Query         psy2117
Match_columns 81
No_of_seqs    105 out of 468
Neff          6.8 
Searched_HMMs 46136
Date          Fri Aug 16 16:31:09 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2117.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2117hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01130 CD36:  CD36 family;  I 100.0 1.1E-29 2.4E-34  190.4   7.6   80    2-81      3-84  (467)
  2 KOG3776|consensus               99.9 1.2E-27 2.7E-32  181.9   6.6   80    2-81     15-95  (507)
  3 PF09838 DUF2065:  Uncharacteri  56.6      16 0.00036   20.3   2.7   33    2-34      4-36  (57)
  4 PF06053 DUF929:  Domain of unk  55.4      18 0.00039   25.9   3.4   23   53-77     45-67  (249)
  5 PF11381 DUF3185:  Protein of u  53.0      11 0.00024   21.4   1.6   35    2-36      2-37  (59)
  6 PF05745 CRPA:  Chlamydia 15 kD  51.3      10 0.00023   25.0   1.5   15    1-15     69-84  (150)
  7 PF02038 ATP1G1_PLM_MAT8:  ATP1  45.3      14  0.0003   20.4   1.1   12    1-12     19-30  (50)
  8 COG2832 Uncharacterized protei  42.1      14 0.00031   23.8   1.0   40    2-42      8-50  (119)
  9 PF11295 DUF3096:  Protein of u  41.4      41 0.00088   17.6   2.5   20    7-26      4-23  (39)
 10 PRK12585 putative monovalent c  39.5      23  0.0005   24.7   1.8   22    3-24     15-37  (197)
 11 PF02056 Glyco_hydro_4:  Family  39.2      21 0.00044   24.4   1.5   13   52-64    138-150 (183)
 12 PRK00523 hypothetical protein;  38.4      49  0.0011   19.5   2.9   30    4-33     11-42  (72)
 13 KOG0938|consensus               37.4      11 0.00023   28.9  -0.1   34   22-55    376-409 (446)
 14 PRK06580 putative monovalent c  37.3      57  0.0012   20.3   3.2   38   25-67     58-95  (103)
 15 PRK10527 hypothetical protein;  35.9      16 0.00035   23.5   0.6   41    2-43      8-51  (125)
 16 PF09656 PGPGW:  Putative trans  34.6      33 0.00071   19.0   1.6   13    2-14      6-19  (53)
 17 PF03393 Pneumo_matrix:  Pneumo  33.7      33 0.00071   24.5   1.9   28   52-79    201-230 (252)
 18 PF10177 DUF2371:  Uncharacteri  32.9      24 0.00053   23.3   1.1   18    2-19     44-64  (141)
 19 PRK12675 putative monovalent c  32.3      38 0.00081   21.2   1.8   22    3-24      9-31  (104)
 20 TIGR01300 CPA3_mnhG_phaG monov  31.9      43 0.00093   20.5   2.0   23    2-24      4-27  (97)
 21 TIGR00869 sec62 protein transl  31.8      41 0.00088   24.0   2.1   22    3-24    124-146 (232)
 22 PF03729 DUF308:  Short repeat   31.6      79  0.0017   16.9   3.0   17    3-19      2-18  (72)
 23 PRK12586 putative monovalent c  30.2      38 0.00082   22.5   1.6    8   16-23     32-39  (145)
 24 PRK10574 putative major pilin   30.1      68  0.0015   21.0   2.8   20    5-24     14-34  (146)
 25 PF15345 TMEM51:  Transmembrane  29.9      29 0.00062   24.8   1.1   14    2-15     11-25  (233)
 26 PF03839 Sec62:  Translocation   29.6      37  0.0008   24.0   1.6   11   50-60    194-204 (224)
 27 PF03334 PhaG_MnhG_YufB:  Na+/H  29.6      60  0.0013   19.0   2.3   24    1-24      2-26  (81)
 28 PF14927 Neurensin:  Neurensin   29.1      35 0.00077   22.5   1.3   14    1-14     48-62  (140)
 29 PF06799 DUF1230:  Protein of u  29.0      88  0.0019   20.8   3.2   30   16-45     85-116 (144)
 30 PF02799 NMT_C:  Myristoyl-CoA:  28.8      37  0.0008   23.5   1.5   17   45-61    162-178 (190)
 31 PRK12592 putative monovalent c  28.5      42 0.00091   21.7   1.6   22    3-24     17-39  (126)
 32 PRK01844 hypothetical protein;  28.0      94   0.002   18.3   2.9   30    4-33     10-41  (72)
 33 PRK12671 putative monovalent c  27.2      51  0.0011   21.2   1.8   22    3-24     21-43  (120)
 34 smart00879 Brix Brix domain. T  27.0      94   0.002   19.9   3.1   25   47-77    152-176 (180)
 35 PF01102 Glycophorin_A:  Glycop  27.0      59  0.0013   20.9   2.1    7   21-27     88-94  (122)
 36 PRK12670 putative monovalent c  26.7      58  0.0013   20.0   2.0   22    3-24     12-34  (99)
 37 PRK12672 putative monovalent c  26.6      54  0.0012   20.8   1.9   22    3-24     13-35  (118)
 38 PF04156 IncA:  IncA protein;    25.9      54  0.0012   21.6   1.8   11    2-12     13-23  (191)
 39 COG5154 BRX1 RNA-binding prote  25.9 2.1E+02  0.0046   20.6   4.8   58   20-77    151-211 (283)
 40 PF05552 TM_helix:  Conserved T  25.9 1.1E+02  0.0025   16.1   3.2   24    4-27     21-45  (53)
 41 COG4968 PilE Tfp pilus assembl  25.6   1E+02  0.0022   20.4   3.0   22    5-26     15-37  (139)
 42 PRK12674 putative monovalent c  25.3      62  0.0013   19.7   1.9   22    3-24     13-35  (99)
 43 cd06919 Asp_decarbox Aspartate  25.3      38 0.00081   21.6   0.9   21   44-64     35-55  (111)
 44 PRK15076 alpha-galactosidase;   25.0      48   0.001   25.3   1.6   16   50-65    139-154 (431)
 45 PRK12587 putative monovalent c  25.0      59  0.0013   20.7   1.8   21    4-24     17-38  (118)
 46 TIGR01710 typeII_sec_gspG gene  24.6      96  0.0021   19.6   2.8   17    6-22     11-28  (134)
 47 PF14237 DUF4339:  Domain of un  23.0      38 0.00082   17.4   0.5    8   73-80      9-16  (45)
 48 PRK05449 aspartate alpha-decar  22.8      44 0.00096   21.7   0.9   21   44-64     36-56  (126)
 49 COG1320 MnhG Multisubunit Na+/  22.2      89  0.0019   19.8   2.2   23    2-24     13-36  (113)
 50 PF08488 WAK:  Wall-associated   22.2      50  0.0011   20.3   1.1   20   51-70     48-67  (103)
 51 COG2165 PulG Type II secretory  21.7      94   0.002   18.6   2.3   16    5-20     17-33  (149)
 52 KOG2927|consensus               21.7      51  0.0011   25.1   1.1   19    6-24    198-217 (372)
 53 PF12249 AftA_C:  Arabinofurano  21.1 1.1E+02  0.0023   21.1   2.5   19   59-79    155-173 (178)
 54 PF14991 MLANA:  Protein melan-  20.9      27 0.00059   22.4  -0.3   14    2-15     28-42  (118)
 55 COG3763 Uncharacterized protei  20.7 1.5E+02  0.0032   17.4   2.7   15   18-32     26-40  (71)
 56 TIGR03545 conserved hypothetic  20.2 1.9E+02  0.0042   23.1   4.1   47   15-61     23-70  (555)

