, GO:0051146, GO:0061061, GO:0007275, GO:0071840, GO:0007517, GO:0048869, GO:0007519, GO:0016043, GO:0048513, GO:0044699, GO:0032502, GO:0055001, GO:0055002, GO:0032501, GO:0048741, GO:0009987, GO:0009888, GO:0048747, GO:0044767, GO:0044763, GO:0048731, GO:0044707, GO:0048856, GO:0060537, GO:0060538, GO:0008150, GO:0042692
GO:0045719 [BP]	negative regulation of glycogen biosynthetic process	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010906, GO:0048519, GO:0032885, GO:0050789, GO:0032881, GO:0043255, GO:0010605, GO:0019222, GO:0043467, GO:2000112, GO:2000113, GO:0065007, GO:0010962, GO:0045912, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0010675, GO:0010677, GO:0070873, GO:0070874, GO:0005979, GO:0010556, GO:0006109, GO:0010558, GO:0048523
GO:0006047 [BP]	UDP-N-acetylglucosamine metabolic process	probable	GO:0034641, GO:0006807, GO:0044281, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0009225, GO:0009987, GO:0006725, GO:0009117, GO:0008152, GO:0055086, GO:0046483, GO:0044238, GO:0006040, GO:1901135, GO:0044237, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:0006753
GO:0006987 [BP]	activation of signaling protein activity involved in unfolded protein response	probable	GO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0048703 [BP]	embryonic viscerocranium morphogenesis	probable	GO:0048705, GO:0048562, GO:0048568, GO:0001501, GO:0048706, GO:0009653, GO:0007275, GO:0044699, GO:0048513, GO:0043009, GO:0048598, GO:0048704, GO:0009887, GO:0032501, GO:0048701, GO:0044767, GO:0008150, GO:0044707, GO:0009790, GO:0048856, GO:0032502, GO:0009792, GO:0048731
GO:0006038 [BP]	cell wall chitin biosynthetic process	probable	GO:0046349, GO:0044036, GO:0006807, GO:0034645, GO:0070592, GO:0016051, GO:0071840, GO:0044038, GO:1901576, GO:0044264, GO:0044262, GO:0044260, GO:0071554, GO:0071704, GO:0044699, GO:0006031, GO:0006030, GO:0006023, GO:0006037, GO:0043170, GO:0009987, GO:0000271, GO:0044710, GO:0034637, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0010383, GO:0044723, GO:1901564, GO:0044238, GO:0042546, GO:0005975, GO:1901566, GO:0005976, GO:1901137, GO:1901135, GO:0044763, GO:0070589, GO:0044237, GO:0033692, GO:0006040, GO:0044085, GO:0006022, GO:1901073, GO:1901071, GO:0044249
GO:0006112 [BP]	energy reserve metabolic process	probable	GO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0008150, GO:0008152, GO:0006091, GO:0055114
GO:0030318 [BP]	melanocyte differentiation	probable	GO:0032502, GO:0043473, GO:0060429, GO:0048856, GO:0048869, GO:0050931, GO:0030154, GO:0009888, GO:0048066, GO:0044763, GO:0030855, GO:0060563, GO:0008150, GO:0009987, GO:0044699, GO:0002065
GO:0043687 [BP]	post-translational protein modification	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0009744 [BP]	response to sucrose stimulus	probable	GO:1901700, GO:0009743, GO:0034285, GO:0050896, GO:0008150, GO:0042221, GO:0010033
GO:0002063 [BP]	chondrocyte development	probable	GO:0032502, GO:0051216, GO:0044707, GO:0048869, GO:0032501, GO:0030154, GO:0048468, GO:0009888, GO:0061448, GO:0044767, GO:0001501, GO:0048513, GO:0044763, GO:0008150, GO:0002062, GO:0048731, GO:0009987, GO:0007275, GO:0044699, GO:0048856
GO:0030246 [MF]	carbohydrate binding	probable	GO:0003674, GO:0005488
GO:0035690 [BP]	cellular response to drug	probable	GO:0051716, GO:0050896, GO:0009987, GO:0042493, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0044699
GO:0032869 [BP]	cellular response to insulin stimulus	probable	GO:0070887, GO:0032868, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0044763, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:1901698
GO:0040007 [BP]	growth	probable	GO:0008150
GO:0006488 [BP]	dolichol-linked oligosaccharide biosynthetic process	probable	GO:1901576, GO:1901137, GO:1901135, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0018279 [BP]	protein N-linked glycosylation via asparagine	probable	GO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.6.-.-	Transferring nitrogenous groups.	probable
2.6.1.-	Transaminases (aminotransferases).	probable
2.6.1.16	Glutamine--fructose-6-phosphate transaminase (isomerizing).	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZJ3, chain A
Confidence level:very confident
Coverage over the Query: 73-361
View the alignment between query and template
View the model in PyMOL

Template: 2BPL, chain A
Confidence level:very confident
Coverage over the Query: 44-360
View the alignment between query and template
View the model in PyMOL

Template: 2O3F, chain A
Confidence level:probable
Coverage over the Query: 18-35
View the alignment between query and template
View the model in PyMOL