Query         psy2115
Match_columns 77
No_of_seqs    108 out of 410
Neff          4.6 
Searched_HMMs 46136
Date          Sat Aug 17 00:38:27 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2115.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2115hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01130 CD36:  CD36 family;  I  99.9   3E-22 6.6E-27  155.1   7.0   55    1-55     44-98  (467)
  2 KOG3776|consensus               99.8 9.1E-20   2E-24  145.7   6.5   56    1-56     55-110 (507)
  3 cd08519 PBP2_NikA_DppA_OppA_li  40.0      31 0.00066   26.4   2.8   31   34-65    158-189 (469)
  4 cd08518 PBP2_NikA_DppA_OppA_li  39.2      30 0.00065   26.4   2.6   33   33-65    148-181 (464)
  5 cd08510 PBP2_Lactococcal_OppA_  38.4      32  0.0007   26.7   2.7   34   33-66    182-216 (516)
  6 cd08508 PBP2_NikA_DppA_OppA_li  36.0      34 0.00073   26.2   2.4   33   34-66    162-195 (470)
  7 PF14498 Glyco_hyd_65N_2:  Glyc  34.3      23  0.0005   25.2   1.3   23   44-66     29-51  (236)
  8 PF01289 Thiol_cytolysin:  Thio  33.4      48   0.001   27.2   3.0   55   15-71    349-416 (467)
  9 PRK09755 putative ABC transpor  32.8      40 0.00087   26.6   2.4   35   32-66    206-242 (535)
 10 cd08507 PBP2_SgrR_like The C-t  32.7      42  0.0009   25.7   2.5   32   34-66    157-189 (448)
 11 PRK15104 oligopeptide ABC tran  32.7      41  0.0009   26.6   2.5   34   32-65    211-246 (543)
 12 cd08513 PBP2_thermophilic_Hb8_  32.3      48   0.001   25.2   2.7   33   33-65    159-192 (482)
 13 cd08514 PBP2_AppA_like The sub  32.2      41 0.00089   25.6   2.4   33   33-65    160-193 (483)
 14 cd08512 PBP2_NikA_DppA_OppA_li  31.5      47   0.001   25.2   2.6   33   34-66    171-204 (476)
 15 KOG2577|consensus               31.2      37 0.00079   27.1   2.0   33   11-58    105-138 (354)
 16 cd08494 PBP2_NikA_DppA_OppA_li  29.6      55  0.0012   24.5   2.6   32   34-65    153-185 (448)
 17 cd08501 PBP2_Lpqw The substrat  29.2      62  0.0013   24.7   2.9   35   32-66    163-200 (486)
 18 cd08516 PBP2_NikA_DppA_OppA_li  29.2      56  0.0012   24.6   2.6   34   33-66    151-186 (457)
 19 cd08506 PBP2_clavulanate_OppA2  28.9      56  0.0012   24.8   2.6   27   33-59    143-169 (466)
 20 cd08515 PBP2_NikA_DppA_OppA_li  28.5      55  0.0012   24.9   2.5   33   33-65    159-192 (460)
 21 cd08520 PBP2_NikA_DppA_OppA_li  28.1      64  0.0014   24.6   2.8   35   32-66    157-193 (468)
 22 cd08498 PBP2_NikA_DppA_OppA_li  28.0      59  0.0013   24.9   2.6   33   34-66    156-189 (481)
 23 cd08505 PBP2_NikA_DppA_OppA_li  27.9      53  0.0011   26.0   2.4   26   34-59    168-193 (528)
 24 cd08499 PBP2_Ylib_like The sub  27.2      55  0.0012   24.9   2.3   33   33-65    155-188 (474)
 25 cd08496 PBP2_NikA_DppA_OppA_li  26.8      65  0.0014   24.4   2.6   32   34-65    153-186 (454)
 26 cd08490 PBP2_NikA_DppA_OppA_li  26.4      62  0.0013   24.4   2.4   33   34-66    148-181 (470)
 27 cd08495 PBP2_NikA_DppA_OppA_li  25.2      71  0.0015   24.4   2.6   33   34-66    168-202 (482)
 28 smart00879 Brix Brix domain. T  24.9   1E+02  0.0022   20.3   3.1   10   28-37    167-176 (180)
 29 TIGR02294 nickel_nikA nickel A  24.9      60  0.0013   25.1   2.2   33   33-65    162-195 (500)
 30 cd08489 PBP2_NikA The substrat  24.3      76  0.0017   24.2   2.6   33   33-65    155-188 (488)
 31 PF02056 Glyco_hydro_4:  Family  24.2      49  0.0011   23.6   1.5   13   12-24    138-150 (183)
 32 PF07565 Band_3_cyto:  Band 3 c  24.1      27 0.00059   26.1   0.2   17   52-69      4-20  (257)
 33 PF09200 Monellin:  Monellin;    23.6      64  0.0014   18.5   1.6   11   31-41      4-14  (43)
 34 PHA02757 hypothetical protein;  22.7      62  0.0013   20.4   1.5   20   22-41      4-28  (75)
 35 cd00995 PBP2_NikA_DppA_OppA_li  22.6      77  0.0017   23.6   2.3   33   33-65    155-189 (466)
 36 cd08493 PBP2_DppA_like The sub  22.6      83  0.0018   24.0   2.5   32   34-65    173-205 (482)
 37 PF07619 DUF1581:  Protein of u  22.5      42 0.00091   21.8   0.8   16   57-72     37-52  (84)
 38 PRK15413 glutathione ABC trans  22.1      93   0.002   24.3   2.7   33   34-66    184-218 (512)
 39 cd08517 PBP2_NikA_DppA_OppA_li  21.5      86  0.0019   23.7   2.4   33   33-65    158-192 (480)
 40 cd08500 PBP2_NikA_DppA_OppA_li  21.1      89  0.0019   24.3   2.5   33   33-65    148-187 (499)
 41 PF00496 SBP_bac_5:  Bacterial   20.8      58  0.0013   23.5   1.3   39   30-68    114-154 (374)
 42 cd08502 PBP2_NikA_DppA_OppA_li  20.1      98  0.0021   23.7   2.5   27   32-58    155-181 (472)
 43 PRK15109 antimicrobial peptide  20.1      97  0.0021   24.7   2.5   31   34-64    214-245 (547)