No 1  
>PF01130 CD36:  CD36 family;  InterPro: IPR002159 CD36 is a transmembrane, highly glycosylated, 88kDa glycoprotein expressed by monocytes, macrophages, platelets, microvascular endothelial cells and adipose tissues. Platelet glycoprotein IV (GP IV)(GPIIIb) (CD36 antigen) is also called GPIV, OKM5-antigen or PASIV. CD36 recognises oxidized low density lipoprotein, long chain fatty acids, anionic phospholipids, collagen types I, IV and V, thrombospondin (TSP) and Plasmodium falciparum infected erythrocytes. The recognition of apoptotic neutrophils is in co-operation with TSP and avb3. Other ligands may still be unknown. CD36 is a scavenger receptor for oxidized LDL and shed photoreceptor outer segments and in recognition and phagocytosis of apoptotic cells and is the cell adhesion molecule in platelet adhesion and aggregation, platelet-monocyte and platelet-tumor cell interaction []. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0007155 cell adhesion, 0016020 membrane
Probab=99.96  E-value=1.1e-29  Score=190.42  Aligned_cols=80  Identities=45%  Similarity=0.830  Sum_probs=76.1

Q ss_pred             hhhHHHHHHHH-hHhc-cHHHHHHHHHHhcccCCCCccccccccCCcceeEEEEEEeecChHHhhCCCCCCceEEeccee
Q psy2117           2 TVGALLTLTNI-EVTS-LPSFFQLILQKELALSPWSRSFKIWRSNPVPIYLDFYFFNWTNPEDIRNNETKPNFVEMGPYR   79 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~~-~p~~i~~~v~~~~~l~~~s~~~~~W~~pp~~~~~~~y~fN~TN~~e~l~g~~kp~~~E~GPY~   79 (81)
                      ++|++++++|+ +..+ +|++++.+++|+++|++||..|+.|++||.|++++||+||+||||||++|++||+++|+|||+
T Consensus         3 ~~g~~~~~~g~~~~~~~~~~~~~~~i~~~~~L~~~s~~~~~W~~~p~p~~~~~y~fNvTNp~ev~~~g~kP~~~EvGPY~   82 (467)
T PF01130_consen    3 VVGILLLVLGILLGFVVFPSIIDSQIKKQLVLKPGSDSYDNWKKPPVPIYFKFYFFNVTNPEEVLNGGAKPNVQEVGPYV   82 (467)
T ss_pred             eehhHHHHHhHhhhhhhhHHHHHHHHHhCcEECCCChhHhhhhcCCCccEEEEEEEeccCHHHHhCcCCCceEEEeCCEE
Confidence            67999999999 7765 999999999999999999999999999999999999999999999999976699999999999


Q ss_pred             eC
Q psy2117          80 FQ   81 (81)
Q Consensus        80 y~   81 (81)
                      ||
T Consensus        83 y~   84 (467)
T PF01130_consen   83 YR   84 (467)
T ss_pred             EE
Confidence            96


No 2  
>KOG3776|consensus
Probab=99.94  E-value=1.2e-27  Score=181.93  Aligned_cols=80  Identities=40%  Similarity=0.826  Sum_probs=76.0

Q ss_pred             hhhHHHHHHHH-hHhccHHHHHHHHHHhcccCCCCccccccccCCcceeEEEEEEeecChHHhhCCCCCCceEEecceee
Q psy2117           2 TVGALLTLTNI-EVTSLPSFFQLILQKELALSPWSRSFKIWRSNPVPIYLDFYFFNWTNPEDIRNNETKPNFVEMGPYRF   80 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~~~p~~i~~~v~~~~~l~~~s~~~~~W~~pp~~~~~~~y~fN~TN~~e~l~g~~kp~~~E~GPY~y   80 (81)
                      ++|++|+++|+ +++.|+.+++++++++++|+|||.++++|.+||.+.++++|+|||||||||++|++||+++|+|||+|
T Consensus        15 v~~~~~~v~g~~~~~~~~~i~~~~v~~~~~L~~gs~~~~~W~~pp~~~~~~~yiFNvTNpde~~~~~~kp~v~EvGPyvy   94 (507)
T KOG3776|consen   15 VIGALLAVAGIVIVVVFPDIIDSMVDKNVVLRPGSDAFESWLNPPYPIYLNFYIFNVTNPDEFLSGGAKPNVQEVGPYVY   94 (507)
T ss_pred             HHHHHHHHhhheeeEeeHHHHHHHHHhceeeCCCchhhhhhhcCCCccEEEEEEEecCCHHHhhCcCCCCceEeeCCeEE
Confidence            56888888899 88888999999999999999999999999999999999999999999999999877999999999999


Q ss_pred             C
Q psy2117          81 Q   81 (81)
Q Consensus        81 ~   81 (81)
                      |
T Consensus        95 ~   95 (507)
T KOG3776|consen   95 R   95 (507)
T ss_pred             E
Confidence            6


No 3  
>PF09838 DUF2065:  Uncharacterized protein conserved in bacteria (DUF2065);  InterPro: IPR019201  This entry represents a protein found in various prokaryotic proteins, and has no known function. 
Probab=56.59  E-value=16  Score=20.30  Aligned_cols=33  Identities=15%  Similarity=0.241  Sum_probs=24.7

Q ss_pred             hhhHHHHHHHHhHhccHHHHHHHHHHhcccCCC
Q psy2117           2 TVGALLTLTNIEVTSLPSFFQLILQKELALSPW   34 (81)
Q Consensus         2 ~vg~~l~~~Gi~~~~~p~~i~~~v~~~~~l~~~   34 (81)
                      ++|..+++=|+....+|+-.++.+.+-..+.++
T Consensus         4 algLvliiEGl~~~l~P~~~r~~l~~l~~~p~~   36 (57)
T PF09838_consen    4 ALGLVLIIEGLLPFLAPERWRRMLRQLAQLPDR   36 (57)
T ss_pred             HHHHHHHHHhhHHHhCHHHHHHHHHHHHhCCHH
Confidence            457777777887788999888888776665544


No 4  
>PF06053 DUF929:  Domain of unknown function (DUF929);  InterPro: IPR009272 This is a family of proteins from the archaeon Sulfolobus, with undetermined function.
Probab=55.40  E-value=18  Score=25.95  Aligned_cols=23  Identities=35%  Similarity=0.608  Sum_probs=18.5

Q ss_pred             EEEeecChHHhhCCCCCCceEEecc
Q psy2117          53 YFFNWTNPEDIRNNETKPNFVEMGP   77 (81)
Q Consensus        53 y~fN~TN~~e~l~g~~kp~~~E~GP   77 (81)
                      .++.+.| .++..+| ||.+-.+|=
T Consensus        45 ~~~kvsn-~d~~~~G-k~~v~~igw   67 (249)
T PF06053_consen   45 NFFKVSN-QDLAPNG-KPEVIFIGW   67 (249)
T ss_pred             ceeeecC-cccCCCC-eeEEEEEec
Confidence            7788888 5577778 999998883


No 5  
>PF11381 DUF3185:  Protein of unknown function (DUF3185);  InterPro: IPR021521  Some members in this bacterial family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=53.04  E-value=11  Score=21.35  Aligned_cols=35  Identities=11%  Similarity=-0.145  Sum_probs=20.4

Q ss_pred             hhhHHHHHHHH-hHhccHHHHHHHHHHhcccCCCCc
Q psy2117           2 TVGALLTLTNI-EVTSLPSFFQLILQKELALSPWSR   36 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~~~p~~i~~~v~~~~~l~~~s~   36 (81)
                      ++|+.|++.|+ +...--+..++.-.|....-.|++
T Consensus         2 iigi~Llv~GivLl~~G~~~~~S~~s~~s~~~TG~~   37 (59)
T PF11381_consen    2 IIGIALLVGGIVLLYFGYQASDSLGSQVSRAFTGSP   37 (59)
T ss_pred             eeeehHHHHHHHHHHhhhhhhhhHHHHHHHHhcCCC
Confidence            46889999999 665444445554444333333433


