Query         psy2017
Match_columns 255
No_of_seqs    222 out of 1577
Neff          8.8 
Searched_HMMs 46136
Date          Fri Aug 16 22:06:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2017.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2017hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01607 CBM_14:  Chitin bindin  99.2 5.4E-12 1.2E-16   80.9   2.3   48  196-246     5-53  (53)
  2 PF01607 CBM_14:  Chitin bindin  99.2 2.2E-11 4.8E-16   78.0   3.4   48   29-78      1-49  (53)
  3 smart00494 ChtBD2 Chitin-bindi  99.1   1E-10 2.2E-15   75.6   5.1   53  192-247     2-55  (56)
  4 smart00494 ChtBD2 Chitin-bindi  99.1 3.4E-10 7.4E-15   73.1   5.4   51   28-80      2-53  (56)
  5 PF03427 CBM_19:  Carbohydrate   87.8    0.49 1.1E-05   30.7   2.2   21  207-227    35-55  (61)
  6 PF03427 CBM_19:  Carbohydrate   81.2     1.9 4.1E-05   28.1   2.7   36   24-66     18-56  (61)
  7 PF08475 Baculo_VP91_N:  Viral   67.3     7.1 0.00015   31.4   3.4   35   39-75    108-142 (183)
  8 PF08475 Baculo_VP91_N:  Viral   53.9      12 0.00025   30.2   2.5   37  200-241   107-143 (183)
  9 PF12662 cEGF:  Complement Clr-  45.3      15 0.00033   19.1   1.3   17  138-154     5-21  (24)
 10 PF09064 Tme5_EGF_like:  Thromb  41.3      16 0.00034   20.8   1.0   12  220-231    20-31  (34)
 11 PF01826 TIL:  Trypsin Inhibito  36.9      13 0.00029   23.2   0.3   18   59-77     36-53  (55)
 12 cd00064 FU Furin-like repeats.  27.0      59  0.0013   19.6   2.1   20  133-152    29-48  (49)
 13 PF00220 Hormone_4:  Neurohypop  26.2      36 0.00077   13.4   0.6    7  136-142     3-9   (9)

No 1  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.21  E-value=5.4e-12  Score=80.95  Aligned_cols=48  Identities=50%  Similarity=1.125  Sum_probs=37.2

Q ss_pred             CCCcccCCcCCcccEEccCCeeEeccCCCCCccCcCCCCCCCCCCCCc-ccC
Q psy2017         196 KNGQYEDPVQCDKYYECFDGQATEKLCPDGLVFDPLNRKINKCDQPFN-VEC  246 (255)
Q Consensus       196 ~~g~~~~~~~C~~y~~C~~g~~~~~~Cp~G~~Fd~~~~~~~~C~~~~~-v~C  246 (255)
                      .+|+++++.+|++||+|.+|.++++.||.|++||+.   +++|+++.+ +.|
T Consensus         5 ~~~~~~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~---~~~C~~~~~~~~C   53 (53)
T PF01607_consen    5 GDGFYPHPDDCRKYYQCVNGQAVEQRCPEGLYFDPS---SQRCVPPSNVVQC   53 (53)
T ss_dssp             SSEEE--SS-SSEEEEEETTEEEEEE-TTS-EE-TT---TSSEE-TTT-TT-
T ss_pred             CCeeEeCCCCCCEEEEeeCCcEECCCCcCCCEECcC---cCEEcCCccCCCC
Confidence            478999999999999999999999999999999996   799999999 666


No 2  
>PF01607 CBM_14:  Chitin binding Peritrophin-A domain;  InterPro: IPR002557 This entry represents a chitin binding domain []. It is found in (amongst others) the Peritrophin-A chitin binding proteins, particularly the peritrophic matrix proteins of insects and animal chitinases [, , ]. Copies of the domain are also found in some baculoviruses. It is an extracellular domain that contains six conserved cysteines that probably form three disulphide bridges. Chitin binding has been demonstrated for a protein containing only two of these domains [].; GO: 0008061 chitin binding, 0006030 chitin metabolic process, 0005576 extracellular region; PDB: 1DQC_A.
Probab=99.16  E-value=2.2e-11  Score=78.03  Aligned_cols=48  Identities=38%  Similarity=0.996  Sum_probs=36.1