No 1  
>PF01130 CD36:  CD36 family;  InterPro: IPR002159 CD36 is a transmembrane, highly glycosylated, 88kDa glycoprotein expressed by monocytes, macrophages, platelets, microvascular endothelial cells and adipose tissues. Platelet glycoprotein IV (GP IV)(GPIIIb) (CD36 antigen) is also called GPIV, OKM5-antigen or PASIV. CD36 recognises oxidized low density lipoprotein, long chain fatty acids, anionic phospholipids, collagen types I, IV and V, thrombospondin (TSP) and Plasmodium falciparum infected erythrocytes. The recognition of apoptotic neutrophils is in co-operation with TSP and avb3. Other ligands may still be unknown. CD36 is a scavenger receptor for oxidized LDL and shed photoreceptor outer segments and in recognition and phagocytosis of apoptotic cells and is the cell adhesion molecule in platelet adhesion and aggregation, platelet-monocyte and platelet-tumor cell interaction []. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0007155 cell adhesion, 0016020 membrane
Probab=99.86  E-value=3e-22  Score=155.09  Aligned_cols=55  Identities=27%  Similarity=0.345  Sum_probs=53.2

Q ss_pred             CccCCCcceEEEEEEeccChhhhhCCCCCcceEEeCCeEEEEeeeeeceEEcCCc
Q psy2115           1 MEINTNPKKLRGHKFNWTNPEDIRNNETKPNFVEMGPYRFHYGDKYKSQKTSGPQ   55 (77)
Q Consensus         1 ~~~pP~p~~~~~y~FNvTNpeevl~G~~kP~v~EvGPYvY~E~~~K~nvtf~~~~   55 (77)
                      |++||+|++++||+||||||+||++|++||+|+|+|||+|+|+++|.|++|++++
T Consensus        44 W~~~p~p~~~~~y~fNvTNp~ev~~~g~kP~~~EvGPY~y~e~~~k~nv~~~~~~   98 (467)
T PF01130_consen   44 WKKPPVPIYFKFYFFNVTNPEEVLNGGAKPNVQEVGPYVYREYREKVNVTFNDNG   98 (467)
T ss_pred             hhcCCCccEEEEEEEeccCHHHHhCcCCCceEEEeCCEEEEeeeeeeeeEEcCCC
Confidence            8999999999999999999999999668999999999999999999999999997


No 2  
>KOG3776|consensus
Probab=99.79  E-value=9.1e-20  Score=145.74  Aligned_cols=56  Identities=25%  Similarity=0.307  Sum_probs=54.2

Q ss_pred             CccCCCcceEEEEEEeccChhhhhCCCCCcceEEeCCeEEEEeeeeeceEEcCCcc
Q psy2115           1 MEINTNPKKLRGHKFNWTNPEDIRNNETKPNFVEMGPYRFHYGDKYKSQKTSGPQK   56 (77)
Q Consensus         1 ~~~pP~p~~~~~y~FNvTNpeevl~G~~kP~v~EvGPYvY~E~~~K~nvtf~~~~~   56 (77)
                      |.+||++++++||+|||||||||++|++||+|+|+|||+|+|..+|+|+.|++|++
T Consensus        55 W~~pp~~~~~~~yiFNvTNpde~~~~~~kp~v~EvGPyvy~E~~~K~~~~f~~n~t  110 (507)
T KOG3776|consen   55 WLNPPYPIYLNFYIFNVTNPDEFLSGGAKPNVQEVGPYVYREIEQKVNIDFNENNT  110 (507)
T ss_pred             hhcCCCccEEEEEEEecCCHHHhhCcCCCCceEeeCCeEEEEEecccceeeccCCc
Confidence            89999999999999999999999998789999999999999999999999999977


No 3  
>cd08519 PBP2_NikA_DppA_OppA_like_20 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=40.01  E-value=31  Score=26.39  Aligned_cols=31  Identities=19%  Similarity=0.398  Sum_probs=24.7

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      =-|||...++.. ..+++..++. |.+.|++++
T Consensus       158 gsGPy~~~~~~~-~~~~l~~n~~y~~~~p~~~~  189 (469)
T cd08519         158 GTGPYKLKSFRS-ESIRLEPNPDYWGEKPKNDG  189 (469)
T ss_pred             ccCCEEEEEeec-cEEEEEeChhhcCCCCCcce
Confidence            479999999887 7888888887 666666664


No 4  
>cd08518 PBP2_NikA_DppA_OppA_like_19 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=39.24  E-value=30  Score=26.37  Aligned_cols=33  Identities=21%  Similarity=0.417  Sum_probs=24.7

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .=-|||...+......+++..++. |.+.|++++
T Consensus       148 vGtGPy~l~~~~~~~~i~l~rn~~Yw~~~p~~d~  181 (464)
T cd08518         148 IGTGPYKLVQWDKGQQVIFEANPDYYGGKPKFKK  181 (464)
T ss_pred             cccCCeEEEEeccCceEEEEECccccCCCCCcCE
Confidence            357999999887767788888877 555566664


No 5  
>cd08510 PBP2_Lactococcal_OppA_like The substrate binding component of an ABC-type lactococcal OppA-like transport system contains. This family represents the substrate binding domain of an ATP-binding cassette (ABC)-type oligopeptide import system from Lactococcus lactis and other gram-positive bacteria, as well as its closet homologs from gram-negative bacteria. Oligopeptide-binding protein (OppA) from Lactococcus lactis can bind peptides of length from 4 to at least 35 residues without sequence preference.  The oligopeptide import system OppABCDEF is consisting of five subunits:  two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in sev
Probab=38.44  E-value=32  Score=26.72  Aligned_cols=34  Identities=21%  Similarity=0.400  Sum_probs=25.3

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      .=-|||...+......+++..++. |.+.|++++.
T Consensus       182 vGtGPy~l~~~~~~~~~~l~rn~~yw~~~p~~d~I  216 (516)
T cd08510         182 LGFGPYKVKKIVPGESVEYVPNEYYWRGKPKLDKI  216 (516)
T ss_pred             CccCCeEEEEeccCceEEEEeCccccCCCCcccEE
Confidence            357999999887666788887766 6677777744


No 6  
>cd08508 PBP2_NikA_DppA_OppA_like_1 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=35.98  E-value=34  Score=26.23  Aligned_cols=33  Identities=15%  Similarity=0.338  Sum_probs=23.8

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      =-|||...+......+++..++. |.+.|++++.
T Consensus       162 gsGPy~l~~~~~~~~~~l~rn~~Yw~~~~~~d~i  195 (470)
T cd08508         162 GTGPFEVEEHSPQQGVTLVANDGYFRGAPKLERI  195 (470)
T ss_pred             cCCCcEEEEecCCCeEEEEeCccccCCCCCCCeE
Confidence            58999999877656677877777 5555666643


