Query         psy1968
Match_columns 215
No_of_seqs    86 out of 104
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 20:50:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy1968.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/1968hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01841 Transglut_core:  Trans  96.6 0.00081 1.8E-08   49.6   0.8   51  157-211    16-66  (113)
  2 KOG3639|consensus               96.3    0.01 2.2E-07   61.2   6.9  111   99-213   877-998 (1239)
  3 PF04473 DUF553:  Transglutamin  94.0   0.036 7.8E-07   46.5   2.2   31  183-213    62-92  (153)
  4 smart00460 TGc Transglutaminas  87.8    0.26 5.5E-06   33.5   1.0   21  191-211     1-21  (68)
  5 COG1305 Transglutaminase-like   87.7    0.59 1.3E-05   39.3   3.3   31  182-212   180-210 (319)
  6 PF06035 Peptidase_C93:  Bacter  76.6     1.3 2.8E-05   38.2   1.2   61  147-211    32-92  (170)
  7 PF13214 DUF4022:  Protein of u  64.9     3.8 8.3E-05   31.4   1.4   21  193-213    43-63  (83)
  8 cd01240 PH_beta-ARK Beta adren  38.4      19 0.00042   29.6   1.5   19  110-128    16-34  (116)
  9 PF12242 Eno-Rase_NADH_b:  NAD(  36.0     9.7 0.00021   29.4  -0.5   36  138-184     6-41  (78)
 10 PF00797 Acetyltransf_2:  N-ace  34.3      20 0.00043   30.3   1.1   20  193-212    43-62  (240)
 11 PF06991 Prp19_bind:  Splicing   20.2      83  0.0018   29.0   2.5   19   33-51     28-46  (276)

No 1  
>PF01841 Transglut_core:  Transglutaminase-like superfamily;  InterPro: IPR002931 This domain is found in many proteins known to have transglutaminase activity, i.e. which cross-link proteins through an acyl-transfer reaction between the gamma-carboxamide group of peptide-bound glutamine and the epsilon-amino group of peptide-bound lysine, resulting in a epsilon-(gamma-glutamyl)lysine isopeptide bond. Tranglutaminases have been found in a diverse range of species, from bacteria through to mammals. The enzymes require calcium binding and their activity leads to post-translational modification of proteins through acyl-transfer reactions, involving peptidyl glutamine residues as acyl donors and a variety of primary amines as acyl acceptors, with the generation of proteinase resistant isopeptide bonds [].  Sequence conservation in this superfamily primarily involves three motifs that centre around conserved cysteine, histidine, and aspartate residues that form the catalytic triad in the structurally characterised transglutaminase, the human blood clotting factor XIIIa' []. On the basis of the experimentally demonstrated activity of the Methanobacterium phage psiM2 pseudomurein endoisopeptidase [], it is proposed that many, if not all, microbial homologs of the transglutaminases are proteases and that the eukaryotic transglutaminases have evolved from an ancestral protease [].  A subunit of plasma Factor XIII revealed that each Factor XIIIA subunit is composed of four domains (termed N-terminal beta-sandwich, core domain (containing the catalytic and the regulatory sites), and C-terminal beta-barrels 1 and 2) and that two monomers assemble into the native dimer through the surfaces in domains 1 and 2, in opposite orientation. This organisation in four domains is highly conserved during evolution among transglutaminase isoforms [].; PDB: 2F4M_A 2F4O_A 1GGY_B 1FIE_B 1GGU_B 1GGT_B 1F13_A 1QRK_B 1EVU_A 1EX0_B ....
Probab=96.57  E-value=0.00081  Score=49.58  Aligned_cols=51  Identities=25%  Similarity=0.417  Sum_probs=38.4