Q ss_pred             CCC-CCCcccCCCCcCCCccEEcCCCceEEeeCCCCCeeeCCCCcccCCCc
Q psy2017          29 CPR-RNGYFAHPDEKVCNIFYNCIEGDSTEIICPTGLHFDEYTGTCVWPES   78 (255)
Q Consensus        29 C~~-~~G~~~~p~p~~C~~y~~C~~g~~~~~~Cp~g~~Fd~~~~~C~~~~~   78 (255)
                      |.. .+|+|  +++.+|++||+|.+|.++++.||.|++||+.++.|+++..
T Consensus         1 C~~~~~~~~--~~~~~C~~Y~~C~~g~~~~~~C~~g~~fd~~~~~C~~~~~   49 (53)
T PF01607_consen    1 CPGRGDGFY--PHPDDCRKYYQCVNGQAVEQRCPEGLYFDPSSQRCVPPSN   49 (53)
T ss_dssp             ----SSEEE----SS-SSEEEEEETTEEEEEE-TTS-EE-TTTSSEE-TTT
T ss_pred             CCccCCeeE--eCCCCCCEEEEeeCCcEECCCCcCCCEECcCcCEEcCCcc
Confidence            443 57888  6689999999999999999999999999999999999988


No 3  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.12  E-value=1e-10  Score=75.61  Aligned_cols=53  Identities=49%  Similarity=1.130  Sum_probs=47.7

Q ss_pred             ccCC-CCCcccCCcCCcccEEccCCeeEeccCCCCCccCcCCCCCCCCCCCCcccCC
Q psy2017         192 KCPQ-KNGQYEDPVQCDKYYECFDGQATEKLCPDGLVFDPLNRKINKCDQPFNVECG  247 (255)
Q Consensus       192 ~C~~-~~g~~~~~~~C~~y~~C~~g~~~~~~Cp~G~~Fd~~~~~~~~C~~~~~v~C~  247 (255)
                      .|.. ..|+|+++.+|++||+|.+|.++.+.||.|++||..   ++.|+++..+.|.
T Consensus         2 ~C~~~~~g~~~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~---~~~C~~~~~~~C~   55 (56)
T smart00494        2 ECPGRGDGLYPHPTDCSKYYQCSNGRPIVGSCPAGLVFDPA---TQTCDWPDNVGCG   55 (56)
T ss_pred             cCCCCCCccccCcccCCeeEEcCCCcEEeccCcCCCeECCC---CCCcCCcccCCCC
Confidence            3544 478999999999999999999999999999999996   6999999999886


No 4  
>smart00494 ChtBD2 Chitin-binding domain type 2.
Probab=99.06  E-value=3.4e-10  Score=73.13  Aligned_cols=51  Identities=39%  Similarity=0.962  Sum_probs=45.5

Q ss_pred             CCCC-CCCcccCCCCcCCCccEEcCCCceEEeeCCCCCeeeCCCCcccCCCccC
Q psy2017          28 LCPR-RNGYFAHPDEKVCNIFYNCIEGDSTEIICPTGLHFDEYTGTCVWPESAG   80 (255)
Q Consensus        28 ~C~~-~~G~~~~p~p~~C~~y~~C~~g~~~~~~Cp~g~~Fd~~~~~C~~~~~~~   80 (255)
                      .|.. .+|+|  +++.+|++|++|.++.++.+.||.|++||..++.|+++..+.
T Consensus         2 ~C~~~~~g~~--~~~~~C~~y~~C~~~~~~~~~C~~g~~f~~~~~~C~~~~~~~   53 (56)
T smart00494        2 ECPGRGDGLY--PHPTDCSKYYQCSNGRPIVGSCPAGLVFDPATQTCDWPDNVG   53 (56)
T ss_pred             cCCCCCCccc--cCcccCCeeEEcCCCcEEeccCcCCCeECCCCCCcCCcccCC
Confidence            5764 56888  778899999999999999999999999999999999998764


No 5  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=87.76  E-value=0.49  Score=30.74  Aligned_cols=21  Identities=24%  Similarity=0.477  Sum_probs=19.4

Q ss_pred             cccEEccCCeeEeccCCCCCc
Q psy2017         207 DKYYECFDGQATEKLCPDGLV  227 (255)
Q Consensus       207 ~~y~~C~~g~~~~~~Cp~G~~  227 (255)
                      .+|-+|.+|+++.+.||+|++
T Consensus        35 G~faiC~~G~Wv~~~C~~Gt~   55 (61)
T PF03427_consen   35 GSFAICDHGTWVITPCPAGTT   55 (61)
T ss_pred             CCEEEcCCCcEEEeeCCCCCE
Confidence            479999999999999999986


