Query         psy2132
Match_columns 48
No_of_seqs    69 out of 71
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 16:51:54 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2132.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2132hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08332 CaMKII_AD:  Calcium/ca  99.8 1.5E-19 3.3E-24  111.2   3.0   48    1-48     47-94  (128)
  2 KOG0033|consensus               90.6   0.015 3.3E-07   41.2  -3.4   20   29-48    331-350 (355)
  3 COG1274 PckA Phosphoenolpyruva  53.0      13 0.00028   28.6   2.4   34    5-38    263-301 (608)
  4 cd00819 PEPCK_GTP Phosphoenolp  52.6      12 0.00025   28.7   2.1   34    5-38    241-279 (579)
  5 TIGR02246 conserved hypothetic  52.1      16 0.00034   20.1   2.1   21   19-39     64-84  (128)
  6 PF03185 CaKB:  Calcium-activat  49.8     5.4 0.00012   26.3   0.0   24   23-47    171-194 (201)
  7 PF12190 amfpi-1:  Fungal prote  47.5      11 0.00025   22.4   1.1   16   27-42     51-66  (91)
  8 PF05198 IF3_N:  Translation in  47.3     8.5 0.00018   21.6   0.6   22   16-37      3-24  (76)
  9 PF13711 DUF4160:  Domain of un  42.9      23 0.00049   18.9   1.8    9   26-34     17-25  (66)
 10 COG1279 Lysine efflux permease  40.5     5.4 0.00012   26.7  -1.1   10   21-30    118-127 (202)
 11 PF00586 AIRS:  AIR synthase re  37.9      25 0.00055   19.3   1.5   10   32-41      1-10  (96)
 12 PF04213 HtaA:  Htaa;  InterPro  34.9      81  0.0018   19.7   3.7   24   19-42     77-100 (168)
 13 PRK04210 phosphoenolpyruvate c  34.4      34 0.00074   26.4   2.1   34    5-38    256-294 (601)
 14 PF03389 MobA_MobL:  MobA/MobL   32.2      19 0.00041   23.4   0.5   10   24-33    113-122 (216)
 15 PRK00028 infC translation init  25.5      44 0.00096   21.4   1.3   24   14-37      8-31  (177)
 16 PF14534 DUF4440:  Domain of un  24.5 1.1E+02  0.0025   15.6   3.9   22   19-41     55-76  (107)
 17 PF13577 SnoaL_4:  SnoaL-like d  22.9 1.4E+02   0.003   16.1   3.8   29   18-46     67-95  (127)

No 1  
>PF08332 CaMKII_AD:  Calcium/calmodulin dependent protein kinase II Association;  InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This domain is found at the C terminus of the Calcium/calmodulin dependent protein kinases II (CaMKII). These proteins also have a Ser/Thr protein kinase domain (IPR000719 from INTERPRO) at their N terminus []. The function of the CaMKII association domain is the assembly of the single proteins into large (8 to 14 subunits) multimers [] and is a prominent kinase in the central nervous system that may function in long-term potentiation and neurotransmitter release. ; GO: 0004683 calmodulin-dependent protein kinase activity, 0005516 calmodulin binding, 0006468 protein phosphorylation; PDB: 2W2C_F 3H51_B 3SOA_A 2UX0_A 1HKX_M 2F86_B.
Probab=99.77  E-value=1.5e-19  Score=111.22  Aligned_cols=48  Identities=58%  Similarity=0.863  Sum_probs=46.1

