Diaphorina citri psyllid: psy2055


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MFYRASVVSLEKIPLRVKAIHIVNQPFYFNALYAIFKPFLKQKLRRRNVVRLQTHYCCIGDGKKVFIKKGFLIKGNCNNRGLIVPE
cHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHHHHHHHccEEEcccccccccccccccccccEEEccccccccccccc
*FYRASVVSLEKIPLRVKAIHIVNQPFYFNALYAIFKPFLKQKLRRRNVVRLQTHYCCIGDGKKVFIKKGFLIKGNCNNRGLI***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYRASVVSLEKIPLRVKAIHIVNQPFYFNALYAIFKPFLKQKLRRRNVVRLQTHYCCIGDGKKVFIKKGFLIKGNCNNRGLIVPE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Clavesin-2 Required for normal morphology of late endosomes and/or lysosomes in neurons (By similarity). Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).confidentQ5SYC1
Clavesin-2 Required for normal morphology of late endosomes and/or lysosomes in neurons. Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).confidentA6JUQ6
Clavesin-2 Required for normal morphology of late endosomes and/or lysosomes in neurons. Binds phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).confidentQ5SPP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044297 [CC]cell bodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0080025 [MF]phosphatidylinositol-3,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005502 [MF]11-cis retinal bindingprobableGO:0019840, GO:0008289, GO:0019842, GO:0036094, GO:0003674, GO:0005488, GO:0005501, GO:0016918
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030136 [CC]clathrin-coated vesicleprobableGO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HX3, chain A
Confidence level:very confident
Coverage over the Query: 9-76
View the alignment between query and template
View the model in PyMOL