No 7  
>PF14498 Glyco_hyd_65N_2:  Glycosyl hydrolase family 65, N-terminal domain; PDB: 2EAE_A 2EAB_B 2EAC_A 2EAD_B 2RDY_A.
Probab=34.31  E-value=23  Score=25.22  Aligned_cols=23  Identities=22%  Similarity=0.375  Sum_probs=17.7

Q ss_pred             eeeeceEEcCCcccCCCCeeecc
Q psy2115          44 DKYKSQKTSGPQKWSGGPHVARR   66 (77)
Q Consensus        44 ~~K~nvtf~~~~~~~~~~~~~~~   66 (77)
                      -.++-|.+|++.+||++|+-...
T Consensus        29 ~~~E~i~lNe~tlWsg~p~~~~~   51 (236)
T PF14498_consen   29 PAKERIQLNEDTLWSGGPSDRTP   51 (236)
T ss_dssp             SSEEEEEEEETT-BSSSTTSSSS
T ss_pred             CCeEEEEEcchheECCCCccccC
Confidence            34778999999999999986643


No 8  
>PF01289 Thiol_cytolysin:  Thiol-activated cytolysin;  InterPro: IPR001869 Thiol-activated cytolysins [] are toxins produced by a variety of Gram-positive bacteria and are characterised by their ability to lyse cholesterol-containing membranes, their reversible inactivation by oxidation and their capacity to bind to cholesterol. All these proteins contain a single cysteine residue, located in their C-terminal section, which has been shown [] to be essential for the binding to cholesterol.; GO: 0015485 cholesterol binding, 0009405 pathogenesis; PDB: 1S3R_A 1M3I_A 1PFO_A 1M3J_B 3CQF_A 3HVN_A.
Probab=33.41  E-value=48  Score=27.17  Aligned_cols=55  Identities=22%  Similarity=0.399  Sum_probs=36.4

Q ss_pred             EeccChhhhhCCCCCcceEEeCCeEEEEeeeeeceEEcCCcc-------cCCC-----Ceee-cccccCC
Q psy2115          15 FNWTNPEDIRNNETKPNFVEMGPYRFHYGDKYKSQKTSGPQK-------WSGG-----PHVA-RRPLVGN   71 (77)
Q Consensus        15 FNvTNpeevl~G~~kP~v~EvGPYvY~E~~~K~nvtf~~~~~-------~~~~-----~~~~-~~~~~~~   71 (77)
                      |-.|...+..+|  +..+.-.|-|+.+-...=+++++.++-+       |+++     +||. .+||-||
T Consensus       349 YieT~~t~y~~~--~i~l~h~g~yva~~~~~w~e~~yd~~g~~~~~~~~w~~~~~~~ta~~~~~i~~~~n  416 (467)
T PF01289_consen  349 YIETTSTEYTNG--KITLDHSGAYVAQFNVTWDEVSYDENGNEVITHKTWEGNGKDRTAHFSTVIPLPGN  416 (467)
T ss_dssp             EEEEEEEEEE-E--EEEEEEECSSEEEEEEEEEEEEE-TTS-EEEEEEE-TTTT-EEESSEEEEEEE-TT
T ss_pred             EEEEeeeeccCc--cEEEecCCcEEEEEEEEeeecccCCCCCEEeeeeccCCCCccccccceEEEecCCC
Confidence            346666666665  8899999999988666667777665443       8775     6765 7777776


No 9  
>PRK09755 putative ABC transporter periplasmic-binding protein; Provisional
Probab=32.76  E-value=40  Score=26.64  Aligned_cols=35  Identities=9%  Similarity=0.050  Sum_probs=26.7

Q ss_pred             eEEeCCeEEEEeeeeeceEEcCCccc-CCC-Ceeecc
Q psy2115          32 FVEMGPYRFHYGDKYKSQKTSGPQKW-SGG-PHVARR   66 (77)
Q Consensus        32 v~EvGPYvY~E~~~K~nvtf~~~~~~-~~~-~~~~~~   66 (77)
                      ..--|||...++.....+++..++.| .++ |++++.
T Consensus       206 ~vGtGPy~l~~~~~~~~i~l~rn~~Yw~~~~p~~d~I  242 (535)
T PRK09755        206 MVYNGAFVLDQWVVNEKITARKNPKYRDAQHTVLQQV  242 (535)
T ss_pred             eeecCCeEEeeeccCCeEEEeeCccccCCCCCCCCeE
Confidence            45689999999887778999998884 433 677754


No 10 
>cd08507 PBP2_SgrR_like The C-terminal solute-binding domain of DNA-binding transcriptional regulator SgrR is related to the ABC-type oligopeptide-binding proteins and contains the type 2 periplasmic-binding fold. A novel family of SgrR transcriptional regulator contains a two-domain structure with an N terminal DNA-binding domain of the winged helix family and a C-terminal solute-binding domain. The C-terminal domain shows strong homology with the ABC-type oligopeptide-binding protein family, a member of the type 2 periplasmic-binding fold protein (PBP2) superfamily that also includes the C-terminal substrate-binding domain of LysR-type transcriptional regulators. SgrR (SugaR transport-related Regulator) is negatively autoregulated and activates transcription of divergent operon SgrS, which encodes a small RNA required for recovery from glucose-phosphate stress.  Hence, the small RNA SgrS and SgrR, the transcription factor that controls sgrS expression, are both required for recovery f
Probab=32.71  E-value=42  Score=25.68  Aligned_cols=32  Identities=16%  Similarity=0.211  Sum_probs=23.4

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      =-|||...+.. +..+++..++. |.+.|++++.
T Consensus       157 gtGPy~l~~~~-~~~i~l~rn~~Yw~~~p~~~~v  189 (448)
T cd08507         157 GTGPFRVVENT-DKRLVLEAFDDYFGERPLLDEV  189 (448)
T ss_pred             ccCCeEEEEcc-CCeEEEEECCCccCCCCCCCEE
Confidence            57999999875 56788888887 4445666643


No 11 
>PRK15104 oligopeptide ABC transporter substrate-binding protein OppA; Provisional
Probab=32.69  E-value=41  Score=26.55  Aligned_cols=34  Identities=12%  Similarity=0.214  Sum_probs=25.4