Q ss_pred             CcceeeeeeccCCcCCceeeeEEeCCceEEecCceeEEEEeeeeeecC
Q psy2132           1 MEFHKFYFDNVVGKNCKAVNTTILNPNVHLLGDDAACIAYVRLTQYMD   48 (48)
Q Consensus         1 mdFHkFyFen~~~~~~~~~~ttilnP~V~l~g~~~A~iaY~rLtq~~d   48 (48)
                      +||||||||+.|++..+.+++||++|+||++||++||+||+|++|++|
T Consensus        47 ~~~~~~YF~~~l~~~~~~~~~tI~~p~V~~lg~~~Ai~~gvy~f~~~d   94 (128)
T PF08332_consen   47 LEFHKFYFDHFLAKKPQGVNTTILNPHVRLLGDNAAIDAGVYTFQFVD   94 (128)
T ss_dssp             CHHHHHHHHHTGTTTSSCEEEEEEEEEEEEESTTEEEEEEEEEEEEES
T ss_pred             hHHHHHHHhcccccCCCceeeEecCCeEEEcCCCEEEEeeEEEEEeec
Confidence            689999999999999999999999999999999999999999999976


No 2  
>KOG0033|consensus
Probab=90.63  E-value=0.015  Score=41.23  Aligned_cols=20  Identities=60%  Similarity=1.137  Sum_probs=18.6

Q ss_pred             EEecCceeEEEEeeeeeecC
Q psy2132          29 HLLGDDAACIAYVRLTQYMD   48 (48)
Q Consensus        29 ~l~g~~~A~iaY~rLtq~~d   48 (48)
                      +..|+||||.+|++++|++|
T Consensus       331 ~s~G~daa~ra~s~~~~~~e  350 (355)
T KOG0033|consen  331 HSIGEDAACRAYSKLTQFLD  350 (355)
T ss_pred             cccchhHHHHHHHHHHHhhc
Confidence            78899999999999999986


No 3  
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion]
Probab=52.98  E-value=13  Score=28.57  Aligned_cols=34  Identities=32%  Similarity=0.683  Sum_probs=27.6

Q ss_pred             eeeeeccCCcCCceeeeEEeCC-----ceEEecCceeEE
Q psy2132           5 KFYFDNVVGKNCKAVNTTILNP-----NVHLLGDDAACI   38 (48)
Q Consensus         5 kFyFen~~~~~~~~~~ttilnP-----~V~l~g~~~A~i   38 (48)
                      +.||.-..++..-..++-|+.|     ++.++|||.|-|
T Consensus       263 ~~yftaAFPSacGKTnlAMi~p~~pGWk~~~igDDIawi  301 (608)
T COG1274         263 KYYFTAAFPSACGKTNLAMIPPTIPGWKAETIGDDIAWI  301 (608)
T ss_pred             eEEEEeecccccCccchhhcCCCCCCcceeeccCceeee
Confidence            6788877777777889999999     789999996544


No 4  
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity. PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity, this model describes the GTP-dependent group.
Probab=52.60  E-value=12  Score=28.66  Aligned_cols=34  Identities=35%  Similarity=0.599  Sum_probs=25.9

Q ss_pred             eeeeeccCCcCCceeeeEEeCC-----ceEEecCceeEE
Q psy2132           5 KFYFDNVVGKNCKAVNTTILNP-----NVHLLGDDAACI   38 (48)
Q Consensus         5 kFyFen~~~~~~~~~~ttilnP-----~V~l~g~~~A~i   38 (48)
                      +.|+--..++..-..++.|+.|     +|..+|||.|-+
T Consensus       241 ~~yvaaAFPSaCGKTnlAMl~p~~~gwkv~~vGDDIAwm  279 (579)
T cd00819         241 KKYFAAAFPSACGKTNLAMLIPPLPGWKVETVGDDIAWM  279 (579)
T ss_pred             EEEEEEEcccccccccHhhcCCCCCCceeEEeccceeee
Confidence            4566655566666788999999     899999996543


No 5  
>TIGR02246 conserved hypothetical protein. This family consists of uncharacterized proteins found in a number of genera and species, including Streptomyces, Xanthomonas, Oceanobacillus iheyensis, Caulobacter crescentus CB15, and Xylella fastidiosa. The function is unknown.
Probab=52.08  E-value=16  Score=20.06  Aligned_cols=21  Identities=33%  Similarity=0.349  Sum_probs=15.0