Q ss_pred             cChhhHHHHhhcccccccCCCCCCCCccccChhhHhhcccCCcchhhHHHHHhhh
Q psy1968         157 KSWSGCASFVSDHIVYEPLDHPTNLPVRLRSPSTVFNGQSGHCFELSTLLVSLLL  211 (215)
Q Consensus       157 y~~~~cA~FVSd~L~YEpLe~P~~~P~~l~SPtt~L~~QkGnCFD~S~LLCSLLl  211 (215)
                      .-...+.+||.+.+.|.    .......-.+|..+|..++|+|.|+|+|+++||-
T Consensus        16 ~~~~~i~~~v~~~~~y~----~~~~~~~~~~~~~~l~~~~G~C~~~a~l~~allr   66 (113)
T PF01841_consen   16 EKAKAIYDWVRSNIRYD----DPNYSPGPRDASEVLRSGRGDCEDYASLFVALLR   66 (113)
T ss_dssp             CCCCCCCCCCCCCCCEC-----TCCCCCCTTHHHHHHCEEESHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhCcEEe----CCCCCCCCCCHHHHHHcCCCccHHHHHHHHHHHh
Confidence            44455667888999999    2222333345999999999999999999999973


No 2  
>KOG3639|consensus
Probab=96.28  E-value=0.01  Score=61.18  Aligned_cols=111  Identities=17%  Similarity=0.149  Sum_probs=85.0

Q ss_pred             cCCHHHHHHHHHHHHHHHHHHHhCCCC--CCcceecCcccCCcceeeeeeeccCCCCcccc---------ChhhHHHHhh
Q psy1968          99 RNTDKEKLLIWYCENFRRQYSSRYPLR--RPLVMALENECGVQKMVCTSINVTRFPLVEFK---------SWSGCASFVS  167 (215)
Q Consensus        99 ~nS~KE~llL~yAenF~rQF~~lyPdR--RpL~L~p~NECGV~KFVCTTIRPT~Lpy~ELy---------~~~~cA~FVS  167 (215)
                      ..|-....+|+.++||..+-..+||.|  +|+++--   +|-.-|+--|+||..-| .+|-         +..-+||++|
T Consensus       877 feS~EdeKlLea~ekfeaeca~kFPkR~cl~lViDi---nghstf~TRYLkPiaPP-Qelln~~annlqanaeLiaR~aa  952 (1239)
T KOG3639|consen  877 FESFEDEKLLEACEKFEAECAEKFPKRICLPLVIDI---NGHSTFCTRYLKPIAPP-QELLNENANNLQANAELIARLAA  952 (1239)
T ss_pred             cccccchHHHHHHHHHHHHHHHhCccccccceEEec---CCceeEeehhccCCCCh-HHHHhhCccchhhchHHHHHHHH
Confidence            345566789999999999999999999  7887743   56666666699999988 4543         4455677777


Q ss_pred             cccccccCCCCCCCCccccChhhHhhcccCCcchhhHHHHHhhhhc
Q psy1968         168 DHIVYEPLDHPTNLPVRLRSPSTVFNGQSGHCFELSTLLVSLLLVR  213 (215)
Q Consensus       168 d~L~YEpLe~P~~~P~~l~SPtt~L~~QkGnCFD~S~LLCSLLlGa  213 (215)
                      -...--+-.+-+.--+.|.....++.--.|+=.+||||||-.++-+
T Consensus       953 ~Ipf~~drVdfgg~cDiWgnsdQfldiaaGdeEEhatLLc~~fLhf  998 (1239)
T KOG3639|consen  953 KIPFGMDRVDFGGHCDIWGNSDQFLDIAAGDEEEHATLLCCWFLHF  998 (1239)
T ss_pred             hcccCCCccccCccccccccHHHHHHHhcCchHHhHHHHHHHHHHh
Confidence            3332223355566678899999999999999999999999987754


No 3  
>PF04473 DUF553:  Transglutaminase-like domain;  InterPro: IPR007562 This entry represents a transglutaminase-like domain found in a family of uncharacterised archaeal proteins that had previously been called DUF553 and UPF0252.
Probab=94.00  E-value=0.036  Score=46.46  Aligned_cols=31  Identities=23%  Similarity=0.387  Sum_probs=28.0

