BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2112
         (336 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1OB8|A Chain A, Holliday Junction Resolving Enzyme
 pdb|1OB8|B Chain B, Holliday Junction Resolving Enzyme
 pdb|1OB9|A Chain A, Holliday Junction Resolving Enzyme
          Length = 135

 Score = 32.0 bits (71), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 28/49 (57%), Gaps = 8/49 (16%)

Query: 23 EGFNAYGIPT--SSVKVCPHIV----DAAPSIDCQSTSENKEVVQVKFH 65
          EGFNA  IPT  SS    P I     +   SI+C+ST ENK  V+VK H
Sbjct: 20 EGFNAVRIPTSNSSPNPLPDIFATKGNTLLSIECKSTWENK--VKVKEH 66


>pdb|2G29|A Chain A, Crystal Structure Of The Periplasmic Nitrate-binding
           Protein Nrta From Synechocystis Pcc 6803
          Length = 417

 Score = 28.9 bits (63), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 41  IVDAAPSI----DCQSTSENKEVVQVKFHDNGTVSYKQERRWYFDSEYSAGSLKDNVTTL 96
           I+D +  I    + Q T E++E++Q  + DN +  YK   +W+       G L  +  T 
Sbjct: 296 IIDRSKGIYNFGNGQETFEDQEIMQKYWVDNASYPYKSHDQWFLTENIRWGYLPASTDTK 355

Query: 97  NAVVVRNGSDQF 108
             V   N  D +
Sbjct: 356 AIVDKVNREDLW 367


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.135    0.420 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 10,922,215
Number of Sequences: 62578
Number of extensions: 478519
Number of successful extensions: 1016
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 1014
Number of HSP's gapped (non-prelim): 9
length of query: 336
length of database: 14,973,337
effective HSP length: 99
effective length of query: 237
effective length of database: 8,778,115
effective search space: 2080413255
effective search space used: 2080413255
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 52 (24.6 bits)