No 6  
>PF05745 CRPA:  Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA);  InterPro: IPR008436 Chlamydia is a genus of bacteria, which causes the most common bacterial sexually transmitted diseases. They are obligate intracellular bacterial pathogens. Members of this genus lack a peptidoglycan layer, but as a substitute, it has been proposed that they have several cysteine rich membrane proteins. This includes the major outer membrane protein (MOMP). These form disulphide bonds to provide rigidity to the cell wall. The alignment of the amino acid sequences of the MOMP from various serovars of Chlamydia show that they have between seven and ten cysteine residues; seven of which are highly conserved []. The MOMP has been the focus of efforts to produce a vaccine for Chlamydia trachomatis []. The 15 kDa cysteine-rich protein in this entry is a multi-pass outer membrane protein. They are associated with the differentiation of reticulate bodies (RBs) into elementary bodies (EBs) []. They immunolocalise to the inclusion membrane, which is the membrane that surrounds the intracellular parasite. These proteins are recognised by CD8+ T cells in both human and mouse infections, suggesting they gain access to the host cytoplasm.; GO: 0019867 outer membrane
Probab=51.26  E-value=10  Score=25.05  Aligned_cols=15  Identities=13%  Similarity=0.392  Sum_probs=11.7

Q ss_pred             ChhhHHHHHHHH-hHh
Q psy2117           1 MTVGALLTLTNI-EVT   15 (81)
Q Consensus         1 ~~vg~~l~~~Gi-~~~   15 (81)
                      +++|++|++.|+ +.+
T Consensus        69 ~VlGiiLviagl~l~f   84 (150)
T PF05745_consen   69 VVLGIILVIAGLALTF   84 (150)
T ss_pred             HHHHHHHHHHHHHHHh
Confidence            467999999988 544


No 7  
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=45.26  E-value=14  Score=20.38  Aligned_cols=12  Identities=17%  Similarity=0.357  Sum_probs=8.2

Q ss_pred             ChhhHHHHHHHH
Q psy2117           1 MTVGALLTLTNI   12 (81)
Q Consensus         1 ~~vg~~l~~~Gi   12 (81)
                      |+++++|.++||
T Consensus        19 Li~A~vlfi~Gi   30 (50)
T PF02038_consen   19 LIFAGVLFILGI   30 (50)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHH
Confidence            356667777777


No 8  
>COG2832 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=42.10  E-value=14  Score=23.79  Aligned_cols=40  Identities=23%  Similarity=0.292  Sum_probs=26.1

Q ss_pred             hhhHHHHHHHHhHh---ccHHHHHHHHHHhcccCCCCccccccc
Q psy2117           2 TVGALLTLTNIEVT---SLPSFFQLILQKELALSPWSRSFKIWR   42 (81)
Q Consensus         2 ~vg~~l~~~Gi~~~---~~p~~i~~~v~~~~~l~~~s~~~~~W~   42 (81)
                      ++|.+.+.+||+.+   +.|. ---.+........+|+.++.|.
T Consensus         8 ~iGfl~l~LGIiGifLPlLPT-TPFlLLaa~cFaRsSpRf~~WL   50 (119)
T COG2832           8 ILGFLSLALGIIGIFLPLLPT-TPFLLLAAACFARSSPRFHAWL   50 (119)
T ss_pred             HHHHHHHHHHHHHhcCcccCC-cHHHHHHHHHHHcCCcHHHHHH
Confidence            57888888888333   4442 2233455566777888888774


No 9  
>PF11295 DUF3096:  Protein of unknown function (DUF3096);  InterPro: IPR021446 This entry is represented by the archaeal Thermoproteus tenax spherical virus 1, Orf18. The characteristics of the protein distribution suggest prophage matches and lateral genetic transfer in addition to the phage matches.
Probab=41.43  E-value=41  Score=17.57  Aligned_cols=20  Identities=15%  Similarity=0.384  Sum_probs=14.5

Q ss_pred             HHHHHHhHhccHHHHHHHHH
Q psy2117           7 LTLTNIEVTSLPSFFQLILQ   26 (81)
Q Consensus         7 l~~~Gi~~~~~p~~i~~~v~   26 (81)
                      -++.|++..++|.+++..+.
T Consensus         4 aliaGiLiLi~PrllnyiVa   23 (39)
T PF11295_consen    4 ALIAGILILIMPRLLNYIVA   23 (39)
T ss_pred             HHHHhHHHHHHHHHHHHHHH
Confidence            45566677788988888764


No 10 
>PRK12585 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=39.54  E-value=23  Score=24.72  Aligned_cols=22  Identities=27%  Similarity=0.552  Sum_probs=12.0

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|++++++|. -++-||+++...
T Consensus        15 iG~~f~ligaIGLlRfPD~YtRL   37 (197)
T PRK12585         15 IGGLLSILAAIGVIRLPDVYTRT   37 (197)
T ss_pred             HHHHHHHHHHHHHHhcCcHHHHh
Confidence            4555555555 444567666554


No 11 
>PF02056 Glyco_hydro_4:  Family 4 glycosyl hydrolase;  InterPro: IPR001088 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 4 GH4 from CAZY comprises enzymes with several known activities; 6-phospho-beta-glucosidase (3.2.1.86 from EC); 6-phospho-alpha-glucosidase (3.2.1.122 from EC); alpha-galactosidase (3.2.1.22 from EC). 6-phospho-alpha-glucosidase requires both NAD(H) and divalent metal (Mn2+, Fe2+, Co2+, or Ni2+) for activity [].; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 1U8X_X 1S6Y_A 3FEF_B 1VJT_A 1UP4_A 1UP6_C 1UP7_E 1OBB_A.
Probab=39.20  E-value=21  Score=24.40  Aligned_cols=13  Identities=38%  Similarity=0.685  Sum_probs=9.7

Q ss_pred             EEEEeecChHHhh
Q psy2117          52 FYFFNWTNPEDIR   64 (81)
Q Consensus        52 ~y~fN~TN~~e~l   64 (81)
                      -|++|+|||....
T Consensus       138 Aw~iNytNP~~~v  150 (183)
T PF02056_consen  138 AWLINYTNPMGIV  150 (183)
T ss_dssp             SEEEE-SSSHHHH
T ss_pred             cEEEeccChHHHH
Confidence            4799999998664


No 12 
>PRK00523 hypothetical protein; Provisional
Probab=38.42  E-value=49  Score=19.49  Aligned_cols=30  Identities=10%  Similarity=0.088  Sum_probs=18.1

Q ss_pred             hHHHHHHHH-hHh-ccHHHHHHHHHHhcccCC
Q psy2117           4 GALLTLTNI-EVT-SLPSFFQLILQKELALSP   33 (81)
Q Consensus         4 g~~l~~~Gi-~~~-~~p~~i~~~v~~~~~l~~   33 (81)
                      +++++++|. ..+ +-...++++++++-.+++
T Consensus        11 ~i~~li~G~~~Gffiark~~~k~l~~NPpine   42 (72)
T PRK00523         11 GIPLLIVGGIIGYFVSKKMFKKQIRENPPITE   42 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCcCCCH
Confidence            445555566 433 345677888887766654


No 13 
>KOG0938|consensus
Probab=37.44  E-value=11  Score=28.86  Aligned_cols=34  Identities=21%  Similarity=0.440  Sum_probs=24.2

Q ss_pred             HHHHHHhcccCCCCccccccccCCcceeEEEEEE
Q psy2117          22 QLILQKELALSPWSRSFKIWRSNPVPIYLDFYFF   55 (81)
Q Consensus        22 ~~~v~~~~~l~~~s~~~~~W~~pp~~~~~~~y~f   55 (81)
                      ++++.-++.+.+.+..-++|..||+.+.+++-+|
T Consensus       376 E~tlsAevels~Tt~nkq~WtrPPIsleFeV~MF  409 (446)
T KOG0938|consen  376 ESTLSAEVELSDTTQNKQQWTRPPISLEFEVPMF  409 (446)
T ss_pred             cceeEEEEEeccCccccccccCCCceeEEeeeee
Confidence            3344445566665555678999999998888877


