BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2111
         (63 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LQ5|A Chain A, Nmr Structure Of The Rna Binding Motif 39 (Rbm39) From Mus
           Musculus
          Length = 113

 Score = 36.6 bits (83), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 19/38 (50%)

Query: 16  LHGAWFNSKLVTVKYLRYERYHERFPQAKALVAPLKPS 53
           LHG WF  K++T  Y+    YH  FP +      L PS
Sbjct: 74  LHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPS 111


>pdb|3S6E|A Chain A, Crystal Structure Of A Rna Binding Motif Protein 39
           (Rbm39) From Mus Musculus At 0.95 A Resolution
 pdb|3S6E|B Chain B, Crystal Structure Of A Rna Binding Motif Protein 39
           (Rbm39) From Mus Musculus At 0.95 A Resolution
          Length = 114

 Score = 35.0 bits (79), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 14  RTLHGAWFNSKLVTVKYLRYERYHERFPQAKALVAPLKPS 53
             LHG WF  K +T  Y+    YH  FP +      L PS
Sbjct: 73  NALHGRWFAGKXITAAYVPLPTYHNLFPDSXTATQLLVPS 112


>pdb|4A34|A Chain A, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|B Chain B, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|C Chain C, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|D Chain D, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|E Chain E, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|F Chain F, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|G Chain G, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|H Chain H, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|I Chain I, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|J Chain J, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|K Chain K, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|L Chain L, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|M Chain M, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|N Chain N, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|O Chain O, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|P Chain P, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|Q Chain Q, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|R Chain R, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|S Chain S, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
 pdb|4A34|T Chain T, Crystal Structure Of The Fucose Mutarotase In Complex With
           L-Fucose From Streptococcus Pneumoniae
          Length = 147

 Score = 25.8 bits (55), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 23  SKLVTVKYLRYERYHERFPQAKALVA 48
           + L T+ YLR E ++ER  +A A+VA
Sbjct: 98  TDLKTITYLRREDFYERSKKAYAIVA 123


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.321    0.133    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,905,759
Number of Sequences: 62578
Number of extensions: 54395
Number of successful extensions: 94
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 91
Number of HSP's gapped (non-prelim): 3
length of query: 63
length of database: 14,973,337
effective HSP length: 34
effective length of query: 29
effective length of database: 12,845,685
effective search space: 372524865
effective search space used: 372524865
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)