BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy1929
         (95 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1NJ8|A Chain A, Crystal Structure Of Prolyl-Trna Synthetase From
           Methanocaldococcus Janaschii
 pdb|1NJ8|B Chain B, Crystal Structure Of Prolyl-Trna Synthetase From
           Methanocaldococcus Janaschii
 pdb|1NJ8|C Chain C, Crystal Structure Of Prolyl-Trna Synthetase From
           Methanocaldococcus Janaschii
 pdb|1NJ8|D Chain D, Crystal Structure Of Prolyl-Trna Synthetase From
           Methanocaldococcus Janaschii
          Length = 459

 Score = 26.6 bits (57), Expect = 3.6,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 23/44 (52%)

Query: 6   RHSSPLSRVGSYISVKETHQIAEAQLEKNARLRDAFGISEYFVE 49
           +H+ PL R+   ++ KE H     + E   ++++A  I + F +
Sbjct: 140 KHTRPLIRLREIMTFKEAHTAHSTKEEAENQVKEAISIYKKFFD 183


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.131    0.363 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,803,440
Number of Sequences: 62578
Number of extensions: 46598
Number of successful extensions: 60
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 59
Number of HSP's gapped (non-prelim): 1
length of query: 95
length of database: 14,973,337
effective HSP length: 62
effective length of query: 33
effective length of database: 11,093,501
effective search space: 366085533
effective search space used: 366085533
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)