No 14 
>PRK06580 putative monovalent cation/H+ antiporter subunit E; Reviewed
Probab=37.28  E-value=57  Score=20.29  Aligned_cols=38  Identities=13%  Similarity=0.121  Sum_probs=25.3

Q ss_pred             HHHhcccCCCCccccccccCCcceeEEEEEEeecChHHhhCCC
Q psy2117          25 LQKELALSPWSRSFKIWRSNPVPIYLDFYFFNWTNPEDIRNNE   67 (81)
Q Consensus        25 v~~~~~l~~~s~~~~~W~~pp~~~~~~~y~fN~TN~~e~l~g~   67 (81)
                      +...+.++|||-+-+    .... .+-++..|..++||+..|.
T Consensus        58 LAnsITLTPGTltvd----v~~d-~L~VHaLd~~d~e~l~~~~   95 (103)
T PRK06580         58 YGNSITLTPGTVTLD----INNN-MLLVHALNKSSITDLQRGI   95 (103)
T ss_pred             HHHHHhCCCCeEEEE----ecCC-eEEEEEecCCCHHHHhcch
Confidence            344556667665422    2212 3889999999999998864


No 15 
>PRK10527 hypothetical protein; Provisional
Probab=35.92  E-value=16  Score=23.52  Aligned_cols=41  Identities=22%  Similarity=0.292  Sum_probs=25.7

Q ss_pred             hhhHHHHHHHHhH---hccHHHHHHHHHHhcccCCCCcccccccc
Q psy2117           2 TVGALLTLTNIEV---TSLPSFFQLILQKELALSPWSRSFKIWRS   43 (81)
Q Consensus         2 ~vg~~l~~~Gi~~---~~~p~~i~~~v~~~~~l~~~s~~~~~W~~   43 (81)
                      ++|.+++.+|++.   .+.|+ .--.+.-.-....+|+.+++|-.
T Consensus         8 ~lG~~~~~LG~iGi~LPlLPT-TPFlLLAa~cfaRsSpR~~~WL~   51 (125)
T PRK10527          8 IIGWLAVVLGTLGVVLPLLPT-TPFILLAAWCFARSSPRFHAWLL   51 (125)
T ss_pred             HHHHHHHHHHHHHHhccCCCC-cHHHHHHHHHHHcCCHHHHHHHH
Confidence            5688888888832   25553 23344455666778888777743


No 16 
>PF09656 PGPGW:  Putative transmembrane protein (PGPGW);  InterPro: IPR019099 This entry represents proteins that contain three predicted transmembrane helices and an unusual motif with consensus sequence PGPGW. 
Probab=34.60  E-value=33  Score=18.99  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=10.4

Q ss_pred             hhhHHHHHHHH-hH
Q psy2117           2 TVGALLTLTNI-EV   14 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~   14 (81)
                      ++|.+++++|+ +.
T Consensus         6 v~G~~lv~~Gii~~   19 (53)
T PF09656_consen    6 VLGWVLVVAGIIML   19 (53)
T ss_pred             hHHHHHHHHHHHhh
Confidence            57889999999 54


No 17 
>PF03393 Pneumo_matrix:  Pneumovirus matrix protein;  InterPro: IPR005056  The matrix proteins of Pneumovirus virus are transcriptional processivity and antitermination factor and play a crucial role in viral assembly.; GO: 0019068 virion assembly, 0019031 viral envelope; PDB: 2VQP_A 2YKD_A.
Probab=33.66  E-value=33  Score=24.54  Aligned_cols=28  Identities=21%  Similarity=0.391  Sum_probs=15.8

Q ss_pred             EEEEeecChHHhhC--CCCCCceEEeccee
Q psy2117          52 FYFFNWTNPEDIRN--NETKPNFVEMGPYR   79 (81)
Q Consensus        52 ~y~fN~TN~~e~l~--g~~kp~~~E~GPY~   79 (81)
                      +-+.++||+..+..  |...-.+.|+|||+
T Consensus       201 ~lvmt~~~~KG~Fk~l~ag~Q~iveLG~Y~  230 (252)
T PF03393_consen  201 ILVMTMNNPKGAFKKLGAGSQVIVELGAYV  230 (252)
T ss_dssp             EEEEE---SSGGGTTS-TT-EEEEE-GGG-
T ss_pred             EEEEEecCCcchhhhcCCCcEEEEeccchh
Confidence            45789999998764  32256788999996


No 18 
>PF10177 DUF2371:  Uncharacterised conserved protein (DUF2371);  InterPro: IPR018787  This family of proteins with no known function is conserved from nematodes to humans. It includes members of the TMEM200 family of transmembrane proteins. 
Probab=32.87  E-value=24  Score=23.29  Aligned_cols=18  Identities=28%  Similarity=0.416  Sum_probs=13.9

Q ss_pred             hhhHHHHHHHH-hHh--ccHH
Q psy2117           2 TVGALLTLTNI-EVT--SLPS   19 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~--~~p~   19 (81)
                      ++|++++++|+ |.+  .||.
T Consensus        44 ~lG~lvllvGiaMAv~GYwp~   64 (141)
T PF10177_consen   44 LLGILVLLVGIAMAVLGYWPK   64 (141)
T ss_pred             HHHHHHHHHhhHhheeecccc
Confidence            57889999999 765  4774


No 19 
>PRK12675 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=32.32  E-value=38  Score=21.15  Aligned_cols=22  Identities=9%  Similarity=0.295  Sum_probs=12.1

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.++|. -.+-+|+.+...
T Consensus         9 ~G~~f~l~g~iGllR~PD~ytRl   31 (104)
T PRK12675          9 FGYSIMFFGALGLLRFPDVYTRL   31 (104)
T ss_pred             HHHHHHHHHHHHHHhCCcHHHHh
Confidence            4555555555 444567666554


No 20 
>TIGR01300 CPA3_mnhG_phaG monovalent cation/proton antiporter, MnhG/PhaG subunit. This model represents a subfamily of small, transmembrane proteins believed to be components of Na+/H+ and K+/H+ antiporters. Members, including proteins designated MnhG from Staphylococcus aureus and PhaG from Rhizobium meliloti, show some similarity to chain L of the NADH dehydrogenase I, which also translocates protons.
Probab=31.90  E-value=43  Score=20.51  Aligned_cols=23  Identities=22%  Similarity=0.527  Sum_probs=14.2

Q ss_pred             hhhHHHHHHHH-hHhccHHHHHHH
Q psy2117           2 TVGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      ++|+++.++|. -.+-+|+.+.+.
T Consensus         4 ~~G~~f~l~g~iGllR~pD~y~Rl   27 (97)
T TIGR01300         4 LIGAFFTLLGAIGLVRFPDVYTRL   27 (97)
T ss_pred             HHHHHHHHHHHHHHHhCCcHHHHh
Confidence            45666666666 555666666554


No 21 
>TIGR00869 sec62 protein translocation protein, Sec62 family. protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins has been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.
Probab=31.79  E-value=41  Score=24.01  Aligned_cols=22  Identities=9%  Similarity=0.113  Sum_probs=11.1

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      ++++++++++ +..+||..++.-
T Consensus       124 ~~~~~~ila~~lFPlWP~~~r~g  146 (232)
T TIGR00869       124 ILVVSIILALVLFPLWPRFMRRG  146 (232)
T ss_pred             HHHHHHHHHHhhcccChHHHhHh
Confidence            3444444444 555666555443


