Diaphorina citri psyllid: psy1963

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

MSVSQEKLNHLCLQLFDIDALKFGDFVTKVGIKTPVYLDLRGIISYPKLMDYLSTIINDYLNINKISARTVCGVPYTALPIATAVSVKYNIPMLIRRKDVKTYGTKKLIEGVYEKGDKRKDVKTYGTKKLIEGVYEKGDKCVIIEDVVTSGSSILETINDLKSVGIVVTDVLTIVDREQGGRANLKQLGYTLHSLFTLSSVMDILYKANKIKVDTVEDVKKYLCNNQVLPKCDNDVQGRITRCLRPFTNP

ccccHHHHHHHHHHHHHcccEEEccEEEcccccccEEEEcccccccHHHHHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccEEEEcccccEEEEEEccccccHHHHHHHHHHHHcccEEEEEEEEEEccccHHHHHHHccccEEEEccHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccccccc

*******LNHLCLQLFDIDALKFGDFVTKVGIKTPVYLDLRGIISYPKLMDYLSTIINDYLNINKISARTVCGVPYTALPIATAVSVKYNIPMLIRRKDVKTYGTKKLIEGVYEKGDKRKDVKTYGTKKLIEGVYEKGDKCVIIEDVVTSGSSILETINDLKSVGIVVTDVLTIVDREQGGRANLKQLGYTLHSLFTLSSVMDILYKANKIKVDTVEDVKKYLCNNQVLPKC******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Orotate phosphoribosyltransferase	Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).	confident	O27888
Orotate phosphoribosyltransferase	Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).	confident	B0SCV6
Orotate phosphoribosyltransferase	Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).	confident	Q2NFI3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0072528 [BP]	pyrimidine-containing compound biosynthetic process	probable	GO:1901576, GO:0044271, GO:1901566, GO:0071704, GO:0046483, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901564, GO:0018130, GO:1901362, GO:1901360, GO:0072527
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0055086 [BP]	nucleobase-containing small molecule metabolic process	probable	GO:0006139, GO:0044710, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:1901360, GO:0046483

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.4.-.-	Glycosyltransferases.	probable
2.4.2.-	Pentosyltransferases.	probable
2.4.2.10	Orotate phosphoribosyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WNS, chain A
Confidence level:very confident
Coverage over the Query: 8-106,129-225
View the alignment between query and template
View the model in PyMOL

Template: 1O57, chain A
Confidence level:very confident
Coverage over the Query: 5-28,40-201
View the alignment between query and template
View the model in PyMOL