BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2067
         (225 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4ANI|A Chain A, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|B Chain B, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|E Chain E, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
 pdb|4ANI|F Chain F, Structural Basis For The Intermolecular Communication
           Between Dnak And Grpe In The Dnak Chaperone System From
           Geobacillus Kaustophilus Hta426
          Length = 213

 Score = 45.4 bits (106), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/93 (33%), Positives = 47/93 (50%), Gaps = 6/93 (6%)

Query: 74  EELEDLKKQIEALNEKNSDLLDKYKRALADGENARQRFNKQLEESKLYGIQSFCKDLLDI 133
           EEL   K QI  L  K S++  +Y R  AD EN R+R  +++E ++ Y  QS   DLL +
Sbjct: 59  EELAAAKAQIAELEAKLSEMEHRYLRLYADFENFRRRTRQEMEAAEKYRAQSLASDLLPV 118

Query: 134 ADTLSLANESVPKEEVKDSNPHLKSLYEGLLMT 166
            D    A       +++  N   KS+ +G+ M 
Sbjct: 119 LDNFERAL------KIETDNEQAKSILQGMEMV 145


>pdb|3A6M|A Chain A, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
 pdb|3A6M|B Chain B, Crystal Structure Of Grpe From Thermus Thermophilus Hb8
          Length = 177

 Score = 35.4 bits (80), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%)

Query: 72  IKEELEDLKKQIEALNEKNSDLLDKYKRALADGENARQRFNKQLEESKLYGIQSFCKDLL 131
           + +E + L+++++A  E+   L DKY R LAD +N R+R  ++L+  +  G+    + LL
Sbjct: 17  VGQEAQALEERLKAAEEELKGLKDKYLRLLADFDNYRKRMEEELKAREREGVLKALRALL 76

Query: 132 DIADTLSLANE 142
            + D L  A E
Sbjct: 77  PVLDDLDRALE 87


>pdb|1DKG|A Chain A, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
 pdb|1DKG|B Chain B, Crystal Structure Of The Nucleotide Exchange Factor Grpe
           Bound To The Atpase Domain Of The Molecular Chaperone
           Dnak
          Length = 197

 Score = 35.0 bits (79), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 51/99 (51%), Gaps = 9/99 (9%)

Query: 68  VDPKIKEELEDLKKQIEALNEKNSDLLDKYKRALADGENARQRFNKQLEESKLYGIQSFC 127
           VDP+  E++ +L+ Q   L E  +   D   R  A+ EN R+R    +E++  + ++ F 
Sbjct: 37  VDPR-DEKVANLEAQ---LAEAQTRERDGILRVKAEMENLRRRTELDIEKAHKFALEKFI 92

Query: 128 KDLLDIADTLSLANESVPKEEVKDSNPHLKSLYEGLLMT 166
            +LL + D+L  A E   K     +NP + ++ E + +T
Sbjct: 93  NELLPVIDSLDRALEVADK-----ANPDMSAMVEDIELT 126


>pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The
           Ligand Lactoylglutathione
 pdb|1AXD|B Chain B, Structure Of Glutathione S-transferase-i Bound With The
           Ligand Lactoylglutathione
          Length = 209

 Score = 31.6 bits (70), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 109 QRFNKQLE--ESKLYGIQSFCKDLLDIAD----TLSLANESVPKEEVKDSNPHLKSLYEG 162
           ++  K LE  E++L   +    D L +AD    +++L   + P   V D+ PH+K+ + G
Sbjct: 136 EKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSG 195

Query: 163 LL 164
           L+
Sbjct: 196 LM 197


>pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With
           Atrazine Glutathione Conjugate
 pdb|1BYE|B Chain B, Glutathione S-Transferase I From Mais In Complex With
           Atrazine Glutathione Conjugate
 pdb|1BYE|C Chain C, Glutathione S-Transferase I From Mais In Complex With
           Atrazine Glutathione Conjugate
 pdb|1BYE|D Chain D, Glutathione S-Transferase I From Mais In Complex With
           Atrazine Glutathione Conjugate
          Length = 213

 Score = 31.6 bits (70), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 33/62 (53%), Gaps = 6/62 (9%)