Q ss_pred             eEEeCCeEEEEeeeeeceEEcCCcc-cCCC-Ceeec
Q psy2115          32 FVEMGPYRFHYGDKYKSQKTSGPQK-WSGG-PHVAR   65 (77)
Q Consensus        32 v~EvGPYvY~E~~~K~nvtf~~~~~-~~~~-~~~~~   65 (77)
                      ..--|||...++.....+++..++. |.++ |++++
T Consensus       211 pvGtGPy~~~~~~~~~~i~l~rn~~Yw~~~~p~~d~  246 (543)
T PRK15104        211 IVTNGAYKLKDWVVNERIVLERNPTYWDNAKTVINQ  246 (543)
T ss_pred             eeecCCeEEEEeccCCeEEEEeCccccCCCCccCCe
Confidence            3468999999888777788888887 5443 66664


No 12 
>cd08513 PBP2_thermophilic_Hb8_like The substrate-binding component of ABC-type thermophilic oligopeptide-binding protein Hb8-like import systems, contains the type 2 periplasmic binding fold. This family includes the substrate-binding domain of an ABC-type oligopeptide-binding protein Hb8 from Thermus thermophilius and its closest homologs from other bacteria. The structural topology of this substrate-binding domain is similar to those of DppA from Escherichia coli and OppA from Salmonella typhimurium, and thus belongs to the type 2 periplasmic binding fold protein (PBP2) superfamily. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. The type 2 periplasmic binding proteins are soluble ligand-binding components of ABC or tripartite ATP-independent transporter
Probab=32.26  E-value=48  Score=25.22  Aligned_cols=33  Identities=27%  Similarity=0.457  Sum_probs=23.7

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .=-|||...+......+++..+.. |.+.|+++.
T Consensus       159 vgtGPy~l~~~~~~~~~~l~~n~~Yw~~~p~~d~  192 (482)
T cd08513         159 VGTGPYKLEEFVPGDSIELVRNPNYWGGKPYIDR  192 (482)
T ss_pred             CccCCeEEEEEecCCeEEEEECCccccCCCCcCE
Confidence            357999999887656777777766 665666663


No 13 
>cd08514 PBP2_AppA_like The substrate-binding component of the oligopeptide-binding protein, AppA, from Bacillus subtilis contains the type 2 periplasmic-binding fold. This family represents the substrate-binding domain of the oligopeptide-binding protein, AppA, from Bacillus subtilis and its closest homologs from other bacteria and archaea. Bacillus subtilis has three ABC-type peptide transport systems, a dipeptide-binding protein (DppA) and two oligopeptide-binding proteins (OppA and AppA) with overlapping specificity. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains correspondin
Probab=32.19  E-value=41  Score=25.59  Aligned_cols=33  Identities=18%  Similarity=0.351  Sum_probs=24.3

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .=-|||...++.....+++..++. |.+.+++++
T Consensus       160 vgtGPy~l~~~~~~~~i~l~rn~~Yw~~~~~~d~  193 (483)
T cd08514         160 VGTGPYKLKEWKRGQYIVLEANPDYFLGRPYIDK  193 (483)
T ss_pred             cccCCcEEEEecCCCeEEEEECccccCCCCCCcE
Confidence            468999999887666788888877 554566664


No 14 
>cd08512 PBP2_NikA_DppA_OppA_like_7 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=31.54  E-value=47  Score=25.22  Aligned_cols=33  Identities=24%  Similarity=0.505  Sum_probs=23.9

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      =-|||...+......+++..++. |.+.|++++.
T Consensus       171 gtGPy~l~~~~~~~~~~l~~n~~yw~~~p~~d~i  204 (476)
T cd08512         171 GSGPYKLKSWDPGEEVVLERNDDYWGGAPKLKRV  204 (476)
T ss_pred             CCCCeEEEEEcCCCEEEEEecCcccCCCCCcCEE
Confidence            47999999877656777877776 5556776643


No 15 
>KOG2577|consensus
Probab=31.23  E-value=37  Score=27.12  Aligned_cols=33  Identities=12%  Similarity=0.054  Sum_probs=26.3

Q ss_pred             EEEEEeccChhhhhCC-CCCcceEEeCCeEEEEeeeeeceEEcCCcccC
Q psy2115          11 RGHKFNWTNPEDIRNN-ETKPNFVEMGPYRFHYGDKYKSQKTSGPQKWS   58 (77)
Q Consensus        11 ~~y~FNvTNpeevl~G-~~kP~v~EvGPYvY~E~~~K~nvtf~~~~~~~   58 (77)
                      +=.+|+|||   ||.| +            +.|.+.|.+|.|-+.+..+
T Consensus       105 KRRIYDITN---VLEGI~------------LIeKksKN~IqW~G~~~~~  138 (354)
T KOG2577|consen  105 KRRIYDITN---VLEGIG------------LIEKKSKNNIQWIGGDFNS  138 (354)
T ss_pred             cceeeehhh---hhhccc------------ceeeccccceeeecCCCcc
Confidence            346889999   6777 4            5688999999998887776


No 16 
>cd08494 PBP2_NikA_DppA_OppA_like_6 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=29.60  E-value=55  Score=24.52  Aligned_cols=32  Identities=16%  Similarity=0.348  Sum_probs=22.9

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      =-|||...+......+++..+.. |.+.|+++.
T Consensus       153 gtGPy~l~~~~~~~~i~l~~n~~Y~~~~~~~d~  185 (448)
T cd08494         153 GTGPFTVAAWARGSSITLVRNDDYWGAKPKLDK  185 (448)
T ss_pred             cCCCcEEEEEecCCeEEEEeCCcccCCcCCCCe
Confidence            47999999887766778887766 445555553


No 17 
>cd08501 PBP2_Lpqw The substrate-binding domain of mycobacterial lipoprotein Lpqw contains type 2 periplasmic binding fold. LpqW is one of key players in synthesis and transport of the unique components of the mycobacterial cell wall which is a complex structure rich in two related lipoglycans, the phosphatidylinositol mannosides (PIMs) and lipoarabinomannans (LAMs).  Lpqw is a highly conserved lipoprotein that transport intermediates from a pathway for mature PIMs production into a pathway for LAMs biosynthesis, thus controlling the relative abundance of these two essential components of cell wall.   LpqW is thought to have been adapted by the cell-wall biosynthesis machinery of mycobacteria and other closely related pathogens, evolving to play an important role in PIMs/LAMs biosynthesis.  Most of periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the LpqW protein. The structural topology of these domains is most similar to 
Probab=29.19  E-value=62  Score=24.73  Aligned_cols=35  Identities=17%  Similarity=0.351  Sum_probs=25.2