Q ss_pred             ccccChhhHhhcccCCcchhhHHHHHhhhhc
Q psy1968         183 VRLRSPSTVFNGQSGHCFELSTLLVSLLLVR  213 (215)
Q Consensus       183 ~~l~SPtt~L~~QkGnCFD~S~LLCSLLlGa  213 (215)
                      ..+.||..++..++|.|-|+|+|..+||+.+
T Consensus        62 ~~i~tp~etl~~k~GiC~DYA~Lta~lLl~~   92 (153)
T PF04473_consen   62 TYIQTPYETLKYKKGICGDYAILTAALLLNM   92 (153)
T ss_pred             ccccCHHHHHHcCCeeeHHHHHHHHHHHHHC
Confidence            3567999999999999999999999999863


No 4  
>smart00460 TGc Transglutaminase/protease-like homologues. Transglutaminases are enzymes that establish covalent links between proteins. A subset of transglutaminase homologues appear to catalyse the reverse reaction, the hydrolysis of peptide bonds. Proteins with this domain are both extracellular and intracellular, and it is likely that the eukaryotic intracellular proteins are involved in signalling events.
Probab=87.82  E-value=0.26  Score=33.51  Aligned_cols=21  Identities=33%  Similarity=0.624  Sum_probs=18.7

Q ss_pred             HhhcccCCcchhhHHHHHhhh
Q psy1968         191 VFNGQSGHCFELSTLLVSLLL  211 (215)
Q Consensus       191 ~L~~QkGnCFD~S~LLCSLLl  211 (215)
                      +|+.+.|+|.++|.+++++|-
T Consensus         1 ~~~~~~G~C~~~a~l~~~llr   21 (68)
T smart00460        1 LLKTKYGTCGEFAALFVALLR   21 (68)
T ss_pred             CCcccceeeHHHHHHHHHHHH
Confidence            467899999999999999984


No 5  
>COG1305 Transglutaminase-like enzymes, putative cysteine proteases [Amino acid transport and metabolism]
Probab=87.72  E-value=0.59  Score=39.32  Aligned_cols=31  Identities=29%  Similarity=0.349  Sum_probs=27.3

Q ss_pred             CccccChhhHhhcccCCcchhhHHHHHhhhh
Q psy1968         182 PVRLRSPSTVFNGQSGHCFELSTLLVSLLLV  212 (215)
Q Consensus       182 P~~l~SPtt~L~~QkGnCFD~S~LLCSLLlG  212 (215)
                      -....++..+|..++|+|-|+|.|+.+||=.
T Consensus       180 ~~~~~~~~~~l~~~~G~C~d~a~l~val~Ra  210 (319)
T COG1305         180 TPVTGSASDALRLGRGVCRDFAHLLVALLRA  210 (319)
T ss_pred             CCCCCCHHHHHHhCCcccccHHHHHHHHHHH
Confidence            4577889999999999999999999999843


No 6  
>PF06035 Peptidase_C93:  Bacterial transglutaminase-like cysteine proteinase BTLCP;  InterPro: IPR010319 Structural analysis predicts that this family of proteins are bacterial transglutaminase-like cysteine peptidases (BTLCPs) with an invariant Cys-His-Asp catalytic triad and an N-terminal signal sequence. They are predicted to possess the papain-like cysteine proteinase fold and catalyse post-translational protein modification through transamidase, acetylase or hydrolase activity. Inspection of neighbouring genes suggests a link between this predicted activity and a type-I secretion system resembling ATP-binding cassette exporters of toxins and proteases involved in bacterial pathogenicity [].; PDB: 4FGQ_B 4FGP_B 4FGO_A.
Probab=76.64  E-value=1.3  Score=38.19  Aligned_cols=61  Identities=13%  Similarity=0.161  Sum_probs=28.2

