BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2064
         (221 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HPQ|C Chain C, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
 pdb|4HPQ|F Chain F, Crystal Structure Of The Atg17-Atg31-Atg29 Complex
          Length = 413

 Score = 31.2 bits (69), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 116 SIDECDTELVVRHGSTLGTFCANTSSYVLDSKEVEV 151
            +D    E+  +H S LG F +  SS++LDSK  E+
Sbjct: 105 KLDNITNEIDQQHNSKLGDFISRDSSHILDSKLNEI 140


>pdb|1F1S|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate
           Lyase At 2.1 Angstrom Resolution.
 pdb|1I8Q|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate
           Lyase Complexed With Enzyme Product, Unsaturated
           Disaccharide Hyaluronan
 pdb|1LXM|A Chain A, Crystal Structure Of Streptococcus Agalactiae Hyaluronate
           Lyase Complexed With Hexasaccharide Unit Of Hyaluronan
          Length = 814

 Score = 27.3 bits (59), Expect = 7.4,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 12  DMTKEAFLSPLLNFFMDGLAAIIPCPRENIYLFSIQDDTDVTSRILNVSF 61
           D T  A+     N  +DGL  ++P  +E  Y  S Q + D+  + +N SF
Sbjct: 308 DHTNVAYTGAYGNVLIDGLTQLLPIIQETDYKISNQ-ELDMVYKWINQSF 356


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,992,930
Number of Sequences: 62578
Number of extensions: 220452
Number of successful extensions: 526
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 523
Number of HSP's gapped (non-prelim): 4
length of query: 221
length of database: 14,973,337
effective HSP length: 95
effective length of query: 126
effective length of database: 9,028,427
effective search space: 1137581802
effective search space used: 1137581802
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 49 (23.5 bits)