BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy1953
(379 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3GHG|A Chain A, Crystal Structure Of Human Fibrinogen
pdb|3GHG|D Chain D, Crystal Structure Of Human Fibrinogen
pdb|3GHG|G Chain G, Crystal Structure Of Human Fibrinogen
pdb|3GHG|J Chain J, Crystal Structure Of Human Fibrinogen
Length = 562
Score = 29.3 bits (64), Expect = 4.0, Method: Compositional matrix adjust.
Identities = 16/70 (22%), Positives = 27/70 (38%)
Query: 116 RNHRLINEIFXXXXXXXXXXXXTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKR 175
R ++L N +F TTN M++L+ S + + + E KR
Sbjct: 65 RINKLKNSLFEYQKNNKDSHSLTTNIMEILRGDFSSANNRDNTYNRVSEDLRSRIEVLKR 124
Query: 176 KFVESSEQFQ 185
K +E + Q
Sbjct: 125 KVIEKVQHIQ 134
>pdb|2KD3|A Chain A, Nmr Structure Of The Wnt Modulator Protein Sclerostin
Length = 113
Score = 28.1 bits (61), Expect = 9.5, Method: Composition-based stats.
Identities = 9/11 (81%), Positives = 10/11 (90%)
Query: 314 HMNAGRPPHYP 324
HMN GRPPH+P
Sbjct: 3 HMNGGRPPHHP 13
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.132 0.406
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,727,971
Number of Sequences: 62578
Number of extensions: 260706
Number of successful extensions: 703
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 697
Number of HSP's gapped (non-prelim): 6
length of query: 379
length of database: 14,973,337
effective HSP length: 100
effective length of query: 279
effective length of database: 8,715,537
effective search space: 2431634823
effective search space used: 2431634823
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 52 (24.6 bits)