Q ss_pred             eccCCCCccccChhhHHHHhhcccccccCCCCCCCCccccChhhHhhcccCCcchhhHHHHHhhh
Q psy1968         147 NVTRFPLVEFKSWSGCASFVSDHIVYEPLDHPTNLPVRLRSPSTVFNGQSGHCFELSTLLVSLLL  211 (215)
Q Consensus       147 RPT~Lpy~ELy~~~~cA~FVSd~L~YEpLe~P~~~P~~l~SPtt~L~~QkGnCFD~S~LLCSLLl  211 (215)
                      .|+.+.-.+.......-+||-.-|.|..=..--+..++|.+|    ....|||.|+|++==-.|+
T Consensus        32 ~~~~lt~~~~~~L~~VN~~vN~~I~~~~D~~~~g~~DyWa~P----~~g~GDCEDyai~K~~~L~   92 (170)
T PF06035_consen   32 APVKLTADRWEQLERVNRFVNRAIRYVSDQDLYGQEDYWATP----ARGAGDCEDYAIAKRFALI   92 (170)
T ss_dssp             -----------HHHHHHHHHHT-SEE---TTTSS--SS---H----HHTEE-HHHHHHHHHHHHH
T ss_pred             cccccchhHHHHHHHHHHHHHccCCccChhHhcCCccCCCCC----CCCcCCcHhHHHHHHHHHH
Confidence            455555444455666667887777666554456677999999    3579999999987444443


No 7  
>PF13214 DUF4022:  Protein of unknown function (DUF4022)
Probab=64.90  E-value=3.8  Score=31.42  Aligned_cols=21  Identities=29%  Similarity=0.271  Sum_probs=19.8

Q ss_pred             hcccCCcchhhHHHHHhhhhc
Q psy1968         193 NGQSGHCFELSTLLVSLLLVR  213 (215)
Q Consensus       193 ~~QkGnCFD~S~LLCSLLlGa  213 (215)
                      .|+|.|-.-++-|+||||+|.
T Consensus        43 gwkksngiky~cl~~slllgt   63 (83)
T PF13214_consen   43 GWKKSNGIKYFCLLLSLLLGT   63 (83)
T ss_pred             ccccCCCeeeHHHHHHHHHhH
Confidence            699999999999999999996


No 8  
>cd01240 PH_beta-ARK Beta adrenergic receptor kinase 1(beta ARK1)(GRK2)  pleckstrin homology (PH) domain. Beta adrenergic receptor kinase 1(beta ARK1)(GRK2)  pleckstrin homology (PH) domain. Beta ARK1 is a G protein-coupled receptor kinase (GRK).  It phosphorylates activated G-protein coupled receptors leading to the release of the previously bound heterotrimeric G protein agonist and thus signal termination. It consists of a domain found in regulators of G-protein signaling (RGS)(RH), a serine/threonine kinase domain and a C-terminal PH domain. The Beta-Ark 1 PH domain has an extended C-terminal helix, which mediates interactions with G beta gamma subunits. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or 
Probab=38.38  E-value=19  Score=29.63  Aligned_cols=19  Identities=26%  Similarity=0.565  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHhCCCCCCc
Q psy1968         110 YCENFRRQYSSRYPLRRPL  128 (215)
Q Consensus       110 yAenF~rQF~~lyPdRRpL  128 (215)
                      ++.+|++.|..+||.|--+
T Consensus        16 Fls~WQ~Ry~~LfPNRLE~   34 (116)
T cd01240          16 FLSQWQTRYFKLYPNRLEL   34 (116)
T ss_pred             HHHHHHHHHheeCcceeee
Confidence            5779999999999999776


No 9  
>PF12242 Eno-Rase_NADH_b:  NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A.
Probab=35.95  E-value=9.7  Score=29.38  Aligned_cols=36  Identities=28%  Similarity=0.529  Sum_probs=23.8