No 22 
>PF03729 DUF308:  Short repeat of unknown function (DUF308);  InterPro: IPR005325 This represents a group of short repeats that occurs in a limited number of membrane proteins. It may divide further in short repeats of around 7-10 residues of the pattern G-#-X(2)-#(2)-X (#=hydrophobic).
Probab=31.56  E-value=79  Score=16.87  Aligned_cols=17  Identities=24%  Similarity=0.298  Sum_probs=10.6

Q ss_pred             hhHHHHHHHHhHhccHH
Q psy2117           3 VGALLTLTNIEVTSLPS   19 (81)
Q Consensus         3 vg~~l~~~Gi~~~~~p~   19 (81)
                      .|++++++|++....|.
T Consensus         2 ~Gil~iv~Gi~~l~~p~   18 (72)
T PF03729_consen    2 SGILFIVLGILLLFNPD   18 (72)
T ss_pred             HHHHHHHHHHHHHHhHH
Confidence            57777777774444443


No 23 
>PRK12586 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=30.18  E-value=38  Score=22.46  Aligned_cols=8  Identities=13%  Similarity=0.239  Sum_probs=3.6

Q ss_pred             ccHHHHHH
Q psy2117          16 SLPSFFQL   23 (81)
Q Consensus        16 ~~p~~i~~   23 (81)
                      -+|+++..
T Consensus        32 RfPD~ytR   39 (145)
T PRK12586         32 KFQDVFLR   39 (145)
T ss_pred             hCCcHHHH
Confidence            34544443


No 24 
>PRK10574 putative major pilin subunit; Provisional
Probab=30.06  E-value=68  Score=20.99  Aligned_cols=20  Identities=10%  Similarity=0.481  Sum_probs=12.2

Q ss_pred             HHHHHHHH-hHhccHHHHHHH
Q psy2117           5 ALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         5 ~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +.++++|| ..+.+|.+.+.+
T Consensus        14 IViaIigILaaiaiP~~~~~~   34 (146)
T PRK10574         14 VVIAIIAILSAIGIPAYQNYL   34 (146)
T ss_pred             HHHHHHHHHHHHHHHHHHHHH
Confidence            34566777 566677665444


No 25 
>PF15345 TMEM51:  Transmembrane protein 51
Probab=29.88  E-value=29  Score=24.85  Aligned_cols=14  Identities=14%  Similarity=0.252  Sum_probs=10.6

Q ss_pred             hhhHHHHHHHH-hHh
Q psy2117           2 TVGALLTLTNI-EVT   15 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~   15 (81)
                      ++|+-++++|| |++
T Consensus        11 AiG~Gml~LGiiM~v   25 (233)
T PF15345_consen   11 AIGVGMLALGIIMIV   25 (233)
T ss_pred             HHhHhHHHHhhHhee
Confidence            46888889999 554


No 26 
>PF03839 Sec62:  Translocation protein Sec62;  InterPro: IPR004728 Members of the NSCC2 family have been sequenced from various yeast, fungal and animals species including Saccharomyces cerevisiae, Drosophila melanogaster and Homo sapiens. These proteins are the Sec62 proteins, believed to be associated with the Sec61 and Sec63 constituents of the general protein secretary systems of yeast microsomes. They are also the non-selective cation (NS) channels of the mammalian cytoplasmic membrane. The yeast Sec62 protein has been shown to be essential for cell growth. The mammalian NS channel proteins have been implicated in platelet derived growth factor(PGDF) dependent single channel current in fibroblasts. These channels are essentially closed in serum deprived tissue-culture cells and are specifically opened by exposure to PDGF. These channels are reported to exhibit equal selectivity for Na+, K+ and Cs+ with low permeability to Ca2+, and no permeability to anions.; GO: 0008565 protein transporter activity, 0015031 protein transport, 0016021 integral to membrane
Probab=29.63  E-value=37  Score=24.00  Aligned_cols=11  Identities=9%  Similarity=0.383  Sum_probs=5.7

Q ss_pred             EEEEEEeecCh
Q psy2117          50 LDFYFFNWTNP   60 (81)
Q Consensus        50 ~~~y~fN~TN~   60 (81)
                      .=.|=|+.+++
T Consensus       194 ~Ply~~~~~~~  204 (224)
T PF03839_consen  194 KPLYSWEYKGD  204 (224)
T ss_pred             eecccccccCc
Confidence            33555666544


No 27 
>PF03334 PhaG_MnhG_YufB:  Na+/H+ antiporter subunit;  InterPro: IPR005133 This is a family of small, transmembrane proteins believed to be components of Na+/H+ and K+/H+ antiporters. Members, including proteins designated MnhG from Staphylococcus aureus and PhaG from Rhizobium meliloti (Sinorhizobium meliloti), show some similarity to chain L of the NADH dehydrogenase I, which also translocates protons. ; GO: 0005451 monovalent cation:hydrogen antiporter activity, 0015672 monovalent inorganic cation transport, 0015992 proton transport
Probab=29.58  E-value=60  Score=19.03  Aligned_cols=24  Identities=21%  Similarity=0.570  Sum_probs=16.5

Q ss_pred             ChhhHHHHHHHH-hHhccHHHHHHH
Q psy2117           1 MTVGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         1 ~~vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +.+|+++.+.|. -..-+|+.+.+.
T Consensus         2 l~~G~~~~l~~~iGllR~pd~y~Rl   26 (81)
T PF03334_consen    2 LLLGAFFMLIGAIGLLRFPDFYTRL   26 (81)
T ss_pred             cHHHHHHHHHHHHHHHhCCcHHHHh
Confidence            356777777777 666777776654


No 28 
>PF14927 Neurensin:  Neurensin
Probab=29.07  E-value=35  Score=22.47  Aligned_cols=14  Identities=36%  Similarity=0.501  Sum_probs=11.2

Q ss_pred             ChhhHHHHHHHH-hH
Q psy2117           1 MTVGALLTLTNI-EV   14 (81)
Q Consensus         1 ~~vg~~l~~~Gi-~~   14 (81)
                      +++|++++++|+ .+
T Consensus        48 ~i~g~l~Ll~Gi~~l   62 (140)
T PF14927_consen   48 FISGLLLLLLGIVAL   62 (140)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            367999999999 44


No 29 
>PF06799 DUF1230:  Protein of unknown function (DUF1230);  InterPro: IPR009631 This family represents Ycf36, which is found in plants, encoded in the genomes of algal chloroplasts and in cyanobacteria. As the family is exclusively found in phototrophic organisms it may play a role in photosynthesis.
Probab=29.02  E-value=88  Score=20.77  Aligned_cols=30  Identities=17%  Similarity=0.068  Sum_probs=21.8

Q ss_pred             ccHHHHHHHHHHhcccCCCCcccc--ccccCC
Q psy2117          16 SLPSFFQLILQKELALSPWSRSFK--IWRSNP   45 (81)
Q Consensus        16 ~~p~~i~~~v~~~~~l~~~s~~~~--~W~~pp   45 (81)
                      ...+.+.+++.+..+--+.|-=||  .|.+||
T Consensus        85 LGW~YV~~RL~s~tV~YEESGWYDGQ~W~Kp~  116 (144)
T PF06799_consen   85 LGWSYVGDRLLSATVEYEESGWYDGQVWVKPP  116 (144)
T ss_pred             hChHHHHhhhccCcccccccCccCCccccCCH
Confidence            345577777777777777776677  699988


No 30 
>PF02799 NMT_C:  Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain;  InterPro: IPR022677 Myristoyl-CoA:protein N-myristoyltransferase (2.3.1.97 from EC) (Nmt) [] is the enzyme responsible for transferring a myristate group on the N-terminal glycine of a number of cellular eukaryotics and viral proteins. Nmt is a monomeric protein of about 50 to 60kDa whose sequence appears to be well conserved.  The N and C-terminal domains of NMT are structurally similar, each adopting an acyl-CoA N-acyltransferase-like fold. This entry represents the C-terminal region.; GO: 0004379 glycylpeptide N-tetradecanoyltransferase activity; PDB: 2P6G_B 2P6F_F 2P6E_A 1IIC_A 1IID_A 2NMT_A 2WUU_A 1IYL_B 1NMT_B 1IYK_A ....
Probab=28.75  E-value=37  Score=23.46  Aligned_cols=17  Identities=35%  Similarity=0.921  Sum_probs=12.3