Q ss_pred             eEEeCCeEEEEeeee-eceEEcCCcc-cCC-CCeeecc
Q psy2115          32 FVEMGPYRFHYGDKY-KSQKTSGPQK-WSG-GPHVARR   66 (77)
Q Consensus        32 v~EvGPYvY~E~~~K-~nvtf~~~~~-~~~-~~~~~~~   66 (77)
                      ..=-|||...+.... ..+++..+.. |.+ .|++++.
T Consensus       163 ~iGtGPy~l~~~~~~~~~~~l~~n~~Yw~~~~p~~d~i  200 (486)
T cd08501         163 PWSAGPYKVESVDRGRGEVTLVRNDRWWGDKPPKLDKI  200 (486)
T ss_pred             cccCCCeEEEEEecCCCeEEeecCCcccCCCCCcccEE
Confidence            345799999988765 6788888777 544 4777643


No 18 
>cd08516 PBP2_NikA_DppA_OppA_like_11 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=29.16  E-value=56  Score=24.57  Aligned_cols=34  Identities=21%  Similarity=0.387  Sum_probs=23.4

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cC-CCCeeecc
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WS-GGPHVARR   66 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~-~~~~~~~~   66 (77)
                      .=-|||...+......+++..++. |. +.|++++.
T Consensus       151 vgtGPy~l~~~~~~~~~~l~~n~~y~~~~~p~~d~i  186 (457)
T cd08516         151 IGTGPFKFASYEPGVSIVLEKNPDYWGKGLPKLDGI  186 (457)
T ss_pred             cccCCeEEEEecCCCEEEEEeCCCccCCCCCCCCeE
Confidence            357999998876555677777666 55 56777643


No 19 
>cd08506 PBP2_clavulanate_OppA2 The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus.  Most of other periplasmic binding proteins are comprised of only two globular subdomains cor
Probab=28.89  E-value=56  Score=24.80  Aligned_cols=27  Identities=26%  Similarity=0.423  Sum_probs=21.5

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcccCC
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQKWSG   59 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~~~~   59 (77)
                      .--|||...+......+++..++-|.+
T Consensus       143 igtGPy~l~~~~~~~~i~l~~n~~y~~  169 (466)
T cd08506         143 VSSGPYKIESYDPGKGLVLVRNPHWDA  169 (466)
T ss_pred             CCCCCeEEEEecCCCeEEEEeCCCCCC
Confidence            446999999888766788888887865


No 20 
>cd08515 PBP2_NikA_DppA_OppA_like_10 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=28.52  E-value=55  Score=24.87  Aligned_cols=33  Identities=21%  Similarity=0.388  Sum_probs=23.2

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .--|||...+......+++..|.- |.+.|+++.
T Consensus       159 igsGPy~l~~~~~~~~~~l~~N~~yw~~~~~~d~  192 (460)
T cd08515         159 VGTGPYKVTEFVPGERVVLEAFDDYWGGKPPIEK  192 (460)
T ss_pred             CCCCCeEEeeeccCCEEEEEECccccCCCCCCCE
Confidence            358999999877656677777665 555666654


No 21 
>cd08520 PBP2_NikA_DppA_OppA_like_21 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=28.15  E-value=64  Score=24.59  Aligned_cols=35  Identities=26%  Similarity=0.474  Sum_probs=24.8

Q ss_pred             eEEeCCeEEEEeeee-eceEEcCCcc-cCCCCeeecc
Q psy2115          32 FVEMGPYRFHYGDKY-KSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        32 v~EvGPYvY~E~~~K-~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      ..--|||...+.... ..+++..++. |.+.|++++.
T Consensus       157 ~vGtGPy~~~~~~~~~~~i~L~rn~~Yw~~~p~~d~i  193 (468)
T cd08520         157 AIGSGPYKLVDYNKEQGTYLYEANEDYWGGKPKVKRL  193 (468)
T ss_pred             ceeeCCeEEEEEecCceEEEEEeCcccccCCCCccEE
Confidence            456899999887664 4677777766 6666766643


No 22 
>cd08498 PBP2_NikA_DppA_OppA_like_2 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=28.04  E-value=59  Score=24.88  Aligned_cols=33  Identities=21%  Similarity=0.424  Sum_probs=23.7

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      =-|||...+......+++..+.- |.+.|+++..
T Consensus       156 gsGPy~l~~~~~~~~i~l~~n~~y~~~~p~~d~I  189 (481)
T cd08498         156 GTGPYKFVSWEPGDRTVLERNDDYWGGKPNWDEV  189 (481)
T ss_pred             cCCCeEEEeeeCCCEEEEEECccccCCCCCcceE
Confidence            47999999887666677777766 5555666643


No 23 
>cd08505 PBP2_NikA_DppA_OppA_like_18 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=27.92  E-value=53  Score=26.02  Aligned_cols=26  Identities=15%  Similarity=0.291  Sum_probs=20.6

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcccCC
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQKWSG   59 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~~~~   59 (77)
                      =-|||...++.....+++..++.|-+
T Consensus       168 gtGPy~l~~~~~~~~~~l~~n~~Y~~  193 (528)
T cd08505         168 GTGPYMLTENNPNSRMVLVRNPNYRG  193 (528)
T ss_pred             cCCCeEEEeecCCCEEEEEecccccc
Confidence            46999999887666788888888654


No 24 
>cd08499 PBP2_Ylib_like The substrate-binding component of an uncharacterized ABC-type peptide import system Ylib contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an uncharacterized ATP-binding cassette (ABC)-type peptide transport system YliB. Although the ligand specificity of Ylib protein is not known, it shares significant sequence similarity to the ABC-type dipeptide and oligopeptide binding proteins. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine.  The PBP2 bind their ligand in the cleft between these domains in a manner resembling
Probab=27.18  E-value=55  Score=24.90  Aligned_cols=33  Identities=24%  Similarity=0.458  Sum_probs=23.7

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .=-|||...+......+++..+.. |.+.|++++
T Consensus       155 vgsGPy~l~~~~~~~~~~l~~n~~Yw~~~~~~~~  188 (474)
T cd08499         155 VGTGPFKFESWTPGDEVTLVKNDDYWGGLPKVDT  188 (474)
T ss_pred             ccCCCceEEeecCCCEEEEEeCchhcCCCCCCCE
Confidence            358999999877666677777766 555566653


No 25 
>cd08496 PBP2_NikA_DppA_OppA_like_9 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA can bind peptides of a wide range of lengths (2-35 amino-acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most
Probab=26.76  E-value=65  Score=24.44  Aligned_cols=32  Identities=19%  Similarity=0.388  Sum_probs=23.7