No 6  
>PF03427 CBM_19:  Carbohydrate binding domain (family 19);  InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity. A few exceptions are CBMs in cellulosomal scaffolding proteins and rare instances of independent putative CBMs. The requirement of CBMs existing as modules within larger enzymes sets this class of carbohydrate-binding protein apart from other non-catalytic sugar binding proteins such as lectins and sugar transport proteins. CBMs were previously classified as cellulose-binding domains (CBDs) based on the initial discovery of several modules that bound cellulose [, ]. However, additional modules in carbohydrate-active enzymes are continually being found that bind carbohydrates other than cellulose yet otherwise meet the CBM criteria, hence the need to reclassify these polypeptides using more inclusive terminology. Previous classification of cellulose-binding domains were based on amino acid similarity. Groupings of CBDs were called "Types" and numbered with roman numerals (e.g. Type I or Type II CBDs). In keeping with the glycoside hydrolase classification, these groupings are now called families and numbered with Arabic numerals. Families 1 to 13 are the same as Types I to XIII. For a detailed review on the structure and binding modes of CBMs see []. This entry represents CBM19 from CAZY which consists of 60-70 residues with chitin-binding function.; GO: 0004568 chitinase activity, 0006032 chitin catabolic process
Probab=81.18  E-value=1.9  Score=28.09  Aligned_cols=36  Identities=25%  Similarity=0.554  Sum_probs=26.2

Q ss_pred             CCCCCCCCCCCcccCCCCcCC---CccEEcCCCceEEeeCCCCCee
Q psy2017          24 QGSYLCPRRNGYFAHPDEKVC---NIFYNCIEGDSTEIICPTGLHF   66 (255)
Q Consensus        24 ~~~~~C~~~~G~~~~p~p~~C---~~y~~C~~g~~~~~~Cp~g~~F   66 (255)
                      .....|.. +|.|      -|   .+|-+|.+|.++...||+|++-
T Consensus        18 ~~g~sc~t-~G~~------aCt~~G~faiC~~G~Wv~~~C~~Gt~C   56 (61)
T PF03427_consen   18 YNGQSCST-DGEY------ACTSDGSFAICDHGTWVITPCPAGTTC   56 (61)
T ss_pred             cCCCccCC-CCce------eEcCCCCEEEcCCCcEEEeeCCCCCEE
Confidence            33445542 4666      26   3599999999999999999863


No 7  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=67.25  E-value=7.1  Score=31.38  Aligned_cols=35  Identities=23%  Similarity=0.360  Sum_probs=32.1

Q ss_pred             CCCcCCCccEEcCCCceEEeeCCCCCeeeCCCCcccC
Q psy2017          39 PDEKVCNIFYNCIEGDSTEIICPTGLHFDEYTGTCVW   75 (255)
Q Consensus        39 p~p~~C~~y~~C~~g~~~~~~Cp~g~~Fd~~~~~C~~   75 (255)
                      +++.|=++|..=.+..+..+.||.+..||..  +|+.
T Consensus       108 ~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~~--~Cvp  142 (183)
T PF08475_consen  108 PHPNDPTKFIARGDDGWVDMDCPENERFDGN--KCVP  142 (183)
T ss_pred             cCCCCCceEEEEecCCcEEEeCCCccccccc--ceee
Confidence            6778999999999888999999999999999  9995


No 8  
>PF08475 Baculo_VP91_N:  Viral capsid protein 91 N-terminal;  InterPro: IPR013682 This domain is found in Baculoviridae including the nucleopolyhedrovirus at the N terminus of the viral capsid protein 91 (VP91) []. 
Probab=53.91  E-value=12  Score=30.16  Aligned_cols=37  Identities=27%  Similarity=0.355  Sum_probs=31.3

Q ss_pred             ccCCcCCcccEEccCCeeEeccCCCCCccCcCCCCCCCCCCC
Q psy2017         200 YEDPVQCDKYYECFDGQATEKLCPDGLVFDPLNRKINKCDQP  241 (255)
Q Consensus       200 ~~~~~~C~~y~~C~~g~~~~~~Cp~G~~Fd~~~~~~~~C~~~  241 (255)
                      -+|+.+=+||..=.+-.++.+.||.+..||.     .+|+..
T Consensus       107 ~~~~~d~~kF~~~~DDGwv~~~CP~~~~FD~-----~~Cvp~  143 (183)
T PF08475_consen  107 RPHPNDPTKFIARGDDGWVDMDCPENERFDG-----NKCVPI  143 (183)
T ss_pred             ecCCCCCceEEEEecCCcEEEeCCCcccccc-----cceeec
Confidence            3578888999998886799999999999999     378863


No 9  
>PF12662 cEGF:  Complement Clr-like EGF-like
Probab=45.26  E-value=15  Score=19.10  Aligned_cols=17  Identities=18%  Similarity=0.614  Sum_probs=13.9

Q ss_pred             CCCCCCccccCCCCCCC
Q psy2017         138 GCQVGEVYNEESQKCDA  154 (255)
Q Consensus       138 ~Cp~G~~Fd~~~~~C~~  154 (255)
                      .|++|+..++..+.|.-
T Consensus         5 ~C~~Gy~l~~d~~~C~D   21 (24)
T PF12662_consen    5 SCPPGYQLSPDGRSCED   21 (24)
T ss_pred             eCCCCCcCCCCCCcccc
Confidence            68999999888888763