Q ss_pred             eeeEEeCCceEEecCceeEEE
Q psy2132          19 VNTTILNPNVHLLGDDAACIA   39 (48)
Q Consensus        19 ~~ttilnP~V~l~g~~~A~ia   39 (48)
                      .+.++.++++.+.|++.|.+.
T Consensus        64 ~~~~~~~~~i~~~~~~~A~~~   84 (128)
T TIGR02246        64 TRVTIDVIEVRFLGPDLAIVH   84 (128)
T ss_pred             cEEEeeeEEEEecCCCEEEEE
Confidence            345677778999998777543


No 6  
>PF03185 CaKB:  Calcium-activated potassium channel, beta subunit;  InterPro: IPR003930 Potassium channels are the most diverse group of the ion channel family [, ]. They are important in shaping the action potential, and in neuronal excitability and plasticity []. The potassium channel family is composed of several functionally distinct isoforms, which can be broadly separated into 2 groups []: the practically non-inactivating 'delayed' group and the rapidly inactivating 'transient' group. These are all highly similar proteins, with only small amino acid changes causing the diversity of the voltage-dependent gating mechanism, channel conductance and toxin binding properties. Each type of K+ channel is activated by different signals and conditions depending on their type of regulation: some open in response to depolarisation of the plasma membrane; others in response to hyperpolarisation or an increase in intracellular calcium concentration; some can be regulated by binding of a transmitter, together with intracellular kinases; while others are regulated by GTP-binding proteins or other second messengers []. In eukaryotic cells, K+ channels are involved in neural signalling and generation of the cardiac rhythm, act as effectors in signal transduction pathways involving G protein-coupled receptors (GPCRs) and may have a role in target cell lysis by cytotoxic T-lymphocytes []. In prokaryotic cells, they play a role in the maintenance of ionic homeostasis [].  All K+ channels discovered so far possess a core of alpha subunits, each comprising either one or two copies of a highly conserved pore loop domain (P-domain). The P-domain contains the sequence (T/SxxTxGxG), which has been termed the K+ selectivity sequence. In families that contain one P-domain, four subunits assemble to form a selective pathway for K+ across the membrane. However, it remains unclear how the 2 P-domain subunits assemble to form a selective pore. The functional diversity of these families can arise through homo- or hetero-associations of alpha subunits or association with auxiliary cytoplasmic beta subunits. K+ channel subunits containing one pore domain can be assigned into one of two superfamilies: those that possess six transmembrane (TM) domains and those that possess only two TM domains. The six TM domain superfamily can be further subdivided into conserved gene families: the voltage-gated (Kv) channels; the KCNQ channels (originally known as KvLQT channels); the EAG-like K+ channels; and three types of calcium (Ca)-activated K+ channels (BK, IK and SK) []. The 2TM domain family comprises inward-rectifying K+ channels. In addition, there are K+ channel alpha-subunits that possess two P-domains. These are usually highly regulated K+ selective leak channels. Ca2+-activated K+ channels are a diverse group of channels that are activated by an increase in intracellular Ca2+ concentration. They are found in the majority of nerve cells, where they modulate cell excitability and action potential. Three types of Ca2+-activated K+ channel have been characterised, termed small-conductance (SK), intermediate conductance (IK) and large conductance (BK) respectively []. BK channels (also referred to as maxi-K channels) are widely expressed in the body, being found in glandular tissue, smooth and skeletal muscle, as well as in neural tissues. They have been demonstrated to regulate arteriolar and airway diameter, and also neurotransmitter release. Each channel complex is thought to be composed of 2 types of subunit: the pore- forming (alpha) subunits and smaller accessory (beta) subunits.  The beta subunit (which is thought to possess 2 TM domains) increases the Ca2+ sensitivity of the BK channel []. It does this by enhancing the time spent by the channel in burst-like open states. However, it has little effect on the durations of closed intervals between bursts, or on the numbers of open and closed states entered during gating []. ; GO: 0015269 calcium-activated potassium channel activity, 0006813 potassium ion transport, 0016020 membrane; PDB: 1JO6_A.
Probab=49.84  E-value=5.4  Score=26.31  Aligned_cols=24  Identities=38%  Similarity=0.718  Sum_probs=0.0