Q ss_pred             CcceeEEEEEEeecChH
Q psy2117          45 PVPIYLDFYFFNWTNPE   61 (81)
Q Consensus        45 p~~~~~~~y~fN~TN~~   61 (81)
                      +.+..+.+|+|||.-|+
T Consensus       162 ~GdG~L~YYLyNwr~~~  178 (190)
T PF02799_consen  162 PGDGNLNYYLYNWRCPP  178 (190)
T ss_dssp             EEEEEEEEEEESEB---
T ss_pred             CCCCCeEEEEEeccCCC
Confidence            46889999999998765


No 31 
>PRK12592 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=28.54  E-value=42  Score=21.69  Aligned_cols=22  Identities=14%  Similarity=0.292  Sum_probs=11.8

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.++|. -++-+|+++...
T Consensus        17 ~G~~f~l~gaiGllRfPD~ytRl   39 (126)
T PRK12592         17 SGAFLSFSASIGLIRFRDTMSRV   39 (126)
T ss_pred             HHHHHHHHHHHHHHhCCcHHHHc
Confidence            4555555555 444567666554


No 32 
>PRK01844 hypothetical protein; Provisional
Probab=27.96  E-value=94  Score=18.30  Aligned_cols=30  Identities=13%  Similarity=0.155  Sum_probs=16.6

Q ss_pred             hHHHHHHHH-hHh-ccHHHHHHHHHHhcccCC
Q psy2117           4 GALLTLTNI-EVT-SLPSFFQLILQKELALSP   33 (81)
Q Consensus         4 g~~l~~~Gi-~~~-~~p~~i~~~v~~~~~l~~   33 (81)
                      +++.+++|+ ..+ +-...+++.++++=.+.+
T Consensus        10 ~I~~li~G~~~Gff~ark~~~k~lk~NPpine   41 (72)
T PRK01844         10 GVVALVAGVALGFFIARKYMMNYLQKNPPINE   41 (72)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCH
Confidence            344555555 333 335667777777654443


No 33 
>PRK12671 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=27.22  E-value=51  Score=21.16  Aligned_cols=22  Identities=36%  Similarity=0.560  Sum_probs=10.9

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.++|. -++-+|+++...
T Consensus        21 ~G~~f~l~gaiGllR~PD~ytRl   43 (120)
T PRK12671         21 LGAGLTLIGTIGLVRLKSFYERL   43 (120)
T ss_pred             HHHHHHHHHHHHHhcCCcHHHHh
Confidence            3444444444 334466655543


No 34 
>smart00879 Brix Brix domain. The Brix domain is found in a number of eukaryotic proteins including SSF proteins from yeast and humans, Arabidopsis thaliana Peter Pan-like protein and several hypothetical proteins.
Probab=26.96  E-value=94  Score=19.86  Aligned_cols=25  Identities=20%  Similarity=0.562  Sum_probs=16.3

Q ss_pred             ceeEEEEEEeecChHHhhCCCCCCceEEecc
Q psy2117          47 PIYLDFYFFNWTNPEDIRNNETKPNFVEMGP   77 (81)
Q Consensus        47 ~~~~~~y~fN~TN~~e~l~g~~kp~~~E~GP   77 (81)
                      .+++..|..+.      -.+..+-.++|+||
T Consensus       152 ~I~~R~y~i~~------~~~~~~v~l~eiGP  176 (180)
T smart00879      152 YIFFRHYRIKF------GKKKPRVELQEIGP  176 (180)
T ss_pred             EEEEEEEEEEc------cCCCCceEEEEecC
Confidence            46666676655      12233688999999


No 35 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=26.96  E-value=59  Score=20.87  Aligned_cols=7  Identities=14%  Similarity=0.268  Sum_probs=2.1

Q ss_pred             HHHHHHH
Q psy2117          21 FQLILQK   27 (81)
Q Consensus        21 i~~~v~~   27 (81)
                      ++.+.||
T Consensus        88 irR~~Kk   94 (122)
T PF01102_consen   88 IRRLRKK   94 (122)
T ss_dssp             HHHHS--
T ss_pred             HHHHhcc
Confidence            4444444


No 36 
>PRK12670 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=26.73  E-value=58  Score=20.01  Aligned_cols=22  Identities=23%  Similarity=0.649  Sum_probs=12.5

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.++|. -.+-+|+.+.+.
T Consensus        12 ~G~~f~l~g~iGllR~pD~y~Rl   34 (99)
T PRK12670         12 LGIFLIVISVIGVIRFPDFYTRL   34 (99)
T ss_pred             HHHHHHHHHHHHHHhCccHHHHh
Confidence            4555555555 444577776654


No 37 
>PRK12672 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=26.62  E-value=54  Score=20.79  Aligned_cols=22  Identities=14%  Similarity=0.448  Sum_probs=12.8

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.++|. -.+=+|+++...
T Consensus        13 ~G~~f~l~gaiGllR~PD~ytRl   35 (118)
T PRK12672         13 IGVTFNLLGSIALHRFPDVYTRL   35 (118)
T ss_pred             HHHHHHHHHHHHHHhCccHHHHh
Confidence            4555555555 444577776654


No 38 
>PF04156 IncA:  IncA protein;  InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion. The inclusion is nonfusogenic with lysosomes but intercepts lipids from a host cell exocytic pathway. Initiation of chlamydial development is concurrent with modification of the inclusion membrane by a set of C. trachomatis-encoded proteins collectively designated Incs. One of these Incs, IncA (Inclusion membrane protein A), is functionally associated with the homotypic fusion of inclusions [].
Probab=25.95  E-value=54  Score=21.61  Aligned_cols=11  Identities=36%  Similarity=0.579  Sum_probs=6.5

Q ss_pred             hhhHHHHHHHH
Q psy2117           2 TVGALLTLTNI   12 (81)
Q Consensus         2 ~vg~~l~~~Gi   12 (81)
                      ++|+++++.||
T Consensus        13 ilgilli~~gI   23 (191)
T PF04156_consen   13 ILGILLIASGI   23 (191)
T ss_pred             HHHHHHHHHHH
Confidence            45666666666


No 39 
>COG5154 BRX1 RNA-binding protein required for 60S ribosomal subunit biogenesis [Translation, ribosomal structure and biogenesis]
Probab=25.90  E-value=2.1e+02  Score=20.60  Aligned_cols=58  Identities=10%  Similarity=0.260  Sum_probs=29.3

Q ss_pred             HHHHHHHHhcccCCCCccccccccCCcceeE---EEEEEeecChHHhhCCCCCCceEEecc
Q psy2117          20 FFQLILQKELALSPWSRSFKIWRSNPVPIYL---DFYFFNWTNPEDIRNNETKPNFVEMGP   77 (81)
Q Consensus        20 ~i~~~v~~~~~l~~~s~~~~~W~~pp~~~~~---~~y~fN~TN~~e~l~g~~kp~~~E~GP   77 (81)
                      +++..+.+...+-+|.+.-+...+--..+..   ++|+=++.=..|.-+++.+-.++|+||
T Consensus       151 ~~Kell~h~F~ip~~arrSkpfiD~v~~f~i~DgkIWvR~YeI~re~ed~~~dv~L~EIGP  211 (283)
T COG5154         151 YAKELLEHIFGIPKGARRSKPFIDKVLCFFILDGKIWVRCYEIGRENEDKSKDVKLEEIGP  211 (283)
T ss_pred             HHHHHHHHhccCCCcccccccchhheEEEEEecCeEEEEEEeeccccccccccceeeeecc
Confidence            3455555555565655433333322211111   344444433345445664679999999