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCC-CCeeec
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSG-GPHVAR   65 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~-~~~~~~   65 (77)
                      =-|||...+......+++..++. |.+ .+++++
T Consensus       153 gtGPy~l~~~~~~~~i~l~~n~~yw~~~~~~~d~  186 (454)
T cd08496         153 GAGPYVLTEWVPNSKYVFERNEDYWDAANPHLDK  186 (454)
T ss_pred             ccCCeEEEEeccCCEEEEEeCccccCCCCCcccE
Confidence            47999999887666788888888 554 366663


No 26 
>cd08490 PBP2_NikA_DppA_OppA_like_3 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=26.42  E-value=62  Score=24.43  Aligned_cols=33  Identities=21%  Similarity=0.477  Sum_probs=24.1

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~~   66 (77)
                      =.|||...+......+++..+.. |.+.++++..
T Consensus       148 gsGPy~l~~~~~~~~i~l~~n~~y~~~~~~~d~I  181 (470)
T cd08490         148 GTGPYKVESFEPDQSLTLERNDDYWGGKPKLDKV  181 (470)
T ss_pred             ccCCcEEEEecCCceEEEEeCccccCCCCCCCEE
Confidence            46999999887656788888776 5555766643


No 27 
>cd08495 PBP2_NikA_DppA_OppA_like_8 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=25.18  E-value=71  Score=24.44  Aligned_cols=33  Identities=12%  Similarity=0.127  Sum_probs=23.0

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcccCC--CCeeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQKWSG--GPHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~~~~--~~~~~~~   66 (77)
                      =-|||...+...-..+++..++.|-+  .|++++.
T Consensus       168 gsGPy~~~~~~~~~~i~l~rn~~y~~~~~~~~~~i  202 (482)
T cd08495         168 GTGPFRITRFVPRERIELVRNDGYWDKRPPKNDKL  202 (482)
T ss_pred             ccCCeEEEEecCCCeEEEEECCCcCCCCCCCccEE
Confidence            47999998876545677888777644  3666643


No 28 
>smart00879 Brix Brix domain. The Brix domain is found in a number of eukaryotic proteins including SSF proteins from yeast and humans, Arabidopsis thaliana Peter Pan-like protein and several hypothetical proteins.
Probab=24.90  E-value=1e+02  Score=20.29  Aligned_cols=10  Identities=30%  Similarity=0.757  Sum_probs=8.0

Q ss_pred             CCcceEEeCC
Q psy2115          28 TKPNFVEMGP   37 (77)
Q Consensus        28 ~kP~v~EvGP   37 (77)
                      .+-.++|+||
T Consensus       167 ~~v~l~eiGP  176 (180)
T smart00879      167 PRVELQEIGP  176 (180)
T ss_pred             CceEEEEecC
Confidence            3578899999


No 29 
>TIGR02294 nickel_nikA nickel ABC transporter, periplasmic nickel-binding protein. Members of this family are periplasmic nickel-binding proteins of nickel ABC transporters. Nickel is bound specifically, albeit weakly, through water molecules positioned in the binding site. The amino acids whose side chains line the binding site include Tyr-44, Met-49, Trp-122, Arg-159, Trp-420, and Tyr-424 (numbering based on the precursor sequence of E. coli NikA) with the Arg contributing a hydrogen bond indirectly through a water molecule. Sequences that exactly (or mostly) have the same binding site residues score above the trusted (or noise) cutoffs to this model. Most appear to be lipoproteins.
Probab=24.85  E-value=60  Score=25.07  Aligned_cols=33  Identities=9%  Similarity=0.222  Sum_probs=23.3

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcccC-CCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQKWS-GGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~~~-~~~~~~~   65 (77)
                      .=-|||...++.....+++..++.|- +.+++++
T Consensus       162 vgtGPy~l~~~~~~~~i~l~~n~~yw~~~~~~d~  195 (500)
T TIGR02294       162 IGTGPWMLGESKQDEYAVFVRNENYWGEKPKLKK  195 (500)
T ss_pred             cccCCcEEEeccCCceEEEeeCccccCCCCcccE
Confidence            45799999887655567888877754 3466663


No 30 
>cd08489 PBP2_NikA The substrate-binding component of an ABC-type nickel import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel transport system, which functions in the import of nickel and in the control of chemotactic response away from nickel. The ATP-binding cassette (ABC) type nickel transport system is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, the initial nickel receptor. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides,
Probab=24.27  E-value=76  Score=24.24  Aligned_cols=33  Identities=15%  Similarity=0.320  Sum_probs=23.6

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      .--|||...++....-+++..++. |.+-|++++
T Consensus       155 vgsGPy~l~~~~~~~~i~l~~n~~y~~~~~~~d~  188 (488)
T cd08489         155 IGTGPWVLAEYKKGEYAVFVRNPNYWGEKPKIDK  188 (488)
T ss_pred             cccCCeEEEEecCCceEEEEeCccccCCCCCcCE
Confidence            457999999887656677777766 555566553


No 31 
>PF02056 Glyco_hydro_4:  Family 4 glycosyl hydrolase;  InterPro: IPR001088 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 4 GH4 from CAZY comprises enzymes with several known activities; 6-phospho-beta-glucosidase (3.2.1.86 from EC); 6-phospho-alpha-glucosidase (3.2.1.122 from EC); alpha-galactosidase (3.2.1.22 from EC). 6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1U8X_X 1S6Y_A 3FEF_B 1VJT_A 1UP4_A 1UP6_C 1UP7_E 1OBB_A.
Probab=24.21  E-value=49  Score=23.64  Aligned_cols=13  Identities=38%  Similarity=0.527  Sum_probs=10.0

Q ss_pred             EEEEeccChhhhh
Q psy2115          12 GHKFNWTNPEDIR   24 (77)
Q Consensus        12 ~y~FNvTNpeevl   24 (77)
                      -|++|.|||...+
T Consensus       138 Aw~iNytNP~~~v  150 (183)
T PF02056_consen  138 AWLINYTNPMGIV  150 (183)
T ss_dssp             SEEEE-SSSHHHH
T ss_pred             cEEEeccChHHHH
Confidence            3899999998875


