Diaphorina citri psyllid: psy2033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120----
MVEKGTIPSHLGAGQTEQQPPESLSGVVPAMHYGYVEGWFSKVAQASLGWLLLMGVLYIIGGLIYALRVPERYFPGKCDIWFQSHQIFHVLVVSAAFVHYHGITEMAMYRLSSGGCEAPQPVAL
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
********SHLG*GQTEQQPPESLSGVVPAMHYGYVEGWFSKVAQASLGWLLLMGVLYIIGGLIYALRVPERYFPGKCDIWFQSHQIFHVLVVSAAFVHYHGITEMAMYRLSSGGCE*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVEKGTIPSHLGAGQTEQQPPESLSGVVPAMHYGYVEGWFSKVAQASLGWLLLMGVLYIIGGLIYALRVPERYFPGKCDIWFQSHQIFHVLVVSAAFVHYHGITEMAMYRLSSGGCEAPQPVAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adiponectin receptor protein 1 Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin.confidentQ96A54
Adiponectin receptor protein 1 Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin.confidentQ91VH1
ADIPOR-like receptor CG5315 Probable receptor, which may be involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation.confidentQ9VCY8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009755 [BP]hormone-mediated signaling pathwayprobableGO:0071495, GO:0044700, GO:0051716, GO:0009719, GO:0070887, GO:0008150, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0050794, GO:0050789, GO:0032870, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0042221, GO:0007154, GO:0010033, GO:0044699
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0042562 [MF]hormone bindingprobableGO:0003674, GO:0005488
GO:0019395 [BP]fatty acid oxidationprobableGO:0034440, GO:0006631, GO:0006629, GO:0006082, GO:0044238, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0030258, GO:0055114, GO:0044281
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0030308 [BP]negative regulation of cell growthprobableGO:0045926, GO:0040008, GO:0051128, GO:0008150, GO:0001558, GO:0065007, GO:0048519, GO:0050794, GO:0050789, GO:0048523
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0004872 [MF]receptor activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted