BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2080
         (93 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1IUR|A Chain A, Dnaj Domain Of Human Kiaa0730 Protein
          Length = 88

 Score = 25.8 bits (55), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 3  VSKDMILKLYKALLRESSKFPAYNYRMYFLRRTREKFQSNKNVDNNEQISLLYNEGLKEL 62
          V +  ILK   +++ ++ K P  + R   +RR   K+  +KN +N++  + ++     E+
Sbjct: 9  VPRGSILKEVTSVVEQAWKLPE-SERKKIIRRLYLKWHPDKNPENHDIANEVFKHLQNEI 67

Query: 63 EVLKRQVLISQ 73
            L++Q  + Q
Sbjct: 68 NRLEKQAFLDQ 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.132    0.349 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,303,572
Number of Sequences: 62578
Number of extensions: 72959
Number of successful extensions: 242
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 238
Number of HSP's gapped (non-prelim): 5
length of query: 93
length of database: 14,973,337
effective HSP length: 60
effective length of query: 33
effective length of database: 11,218,657
effective search space: 370215681
effective search space used: 370215681
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)