Query: 109 QRFNKQLE--ESKLYGIQSFCKDLLDIAD----TLSLANESVPKEEVKDSNPHLKSLYEG 162
           ++  K LE  E++L   +    D L +AD    +++L   + P   V D+ PH+K+ + G
Sbjct: 136 EKLKKVLEVYEARLTKCKYLAGDFLSLADLNHVSVTLCLFATPYASVLDAYPHVKAWWSG 195

Query: 163 LL 164
           L+
Sbjct: 196 LM 197


>pdb|2XAF|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With
           Para-Bromo- (+)-Cis-2-Phenylcyclopropyl-1-Amine
 pdb|2XAG|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With
           Para-Bromo- (-)-Trans-2-Phenylcyclopropyl-1-Amine
 pdb|2XAH|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With (+)-
           Trans-2-Phenylcyclopropyl-1-Amine
 pdb|2XAJ|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With
           (-)-Trans- 2-Phenylcyclopropyl-1-Amine
 pdb|2XAQ|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With A
           Tranylcypromine Derivative (Mc2584, 13b)
 pdb|2XAS|A Chain A, Crystal Structure Of Lsd1-Corest In Complex With A
           Tranylcypromine Derivative (Mc2580, 14e)
          Length = 852

 Score = 30.0 bits (66), Expect = 0.99,   Method: Composition-based stats.
 Identities = 24/84 (28%), Positives = 45/84 (53%), Gaps = 4/84 (4%)

Query: 71  KIKEELEDLKKQIEALNEKNSDLLDKYKRALADGENARQRFNKQLEESKLYGIQSFCKDL 130
           K +EEL++L  ++  L EK  +L  +YK A ++ +  R    + L +SK   + + CK+ 
Sbjct: 436 KTQEELKELLNKMVNLKEKIKELHQQYKEA-SEVKPPRDITAEFLVKSKHRDLTALCKEY 494