No 32 
>PF07565 Band_3_cyto:  Band 3 cytoplasmic domain;  InterPro: IPR013769 Bicarbonate (HCO3 -) transport mechanisms are the principal regulators of pH in animal cells. Such transport also plays a vital role in acid-base movements in the stomach, pancreas, intestine, kidney, reproductive organs and the central nervous system. Functional studies have suggested four different HCO3 - transport modes. Anion exchanger proteins exchange HCO3 - for Cl- in a reversible, electroneutral manner []. Na+/HCO3 - co-transport proteins mediate the coupled movement of Na+ and HCO3 - across plasma membranes, often in an electrogenic manner []. Na- driven Cl-/HCO3 - exchange and K+/HCO3 - exchange activities have also been detected in certain cell types, although the molecular identities of the proteins responsible remain to be determined. Sequence analysis of the two families of HCO3 - transporters that have been cloned to date (the anion exchangers and Na+/HCO3 - co-transporters) reveals that they are homologous. This is not entirely unexpected, given that they both transport HCO3 - and are inhibited by a class of pharmacological agents called disulphonic stilbenes []. They share around ~25-30% sequence identity, which is distributed along their entire sequence length, and have similar predicted membrane topologies, suggesting they have ~10 transmembrane (TM) domains.; GO: 0008509 anion transmembrane transporter activity, 0006820 anion transport, 0016021 integral to membrane; PDB: 1HYN_Q.
Probab=24.15  E-value=27  Score=26.15  Aligned_cols=17  Identities=41%  Similarity=0.829  Sum_probs=6.5

Q ss_pred             cCCcccCCCCeeeccccc
Q psy2115          52 SGPQKWSGGPHVARRPLV   69 (77)
Q Consensus        52 ~~~~~~~~~~~~~~~~~~   69 (77)
                      .+.+.||| ||||.+.||
T Consensus         4 eg~~RWsK-PHVatLSfh   20 (257)
T PF07565_consen    4 EGGERWSK-PHVATLSFH   20 (257)
T ss_dssp             -TTS-B----B---BEHH
T ss_pred             ccCCccCC-CcccccCHH
Confidence            35567888 999988774


No 33 
>PF09200 Monellin:  Monellin;  InterPro: IPR015283 Monellin, a protein produced by the West African plant Dioscoreophyllum cumminsii (Serendipity berry), is approximately 70,000 times sweeter than sucrose on a molar basis. The protein adopts an alpha-beta structure, with a cystatin-like fold, where each helix packs against a coiled antiparallel beta-sheet []. ; PDB: 3PXM_A 1IV7_A 3PYJ_A 1KRL_D 4MON_B 2O9U_X 3Q2P_C 3MON_F 1MOL_B 1IV9_A ....
Probab=23.59  E-value=64  Score=18.47  Aligned_cols=11  Identities=18%  Similarity=0.144  Sum_probs=9.4

Q ss_pred             ceEEeCCeEEE
Q psy2115          31 NFVEMGPYRFH   41 (77)
Q Consensus        31 ~v~EvGPYvY~   41 (77)
                      +.-|+|||+|.
T Consensus         4 ~~~e~~~~~~~   14 (43)
T PF09200_consen    4 KGYEYQLYVYA   14 (43)
T ss_dssp             EEEECCCCEEE
T ss_pred             eEEEeeeeeeh
Confidence            46799999997


No 34 
>PHA02757 hypothetical protein; Provisional
Probab=22.68  E-value=62  Score=20.44  Aligned_cols=20  Identities=25%  Similarity=0.655  Sum_probs=15.6

Q ss_pred             hhhCCCCCc-----ceEEeCCeEEE
Q psy2115          22 DIRNNETKP-----NFVEMGPYRFH   41 (77)
Q Consensus        22 evl~G~~kP-----~v~EvGPYvY~   41 (77)
                      |+|.|+.||     .+.-.||+.|.
T Consensus         4 EflkGSskPprnvCViTPsgpfDFn   28 (75)
T PHA02757          4 EFLKGSSKPPRNVCVITPSGPFDFN   28 (75)
T ss_pred             hhhcCCCCCCCCEEEEeCCCCccEE
Confidence            788997787     45677999886


No 35 
>cd00995 PBP2_NikA_DppA_OppA_like The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is inv
Probab=22.64  E-value=77  Score=23.55  Aligned_cols=33  Identities=24%  Similarity=0.485  Sum_probs=24.0

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cC-CCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WS-GGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~-~~~~~~~   65 (77)
                      .=-|||...+......+++..++- |. +.|++++
T Consensus       155 igtGPy~l~~~~~~~~~~l~~n~~Y~~~~~p~~d~  189 (466)
T cd00995         155 VGTGPYKLVEWKPGESIVLERNDDYWGPGKPKIDK  189 (466)
T ss_pred             ccCCCcEEEeeccCCeEEEEECchhhcCCCCCccE
Confidence            468999999877656677877777 44 4577764


No 36 
>cd08493 PBP2_DppA_like The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine.  The PBP2 bind their li
Probab=22.61  E-value=83  Score=23.99  Aligned_cols=32  Identities=19%  Similarity=0.465  Sum_probs=23.3

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeeec
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVAR   65 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~~   65 (77)
                      =.|||...+......+++..++. |.+.|++++
T Consensus       173 gsGPy~l~~~~~~~~~~l~~n~~y~~~~p~~d~  205 (482)
T cd08493         173 GTGPFKFVSWQKDDRIRLEANPDYWGGKAKIDT  205 (482)
T ss_pred             cCCCeEEEEecCCCEEEEEeCccccCCCCCCCe
Confidence            58999998877656677777766 566676663


No 37 
>PF07619 DUF1581:  Protein of unknown function (DUF1581);  InterPro: IPR022660  Several Rhodopirellula baltica proteins share this domain. They also match PF07622 from PFAM 
Probab=22.53  E-value=42  Score=21.77  Aligned_cols=16  Identities=19%  Similarity=0.339  Sum_probs=14.2

Q ss_pred             cCCCCeeecccccCCC
Q psy2115          57 WSGGPHVARRPLVGNP   72 (77)
Q Consensus        57 ~~~~~~~~~~~~~~~~   72 (77)
                      |++.+||+++-|-|+|
T Consensus        37 ~~~~~~frNlrItG~P   52 (84)
T PF07619_consen   37 RRSHGHFRNLRITGSP   52 (84)
T ss_pred             eeeccceeeeEEcCCC
Confidence            6778999999999998


No 38 
>PRK15413 glutathione ABC transporter substrate-binding protein GsiB; Provisional
Probab=22.07  E-value=93  Score=24.28  Aligned_cols=33  Identities=21%  Similarity=0.396  Sum_probs=24.0