Q ss_pred             CcceeeeeeeccCCCCccccChhhHHHHhhcccccccCCCCCCCCcc
Q psy1968         138 VQKMVCTSINVTRFPLVEFKSWSGCASFVSDHIVYEPLDHPTNLPVR  184 (215)
Q Consensus       138 V~KFVCTTIRPT~Lpy~ELy~~~~cA~FVSd~L~YEpLe~P~~~P~~  184 (215)
                      ++-|||+|-.|           .||++-|.+-+.|-....+..-|+.
T Consensus         6 irg~i~~taHP-----------~GC~~~V~~qI~yvk~~~~~~GpK~   41 (78)
T PF12242_consen    6 IRGFICTTAHP-----------VGCARNVENQIEYVKSQGKINGPKK   41 (78)
T ss_dssp             EETTEES---H-----------HHHHHHHHHHHHHHHHC---TS-SE
T ss_pred             ccceeECCCCc-----------HHHHHHHHHHHHHHHhcCCCCCCce
Confidence            56788988765           6999999999999998666655543


No 10 
>PF00797 Acetyltransf_2:  N-acetyltransferase;  InterPro: IPR001447 Arylamine N-acetyltransferase (NAT) is a cytosolic enzyme of approximately 30 kDa. It facilitates the transfer of an acetyl group from acetyl coenzyme A on to a wide range of arylamine, N-hydroxyarylamines and hydrazines. Acetylation of these compounds generally results in inactivation. NAT is found in many species from Mycobacteria (Mycobacterium tuberculosis, Mycobacterium smegmatis etc) to Homo sapiens (Human). It was the first enzyme to be observed to have polymorphic activity amongst human individuals. NAT is responsible for the inactivation of Isoniazid (a drug used to treat tuberculosis) in humans. The NAT protein has also been shown to be involved in the breakdown of folic acid. NAT catalyses the reaction:  Acetyl-coA + arylamine = coA + N-acetylarylamine   NAT is the target of a common genetic polymorphism of clinical relevance in humans. The N-acetylation polymorphism is determined by low or high NAT activity in liver. NAT has been implicated in the action and toxicity of amine-containing drugs, and in the susceptibility to cancer and systematic lupus erythematosus. Two highly similar human genes for NAT, termed NAT1 and NAT2, encode genetically invariant and variant NAT proteins, respectively. ; GO: 0016407 acetyltransferase activity, 0008152 metabolic process; PDB: 1W6F_A 1W5R_A 1GX3_D 2PQT_A 2IJA_A 1W4T_A 2BSZ_B 3D9W_B 3LTW_A 3LNB_A ....
Probab=34.31  E-value=20  Score=30.35  Aligned_cols=20  Identities=45%  Similarity=0.743  Sum_probs=15.1

Q ss_pred             hcccCCcchhhHHHHHhhhh
Q psy1968         193 NGQSGHCFELSTLLVSLLLV  212 (215)
Q Consensus       193 ~~QkGnCFD~S~LLCSLLlG  212 (215)
                      +.+-|-||++..|++.+|..
T Consensus        43 ~~rGG~C~elN~lf~~lL~~   62 (240)
T PF00797_consen   43 RGRGGYCFELNGLFYWLLRE   62 (240)
T ss_dssp             TT--B-HHHHHHHHHHHHHH
T ss_pred             cCCCeEhHHHHHHHHHHHHH
Confidence            67789999999999999964


No 11 
>PF06991 Prp19_bind:  Splicing factor, Prp19-binding domain;  InterPro: IPR009730 This entry represents the C terminus (approximately 300 residues) of eukaryotic micro-fibrillar-associated protein 1, which is a component of elastin-associated microfibrils in the extracellular matrix [].
Probab=20.24  E-value=83  Score=28.98  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=13.5

Q ss_pred             cccCCCCCCccccceeccc
Q psy1968          33 DENDRRPPIVQPIVPIKYE   51 (215)
Q Consensus        33 ~~~~~~~~~~~~~~~~~~~   51 (215)
                      |+.+-.+||++||-+.|..
T Consensus        28 dSEde~~~~lKPVFV~K~~   46 (276)
T PF06991_consen   28 DSEDEEEPLLKPVFVPKKQ   46 (276)
T ss_pred             cccccccccccceeecccc
Confidence            3334445999999998873


Done!