Query: 131 LDIADTLSLANESVPKEEVKDSNP 154
            ++A+T     E + + E   +NP
Sbjct: 495 DELAETQGKLEEKLQELE---ANP 515


>pdb|1P85|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
           State Of E. Coli 70s Ribosome
 pdb|1P86|F Chain F, Real Space Refined Coordinates Of The 50s Subunit Fitted
           Into The Low Resolution Cryo-Em Map Of The
           Initiation-Like State Of E. Coli 70s Ribosome
 pdb|2AW4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2AWB|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli At 3.5 A Resolution. This File Contains
           The 50s Subunit Of The Second 70s Ribosome. The Entire
           Crystal Structure Contains Two 70s Ribosomes And Is
           Described In Remark 400.
 pdb|1VS6|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|1VS8|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With The Antibiotic
           Kasugamyin At 3.5a Resolution. This File Contains The
           50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2GYA|F Chain F, Structure Of The 50s Subunit Of A Pre-Translocational E.
           Coli Ribosome Obtained By Fitting Atomic Models For Rna
           And Protein Components Into Cryo-Em Map Emd-1056
 pdb|2GYC|F Chain F, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
           Ribosome Complex Obtained By Fitting Atomic Models For
           Rna And Protein Components Into Cryo-Em Map Emd-1143
 pdb|2I2T|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2I2V|H Chain H, Crystal Structure Of Ribosome With Messenger Rna And The
           Anticodon Stem-Loop Of P-Site Trna. This File Contains
           The 50s Subunit Of One 70s Ribosome. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2J28|H Chain H, Model Of E. Coli Srp Bound To 70s Rncs
 pdb|2QOV|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The First 70s Ribosome.
           The Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QOX|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin. This
           File Contains The 50s Subunit Of The Second 70s
           Ribosome. The Entire Crystal Structure Contains Two 70s
           Ribosomes.
 pdb|2QOZ|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QP1|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Spectinomycin And
           Neomycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Neomycin Bound. The Entire
           Crystal Structure Contains Two 70s Ribosomes.
 pdb|2QAM|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Neomycin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QAO|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Neomycin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Neomycin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBA|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The First 70s Ribosome, With
           Gentamicin Bound. The Entire Crystal Structure Contains
           Two 70s Ribosomes And Is Described In Remark 400.
 pdb|2QBC|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin. This File
           Contains The 50s Subunit Of The Second 70s Ribosome,
           With Gentamicin Bound. The Entire Crystal Structure
           Contains Two 70s Ribosomes And Is Described In Remark
           400.
 pdb|2QBE|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           First 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBG|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Ribosome Recycling
           Factor (Rrf). This File Contains The 50s Subunit Of The
           Second 70s Ribosome, With Rrf Bound. The Entire Crystal
           Structure Contains Two 70s Ribosomes And Is Described In
           Remark 400.
 pdb|2QBI|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The First 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2QBK|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Gentamicin And Ribosome
           Recycling Factor (Rrf). This File Contains The 50s
           Subunit Of The Second 70s Ribosome, With Gentamicin And
           Rrf Bound. The Entire Crystal Structure Contains Two 70s
           Ribosomes And Is Described In Remark 400.
 pdb|2Z4L|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The First 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2Z4N|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Paromomycin And
           Ribosome Recycling Factor (Rrf). This File Contains The
           50s Subunit Of The Second 70s Ribosome, With Paromomycin
           And Rrf Bound. The Entire Crystal Structure Contains Two
           70s Ribosomes And Is Described In Remark 400.
 pdb|2VHM|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome (Part 1 Of 4)
 pdb|2VHN|H Chain H, Structure Of Pdf Binding Helix In Complex With The
           Ribosome. (Part 2 Of 4)
 pdb|2RDO|H Chain H, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
 pdb|3DF2|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The First 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3DF4|H Chain H, Crystal Structure Of The Bacterial Ribosome From
           Escherichia Coli In Complex With Hygromycin B. This File
           Contains The 50s Subunit Of The Second 70s Ribosome. The
           Entire Crystal Structure Contains Two 70s Ribosomes.
 pdb|3BBX|H Chain H, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
           Map 50s.Nc-Trna.Hsp15 Complex
 pdb|3FIK|H Chain H, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
           Consists Of The 50s Subunit.
 pdb|3E1B|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Pre-Accommodation State
 pdb|3E1D|4 Chain 4, Structure Of The 50s Subunit Of E. Coli Ribosome In
           Post-Accommodation State
 pdb|3I1N|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1P|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1R|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I1T|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I20|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3I22|H Chain H, Crystal Structure Of The E. Coli 70s Ribosome In An
           Intermediate State Of Ratcheting
 pdb|3KCR|H Chain H, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
           Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
           In Pdb Entry 3kc4
 pdb|2WWQ|H Chain H, E.Coli 70s Ribosome Stalled During Translation Of Tnac
           Leader Peptide. This File Contains The 50s, The P-Site
           Trna And The Tnac Leader Peptide (Part 2 Of 2).
 pdb|1VT2|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3ORB|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Cem-101. This File Contains The 50s Subunit Of The First
           70s Ribosome Bound To Cem-101.
 pdb|3OFQ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OFR|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Erythromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Erthromycin Bound.
 pdb|3OFC|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The First 70s Ribosome With Chloramphenicol Bound.
 pdb|3OFD|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Chloramphenicol. This File Contains The 50s Subunit Of
           The Second 70s Ribosome.
 pdb|3OFZ|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome Bound To Clindamycin.
 pdb|3OG0|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Clindamycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAS|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           Second 70s Ribosome.
 pdb|3OAT|H Chain H, Crystal Structure Of The E. Coli Ribosome Bound To
           Telithromycin. This File Contains The 50s Subunit Of The
           First 70s Ribosome With Telithromycin Bound.
 pdb|3IZT|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A
           Near-Cognate Codon.
 pdb|3IZU|I Chain I, Structural Insights Into Cognate Vs. Near-Cognate
           Discrimination During Decoding. This Entry Contains The
           Large Subunit Of A Ribosome Programmed With A Cognate
           Codon
 pdb|3J01|H Chain H, Structure Of The Ribosome-Secye Complex In The Membrane
           Environment
 pdb|3R8S|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3R8T|H Chain H, Structures Of The Bacterial Ribosome In Classical And
           Hybrid States Of Trna Binding
 pdb|3J0T|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class2 Of The Six
           Classes)
 pdb|3J0W|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4a Of The Six
           Classes)
 pdb|3J0Y|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 4b Of The Six
           Classes)
 pdb|3J11|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 3 Of The Six
           Classes)
 pdb|3J12|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 5 Of The Six
           Classes)
 pdb|3J14|I Chain I, Structural Characterization Of Mrna-Trna Translocation
           Intermediates (50s Ribosome Of Class 6 Of The Six
           Classes)
 pdb|3J19|H Chain H, Structure Of The Bacterial Ribosome Complexed By
           Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
           (50s Subunit)
 pdb|4GAR|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
 pdb|4GAU|H Chain H, Allosteric Control Of The Ribosome By Small-Molecule
           Antibiotics
          Length = 149