No 10 
>PF09064 Tme5_EGF_like:  Thrombomodulin like fifth domain, EGF-like;  InterPro: IPR015149 This domain adopts a fold similar to other EGF domains, with a flat major and a twisted minor beta sheet. Disulphide pairing, however, is not of the usual 1-3, 2-4, 5-6 type; rather 1-2, 3-4, 5-6 pairing is found. Its extended major sheet (strands beta-2 and beta-3 and the connecting loop) projects into thrombin's active site groove. This domain is required for interaction of thrombomodulin with thrombin, and subsequent activation of protein-C []. ; GO: 0004888 transmembrane signaling receptor activity, 0016021 integral to membrane
Probab=41.29  E-value=16  Score=20.79  Aligned_cols=12  Identities=33%  Similarity=0.902  Sum_probs=8.2

Q ss_pred             ccCCCCCccCcC
Q psy2017         220 KLCPDGLVFDPL  231 (255)
Q Consensus       220 ~~Cp~G~~Fd~~  231 (255)
                      =.||.|++.|+.
T Consensus        20 C~CPeGyIlde~   31 (34)
T PF09064_consen   20 CFCPEGYILDEG   31 (34)
T ss_pred             eeCCCceEecCC
Confidence            357777777763


No 11 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=36.88  E-value=13  Score=23.20  Aligned_cols=18  Identities=39%  Similarity=0.910  Sum_probs=15.3

Q ss_pred             eCCCCCeeeCCCCcccCCC
Q psy2017          59 ICPTGLHFDEYTGTCVWPE   77 (255)
Q Consensus        59 ~Cp~g~~Fd~~~~~C~~~~   77 (255)
                      .|+.|+++|.. +.|+.+.
T Consensus        36 ~C~~G~v~~~~-~~CV~~~   53 (55)
T PF01826_consen   36 FCPPGYVRNDN-GRCVPPS   53 (55)
T ss_dssp             EETTTEEEETT-SEEEEGG
T ss_pred             CCCCCeeEcCC-CCEEcHH
Confidence            68999999998 8998654


No 12 
>cd00064 FU Furin-like repeats. Cysteine rich region. Exact function of the domain is not known. Furin is a serine-kinase dependent proprotein processor. Other members of this family include endoproteases and cell surface receptors.
Probab=27.00  E-value=59  Score=19.56  Aligned_cols=20  Identities=20%  Similarity=0.365  Sum_probs=13.8

Q ss_pred             ccceeCCCCCCccccCCCCC
Q psy2017         133 TPREQGCQVGEVYNEESQKC  152 (255)
Q Consensus       133 ~~~~~~Cp~G~~Fd~~~~~C  152 (255)
                      ..=+..||.++++|.....|
T Consensus        29 ~~Cv~~C~~~~~~~~~~~~C   48 (49)
T cd00064          29 GTCVSECPEGTYADTEGGVC   48 (49)
T ss_pred             CcccccCCCCceecCcCCcC
Confidence            33444789999888666655


No 13 
>PF00220 Hormone_4:  Neurohypophysial hormones, N-terminal Domain;  InterPro: IPR022423 Oxytocin (or ocytocin) and vasopressin [] are small (nine amino acid residues), structurally and functionally related neurohypophysial peptide hormones. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland while vasopressin has a direct antidiuretic action on the kidney and also causes vasoconstriction of the peripheral vessels. Like the majority of active peptides, both hormones are synthesized as larger protein precursors that are enzymatically converted to their mature forms. Peptides belonging to this family are also found in birds, fish, reptiles and amphibians (mesotocin, isotocin, valitocin, glumitocin, aspargtocin, vasotocin, seritocin, asvatocin, phasvatocin), in worms (annetocin), octopi (cephalotocin), locust (locupressin or neuropeptide F1/F2) and in molluscs (conopressins G and S) [].  The pattern developed to detect this category of peptides spans their entire sequence and includes four invariant amino acid residues.  .; GO: 0005185 neurohypophyseal hormone activity, 0005576 extracellular region
Probab=26.16  E-value=36  Score=13.37  Aligned_cols=7  Identities=29%  Similarity=0.961  Sum_probs=3.5

Q ss_pred             eeCCCCC
Q psy2017         136 EQGCQVG  142 (255)
Q Consensus       136 ~~~Cp~G  142 (255)
                      .++||.|
T Consensus         3 i~nCP~G    9 (9)
T PF00220_consen    3 IRNCPIG    9 (9)
T ss_pred             cccCCCC
Confidence            3456544


Done!