No 40 
>PF05552 TM_helix:  Conserved TM helix;  InterPro: IPR008910 This alignment represents a conserved transmembrane helix as well as some flanking sequence. It is often found in association with a Mechanosensitive (MS) channel IPR006685 from INTERPRO.; PDB: 2VV5_F 2OAU_E.
Probab=25.87  E-value=1.1e+02  Score=16.10  Aligned_cols=24  Identities=13%  Similarity=0.227  Sum_probs=13.9

Q ss_pred             hHHHHHHHH-hHhccHHHHHHHHHH
Q psy2117           4 GALLTLTNI-EVTSLPSFFQLILQK   27 (81)
Q Consensus         4 g~~l~~~Gi-~~~~~p~~i~~~v~~   27 (81)
                      +++.+++|. +.-..-.++++.+++
T Consensus        21 AilIl~vG~~va~~v~~~~~~~l~~   45 (53)
T PF05552_consen   21 AILILIVGWWVAKFVRKLVRRLLEK   45 (53)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            445555566 555666666666554


No 41 
>COG4968 PilE Tfp pilus assembly protein PilE [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=25.62  E-value=1e+02  Score=20.39  Aligned_cols=22  Identities=18%  Similarity=0.523  Sum_probs=15.1

Q ss_pred             HHHHHHHH-hHhccHHHHHHHHH
Q psy2117           5 ALLTLTNI-EVTSLPSFFQLILQ   26 (81)
Q Consensus         5 ~~l~~~Gi-~~~~~p~~i~~~v~   26 (81)
                      +..+|+|| ..+..|++-+.+++
T Consensus        15 IvVaIv~ILa~IAyPSY~~yv~r   37 (139)
T COG4968          15 IVVAIVGILALIAYPSYQNYVLR   37 (139)
T ss_pred             HHHHHHHHHHHHHhHhHHHHHHH
Confidence            34667788 67788887766654


No 42 
>PRK12674 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=25.33  E-value=62  Score=19.75  Aligned_cols=22  Identities=23%  Similarity=0.572  Sum_probs=10.9

Q ss_pred             hhHHHHHHHH-hHhccHHHHHHH
Q psy2117           3 VGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         3 vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      +|+++.+.|. -..-+|+.+.+.
T Consensus        13 ~G~~f~~~gaiGllR~pD~y~Rl   35 (99)
T PRK12674         13 LGAFFALVGAIGLVRLPDVYTRL   35 (99)
T ss_pred             HHHHHHHHHHHHHHhCccHHHHh
Confidence            3444444444 333467766554


No 43 
>cd06919 Asp_decarbox Aspartate alpha-decarboxylase or L-aspartate 1-decarboxylase, a pyruvoyl group-dependent  decarboxylase in beta-alanine production. Decarboxylation of aspartate is  the major route of beta-alanine production in bacteria, and is catalyzed  by the enzyme L-aspartate decarboxylase (ADC), EC:4.1.1.11 which  requires a pyruvoyl group for its activity. The pyruvoyl cofactor is  covalently bound to the enzyme. The protein is synthesized as a  proenzyme and cleaved via self-processing at Gly23-Ser24 to yield an  alpha chain (C-terminal fragment) and beta chain (N-terminal fragment),  and the pyruvoyl group. Beta-alanine is required for the biosynthesis of  pantothenate, in which the enzyme plays a critical regulatory role. The  active site of the tetrameric enzyme is located at the interface of two  subunits, with a Lysine and a Histidine from the beta chain of one  subunit forming the active site with residues from the alpha chain of  the adjacent subunit. This alignment 
Probab=25.32  E-value=38  Score=21.60  Aligned_cols=21  Identities=14%  Similarity=0.115  Sum_probs=16.5

Q ss_pred             CCcceeEEEEEEeecChHHhh
Q psy2117          44 NPVPIYLDFYFFNWTNPEDIR   64 (81)
Q Consensus        44 pp~~~~~~~y~fN~TN~~e~l   64 (81)
                      ..+-.+-++.+||+||-++|-
T Consensus        35 agi~~~E~V~I~Nv~NG~Rf~   55 (111)
T cd06919          35 AGILPYEKVLVVNVNNGARFE   55 (111)
T ss_pred             cCCCCCCEEEEEECCCCcEEE
Confidence            334556689999999999984


No 44 
>PRK15076 alpha-galactosidase; Provisional
Probab=24.96  E-value=48  Score=25.28  Aligned_cols=16  Identities=25%  Similarity=0.509  Sum_probs=13.5

Q ss_pred             EEEEEEeecChHHhhC
Q psy2117          50 LDFYFFNWTNPEDIRN   65 (81)
Q Consensus        50 ~~~y~fN~TN~~e~l~   65 (81)
                      -+-++.|+|||.+++.
T Consensus       139 p~a~iin~tNP~divt  154 (431)
T PRK15076        139 PDALLLNYVNPMAMNT  154 (431)
T ss_pred             CCeEEEEcCChHHHHH
Confidence            3679999999999874


No 45 
>PRK12587 putative monovalent cation/H+ antiporter subunit G; Reviewed
Probab=24.96  E-value=59  Score=20.70  Aligned_cols=21  Identities=19%  Similarity=0.313  Sum_probs=9.3

Q ss_pred             hHHHHHHHH-hHhccHHHHHHH
Q psy2117           4 GALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         4 g~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      |+++.++|. -.+-+|+++...
T Consensus        17 G~~~~ligaiGllR~PD~y~Rl   38 (118)
T PRK12587         17 GALISALAAIGLLRLEDVYSRA   38 (118)
T ss_pred             HHHHHHHHHHHHHhCCcHHHHh
Confidence            444444444 333455555443


No 46 
>TIGR01710 typeII_sec_gspG general secretion pathway protein G. This model represents GspG, protein G of the main terminal branch of the general secretion pathway, also called type II secretion. It transports folded proteins across the bacterial outer membrane and is widely distributed in Gram-negative pathogens.
Probab=24.64  E-value=96  Score=19.58  Aligned_cols=17  Identities=18%  Similarity=0.471  Sum_probs=8.7

Q ss_pred             HHHHHHH-hHhccHHHHH
Q psy2117           6 LLTLTNI-EVTSLPSFFQ   22 (81)
Q Consensus         6 ~l~~~Gi-~~~~~p~~i~   22 (81)
                      .++++|+ +.++.|.+..
T Consensus        11 vlaIigil~~i~~p~~~~   28 (134)
T TIGR01710        11 VLVILGLLAALVAPKLFS   28 (134)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            4455555 4555555433


No 47 
>PF14237 DUF4339:  Domain of unknown function (DUF4339)
Probab=23.02  E-value=38  Score=17.38  Aligned_cols=8  Identities=25%  Similarity=0.845  Sum_probs=6.0

Q ss_pred             EEecceee
Q psy2117          73 VEMGPYRF   80 (81)
Q Consensus        73 ~E~GPY~y   80 (81)
                      ++.|||+.
T Consensus         9 ~~~GP~s~   16 (45)
T PF14237_consen    9 QQQGPFSL   16 (45)
T ss_pred             eEECCcCH
Confidence            67899863


No 48 
>PRK05449 aspartate alpha-decarboxylase; Provisional
Probab=22.81  E-value=44  Score=21.72  Aligned_cols=21  Identities=10%  Similarity=-0.045  Sum_probs=16.7

Q ss_pred             CCcceeEEEEEEeecChHHhh
Q psy2117          44 NPVPIYLDFYFFNWTNPEDIR   64 (81)
Q Consensus        44 pp~~~~~~~y~fN~TN~~e~l   64 (81)
                      ..+-.+-++.+||+||-++|-
T Consensus        36 agi~p~E~V~V~Nv~NG~Rf~   56 (126)
T PRK05449         36 AGILENEKVQIVNVNNGARFE   56 (126)
T ss_pred             cCCCCCCEEEEEECCCCcEEE
Confidence            344556699999999999984