 Score = 29.3 bits (64), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 13/91 (14%)

Query: 80  KKQIEALNEKNSDLLDKYKRALADGENARQRFN---------KQLEESKLYGIQSFCKDL 130
           KK IE    + ++L  K    LA      ++ N         K  +E KL+G        
Sbjct: 41  KKNIEFFEARRAELEAKLAEVLAAANARAEKINALETVTIASKAGDEGKLFG----SIGT 96

Query: 131 LDIADTLSLANESVPKEEVKDSNPHLKSLYE 161
            DIAD ++ A   V K EV+  N  L++  E
Sbjct: 97  RDIADAVTAAGVEVAKSEVRLPNGVLRTTGE 127


>pdb|2E0Z|A Chain A, Crystal Structure Of Virus-Like Particle From Pyrococcus
           Furiosus
 pdb|2E0Z|B Chain B, Crystal Structure Of Virus-Like Particle From Pyrococcus
           Furiosus
 pdb|2E0Z|C Chain C, Crystal Structure Of Virus-Like Particle From Pyrococcus
           Furiosus
          Length = 345

 Score = 27.3 bits (59), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 88  EKNSDLLDKYKRALADGENARQRFNKQLEESKLYGIQSFCKDLLDIADTLSLANE 142
           E N +  +K + AL DG N  +   K L  +++ G QSF  D++   D + +  +
Sbjct: 107 ESNVEYFEKLRSALLDGVNKGRSLLKHLPVTRIEG-QSFRVDIIKFEDGVRVVKQ 160


>pdb|3H32|B Chain B, Crystal Structure Of D-Dimer From Human Fibrin Complexed
           With Gly-His- Arg-Pro-Tyr-Amide
 pdb|3H32|E Chain E, Crystal Structure Of D-Dimer From Human Fibrin Complexed
           With Gly-His- Arg-Pro-Tyr-Amide
          Length = 458

 Score = 27.3 bits (59), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 72  IKEELEDLKKQIEALNEKNS----------DLLDKYKRALADGENARQRFNKQLEESKLY 121
           I+  +++L   +EA+++ +S          DL  K ++ + D EN    ++ +LE+ +LY
Sbjct: 93  IRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLY 152


>pdb|3GHG|B Chain B, Crystal Structure Of Human Fibrinogen
 pdb|3GHG|E Chain E, Crystal Structure Of Human Fibrinogen
 pdb|3GHG|H Chain H, Crystal Structure Of Human Fibrinogen
 pdb|3GHG|K Chain K, Crystal Structure Of Human Fibrinogen
          Length = 461

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/60 (25%), Positives = 32/60 (53%), Gaps = 10/60 (16%)

Query: 72  IKEELEDLKKQIEALNEKNS----------DLLDKYKRALADGENARQRFNKQLEESKLY 121
           I+  +++L   +EA+++ +S          DL  K ++ + D EN    ++ +LE+ +LY
Sbjct: 93  IRNSVDELNNNVEAVSQTSSSSFQYMYLLKDLWQKRQKQVKDNENVVNEYSSELEKHQLY 152


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.132    0.365 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,367,525
Number of Sequences: 62578
Number of extensions: 186245
Number of successful extensions: 581
Number of sequences better than 100.0: 45
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 41
Number of HSP's that attempted gapping in prelim test: 574
Number of HSP's gapped (non-prelim): 49
length of query: 225
length of database: 14,973,337
effective HSP length: 95
effective length of query: 130
effective length of database: 9,028,427
effective search space: 1173695510
effective search space used: 1173695510
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)