Diaphorina citri psyllid: psy1922


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MCGIALDAADGVDIAIVKKSGKVSALEDEIQTRIALDAADGVDIAIVKKSGKVSALEDEIQTRLKELNVEESSATHVLGRLFPFDDRGLVHAYWAPNFWAFYNTADKAAVVLGKRFHLISSNVTNTMTRGLVENSQHVVLPSIEPCTCFLLTLLGILAF
cccccccccccccEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHcccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccCCcCEEEEcccccHHHHHHHHHHHHHcc
***IALDAADGVDIAIVKKSGKVSALEDEIQTRIALDAADGVDIAIVKKSGKVSALEDEIQTRLKELNVEESSATHVLGRLFPFDDRGLVHAYWAPNFWAFYNTADKAAVVLGKRFHLISSNVTNTMTRGLVENSQHVVLPSIEPCTCFLLTLLGILAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGIALDAADGVDIAIVKKSGKVSALEDEIQTRIALDAADGVDIAIVKKSGKVSALEDEIQTRLKELNVEESSATHVLGRLFPFDDRGLVHAYWAPNFWAFYNTADKAAVVLGKRFHLISSNVTNTMTRGLVENSQHVVLPSIEPCTCFLLTLLGILAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase Adds the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(1)Man(9)GlcNAc(2)-PP-Dol.confidentQ6P8H8
Probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase Adds the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation. Transfers glucose from dolichyl phosphate glucose (Dol-P-Glc) onto the lipid-linked oligosaccharide Glc(1)Man(9)GlcNAc(2)-PP-Dol.confidentQ9W3V8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000033 [MF]alpha-1,3-mannosyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0000030
GO:0006487 [BP]protein N-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BPL, chain A
Confidence level:probable
Coverage over the Query: 29-97
View the alignment between query and template
View the model in PyMOL