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCC-Ceeecc
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGG-PHVARR   66 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~-~~~~~~   66 (77)
                      =-|||...+......+++..++. |.++ |.++..
T Consensus       184 GtGPy~l~~~~~~~~i~l~rn~~Ywg~~~p~~d~i  218 (512)
T PRK15413        184 GTGPYELDTWNQTDFVKVKKFAGYWQPGLPKLDSI  218 (512)
T ss_pred             ccCCeEEEEeecCCEEEEEecccccCCCCCccceE
Confidence            46999999888777788887766 5533 666643


No 39 
>cd08517 PBP2_NikA_DppA_OppA_like_13 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=21.49  E-value=86  Score=23.72  Aligned_cols=33  Identities=21%  Similarity=0.433  Sum_probs=23.2

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcc-cC-CCCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQK-WS-GGPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~-~~-~~~~~~~   65 (77)
                      .=-|||...+......+++..++. |. +.|++++
T Consensus       158 vgtGPy~l~~~~~~~~~~l~~n~~yw~~~~p~~~~  192 (480)
T cd08517         158 IGTGPFKFVEWVRGSHIILERNPDYWDKGKPYLDR  192 (480)
T ss_pred             cccCCeEEEEeccCCEEEEEECcccccCCCCCccE
Confidence            347999999877656677877776 54 4566663


No 40 
>cd08500 PBP2_NikA_DppA_OppA_like_4 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=21.14  E-value=89  Score=24.30  Aligned_cols=33  Identities=12%  Similarity=0.148  Sum_probs=23.4

Q ss_pred             EEeCCeEEEEeeeeeceEEcCCcccCC-------CCeeec
Q psy2115          33 VEMGPYRFHYGDKYKSQKTSGPQKWSG-------GPHVAR   65 (77)
Q Consensus        33 ~EvGPYvY~E~~~K~nvtf~~~~~~~~-------~~~~~~   65 (77)
                      .--|||...+......+++..+..|-+       .|+++.
T Consensus       148 vGsGPy~l~~~~~~~~~~l~~n~~yw~~~~~g~~~p~~d~  187 (499)
T cd08500         148 PTLGPWKLESYTPGERVVLERNPYYWKVDTEGNQLPYIDR  187 (499)
T ss_pred             cccCCeEEEeecCCceEEEEeCCcccccCCCCCcCCccce
Confidence            356999998877656788888877432       367763


No 41 
>PF00496 SBP_bac_5:  Bacterial extracellular solute-binding proteins, family 5 Middle;  InterPro: IPR000914 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into Gram-positive bacteria which are surrounded by a single membrane and therefore have no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped [] into eight families of clusters, which generally correlate with the nature of the solute bound. Family 5 currently includes periplasmic oligopeptide-binding proteins (oppA) of Gram-negative bacteria and homologous lipoproteins in Gram-positive bacteria (oppA, amiA or appA); periplasmic dipeptide-binding proteins of Escherichia coli (dppA) and Bacillus subtilis (dppE); periplasmic murein peptide-binding protein of E. coli (mppA); periplasmic peptide-binding proteins sapA of E. coli, Salmonella typhimurium and Haemophilus influenzae; periplasmic nickel-binding protein (nikA) of E. coli; haem-binding lipoprotein (hbpA or dppA) from H. influenzae; lipoprotein xP55 from Streptomyces lividans; and hypothetical proteins from H. influenzae (HI0213) and Rhizobium sp. (strain NGR234) symbiotic plasmid (y4tO and y4wM).; GO: 0005215 transporter activity, 0006810 transport; PDB: 1B51_A 1B0H_A 1QKA_A 1B9J_A 1B6H_A 1OLA_A 1B3L_C 1JEV_A 1B5H_A 1JET_A ....
Probab=20.81  E-value=58  Score=23.51  Aligned_cols=39  Identities=23%  Similarity=0.432  Sum_probs=26.4

Q ss_pred             cceEEeCCeEEEEeeeeeceEEcCCcc-c-CCCCeeecccc
Q psy2115          30 PNFVEMGPYRFHYGDKYKSQKTSGPQK-W-SGGPHVARRPL   68 (77)
Q Consensus        30 P~v~EvGPYvY~E~~~K~nvtf~~~~~-~-~~~~~~~~~~~   68 (77)
                      ....--|||...+......+++-.+.. | .+.+++++.-+
T Consensus       114 ~~~igtGPy~~~~~~~~~~~~l~~n~~Yw~~~~~~~~~i~~  154 (374)
T PF00496_consen  114 KNPIGTGPYKLKSYSPGQRIVLERNPDYWGGGRPKIDRIEL  154 (374)
T ss_dssp             TS-SBSSSEEEEEEETTTEEEEEE-TTSTTTGGGSCSEEEE
T ss_pred             CCcccccceEEEEeccCcEEEEEeccccccccccccccccc
Confidence            345559999999988756788887777 6 55567775443


No 42 
>cd08502 PBP2_NikA_DppA_OppA_like_16 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=20.13  E-value=98  Score=23.72  Aligned_cols=27  Identities=11%  Similarity=0.234  Sum_probs=21.1

Q ss_pred             eEEeCCeEEEEeeeeeceEEcCCcccC
Q psy2115          32 FVEMGPYRFHYGDKYKSQKTSGPQKWS   58 (77)
Q Consensus        32 v~EvGPYvY~E~~~K~nvtf~~~~~~~   58 (77)
                      ..=-|||...++.....+++..++.|-
T Consensus       155 ~vgtGPy~l~~~~~~~~i~l~rn~~Y~  181 (472)
T cd08502         155 YIGSGPFKFVEWEPDQYVVYEKFADYV  181 (472)
T ss_pred             eeecCCeEEEeecCCcEEEEEecCCcC
Confidence            345799999988766678888888753


No 43 
>PRK15109 antimicrobial peptide ABC transporter periplasmic binding protein SapA; Provisional
Probab=20.08  E-value=97  Score=24.68  Aligned_cols=31  Identities=16%  Similarity=0.373  Sum_probs=22.7

Q ss_pred             EeCCeEEEEeeeeeceEEcCCcc-cCCCCeee
Q psy2115          34 EMGPYRFHYGDKYKSQKTSGPQK-WSGGPHVA   64 (77)
Q Consensus        34 EvGPYvY~E~~~K~nvtf~~~~~-~~~~~~~~   64 (77)
                      =-|||...+......+++..++. |.+.+.++
T Consensus       214 GtGPy~l~~~~~~~~i~l~rn~~Yw~~~~~~d  245 (547)
T PRK15109        214 GTGPFQLSEYRAGQFIRLQRHDDYWRGKPLMP  245 (547)
T ss_pred             ccCCeEEEeecCCCEEEEEeCcccccCCCCCC
Confidence            57999999887666788888887 54444444


Done!