No 49 
>COG1320 MnhG Multisubunit Na+/H+ antiporter, MnhG subunit [Inorganic ion transport and metabolism]
Probab=22.23  E-value=89  Score=19.78  Aligned_cols=23  Identities=22%  Similarity=0.512  Sum_probs=13.5

Q ss_pred             hhhHHHHHHHH-hHhccHHHHHHH
Q psy2117           2 TVGALLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      ++|+++..+|. -..-+|+.+...
T Consensus        13 liGa~~~l~aaiGl~R~PD~YtRl   36 (113)
T COG1320          13 LIGALFSLLAAIGLLRFPDVYTRL   36 (113)
T ss_pred             HHHHHHHHHHHHHHHHCchHHHHH
Confidence            34555555555 445677776655


No 50 
>PF08488 WAK:  Wall-associated kinase;  InterPro: IPR013695 This domain is found together with the eukaryotic protein kinase domain IPR000719 from INTERPRO in plant wall-associated kinases (WAKs) and related proteins. WAKs are serine-threonine kinases which might be involved in signalling to the cytoplasm and are required for cell expansion []. ; GO: 0004674 protein serine/threonine kinase activity, 0016021 integral to membrane
Probab=22.20  E-value=50  Score=20.28  Aligned_cols=20  Identities=35%  Similarity=0.546  Sum_probs=15.3

Q ss_pred             EEEEEeecChHHhhCCCCCC
Q psy2117          51 DFYFFNWTNPEDIRNNETKP   70 (81)
Q Consensus        51 ~~y~fN~TN~~e~l~g~~kp   70 (81)
                      ..|.+|+|+|+++.+.+-.|
T Consensus        48 ~~~~~n~t~p~~~~~~~y~p   67 (103)
T PF08488_consen   48 DWFSSNITDPEDFHAMGYVP   67 (103)
T ss_pred             ccccccCCChHHhccCCeeE
Confidence            56889999999987754345


No 51 
>COG2165 PulG Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion]
Probab=21.74  E-value=94  Score=18.64  Aligned_cols=16  Identities=31%  Similarity=0.600  Sum_probs=9.0

Q ss_pred             HHHHHHHH-hHhccHHH
Q psy2117           5 ALLTLTNI-EVTSLPSF   20 (81)
Q Consensus         5 ~~l~~~Gi-~~~~~p~~   20 (81)
                      +.++++|| ..++.|.+
T Consensus        17 Vvl~Iigil~~~~~p~~   33 (149)
T COG2165          17 VVLAIIGILAALALPSL   33 (149)
T ss_pred             HHHHHHHHHHHHHHhhh
Confidence            45666666 55555544


No 52 
>KOG2927|consensus
Probab=21.73  E-value=51  Score=25.15  Aligned_cols=19  Identities=16%  Similarity=0.050  Sum_probs=9.9

Q ss_pred             HHHHHHH-hHhccHHHHHHH
Q psy2117           6 LLTLTNI-EVTSLPSFFQLI   24 (81)
Q Consensus         6 ~l~~~Gi-~~~~~p~~i~~~   24 (81)
                      .+++++| +..+||..++..
T Consensus       198 vl~tlaivLFPLWP~~mR~g  217 (372)
T KOG2927|consen  198 VLVTLAIVLFPLWPRRMRQG  217 (372)
T ss_pred             HHHHHHHHhcccCcHHHhcc
Confidence            3444444 555777555444


No 53 
>PF12249 AftA_C:  Arabinofuranosyltransferase A C terminal;  InterPro: IPR020959 The arabinofuranosyltransferase enzyme AftA is involved in cell wall arabinan biosynthesis in bacteria []. It catalyses the addition of the first key arabinofuranosyl residue from the sugar donor beta-D-arabinofuranosyl-1-monophosphoryldecaprenol to the galactan domain of the cell wall, thus priming the galactan for further elaboration by the arabinofuranosyltransferases. As this enzyme is important for cell growth and is found in some important pathogens, such as Mycobacterium tuberculosis, it represents a potential target for the devlopment of new antibacterial drugs. This entry represents the C-terminal domain of AftA.; GO: 0016757 transferase activity, transferring glycosyl groups, 0044038 cell wall macromolecule biosynthetic process, 0005886 plasma membrane, 0016021 integral to membrane
Probab=21.15  E-value=1.1e+02  Score=21.11  Aligned_cols=19  Identities=21%  Similarity=0.623  Sum_probs=13.6

Q ss_pred             ChHHhhCCCCCCceEEeccee
Q psy2117          59 NPEDIRNNETKPNFVEMGPYR   79 (81)
Q Consensus        59 N~~e~l~g~~kp~~~E~GPY~   79 (81)
                      |++-| ... .=.++|+|||+
T Consensus       155 ~~~~F-d~p-~f~v~~vGPFv  173 (178)
T PF12249_consen  155 DPEVF-DDP-RFTVTQVGPFV  173 (178)
T ss_pred             CHHHc-CCC-CCeEeeeCCeE
Confidence            55555 433 57899999997


No 54 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=20.94  E-value=27  Score=22.43  Aligned_cols=14  Identities=21%  Similarity=0.451  Sum_probs=2.1

Q ss_pred             hhhHHHHHHHH-hHh
Q psy2117           2 TVGALLTLTNI-EVT   15 (81)
Q Consensus         2 ~vg~~l~~~Gi-~~~   15 (81)
                      ++|++.+|+|+ +++
T Consensus        28 GIGiL~VILgiLLli   42 (118)
T PF14991_consen   28 GIGILIVILGILLLI   42 (118)
T ss_dssp             SSS------------
T ss_pred             cceeHHHHHHHHHHH
Confidence            57889999999 555


No 55 
>COG3763 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=20.66  E-value=1.5e+02  Score=17.44  Aligned_cols=15  Identities=7%  Similarity=0.098  Sum_probs=8.2

Q ss_pred             HHHHHHHHHHhcccC
Q psy2117          18 PSFFQLILQKELALS   32 (81)
Q Consensus        18 p~~i~~~v~~~~~l~   32 (81)
                      ...++++++++=.+.
T Consensus        26 rk~~~k~lk~NPpin   40 (71)
T COG3763          26 RKQMKKQLKDNPPIN   40 (71)
T ss_pred             HHHHHHHHhhCCCCC
Confidence            455666666654443


No 56 
>TIGR03545 conserved hypothetical protein TIGR03545. This model represents a relatively rare but broadly distributed uncharacterized protein family, distributed in 1-2 percent of bacterial genomes, all of which have outer membranes. In many of these genomes, it is part of a two-gene pair.
Probab=20.17  E-value=1.9e+02  Score=23.06  Aligned_cols=47  Identities=11%  Similarity=0.132  Sum_probs=30.5

Q ss_pred             hccHHHHHHHHHHhcccCCCCcc-ccccccCCcceeEEEEEEeecChH
Q psy2117          15 TSLPSFFQLILQKELALSPWSRS-FKIWRSNPVPIYLDFYFFNWTNPE   61 (81)
Q Consensus        15 ~~~p~~i~~~v~~~~~l~~~s~~-~~~W~~pp~~~~~~~y~fN~TN~~   61 (81)
                      +.+|.+++.++.+.+.=.-|... .+.-.-.+.|.-+++.=+-++||+
T Consensus        23 ~~~dp~~K~~ie~~~seatGreV~Ig~V~lslfpl~l~i~gl~Vanp~   70 (555)
T TIGR03545        23 FFFDPLAKKAIERSLEKAFGAKVEIAQVDTGLFPLQLSIQGLQVTDPD   70 (555)
T ss_pred             HhCCHHHHHHHHHHHHHHHCCeEEEeEEEeeecCCeEEEeeEEEeCCC
Confidence            46788899999888876666553 333222334566666667778886


Done!