Q ss_pred             EeCCceEEecCceeEEEEeeeeeec
Q psy2132          23 ILNPNVHLLGDDAACIAYVRLTQYM   47 (48)
Q Consensus        23 ilnP~V~l~g~~~A~iaY~rLtq~~   47 (48)
                      ++=|-+-++|. +++++.++|||++
T Consensus       171 lfWP~l~lvgG-~liv~mvk~~q~l  194 (201)
T PF03185_consen  171 LFWPSLMLVGG-VLIVAMVKLTQYL  194 (201)
T ss_dssp             -------------------------
T ss_pred             HHHHHHHHHHH-HHHHHHHHHHHHH
Confidence            44488988877 5899999999986


No 7  
>PF12190 amfpi-1:  Fungal protease inhibitor;  InterPro: IPR021066 This entry represents fungal proteinase inhibitors, which are found primarily in Antheraea mylitta (Tasar silkworm); they belong to MEROPS inhibitor family I83, clan JH. They inhibits trypsin and chymotrypsin proteases from the fungi Aspergillus oryzae and Rhizopus oryzae. However they do not inhibit papain-like proteases from the bacterium Bacillus licheniformis []. ; PDB: 3BT4_A.
Probab=47.49  E-value=11  Score=22.35  Aligned_cols=16  Identities=50%  Similarity=0.939  Sum_probs=7.5

Q ss_pred             ceEEecCceeEEEEee
Q psy2132          27 NVHLLGDDAACIAYVR   42 (48)
Q Consensus        27 ~V~l~g~~~A~iaY~r   42 (48)
                      -|-|+||.+||-.|..
T Consensus        51 CVTlL~E~aaCK~YSK   66 (91)
T PF12190_consen   51 CVTLLGENAACKTYSK   66 (91)
T ss_dssp             EEEEE-TT-B----BT
T ss_pred             HHHhhccCchHhHHHH
Confidence            3678999999999863


No 8  
>PF05198 IF3_N:  Translation initiation factor IF-3, N-terminal domain;  InterPro: IPR019814 Initiation factor 3 (IF-3) (gene infC) is one of the three factors required for the initiation of protein biosynthesis in bacteria. IF-3 is thought to function as a fidelity factor during the assembly of the ternary initiation complex which consist of the 30S ribosomal subunit, the initiator tRNA and the messenger RNA. IF-3 is a basic protein that binds to the 30S ribosomal subunit []. The chloroplast initiation factor IF-3(chl) is a protein that enhances the poly(A,U,G)-dependent binding of the initiator tRNA to chloroplast ribosomal 30s subunits in which the central section is evolutionary related to the sequence of bacterial IF-3 []. ; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1TIF_A.
Probab=47.33  E-value=8.5  Score=21.65  Aligned_cols=22  Identities=27%  Similarity=0.442  Sum_probs=11.5

Q ss_pred             CceeeeEEeCCceEEecCceeE
Q psy2132          16 CKAVNTTILNPNVHLLGDDAAC   37 (48)
Q Consensus        16 ~~~~~ttilnP~V~l~g~~~A~   37 (48)
                      ..++|-.|..|.|+|+|+++=-
T Consensus         3 ~~~iNe~I~~~~VrlI~~~g~~   24 (76)
T PF05198_consen    3 KPRINEEIRAPEVRLIDEDGEQ   24 (76)
T ss_dssp             ---BGGG---SEEEEE-TTS-E
T ss_pred             CCCCCCCcCCCEEEEECCCCcE
Confidence            4566777889999999988644


No 9  
>PF13711 DUF4160:  Domain of unknown function (DUF4160)
Probab=42.94  E-value=23  Score=18.86  Aligned_cols=9  Identities=33%  Similarity=0.519  Sum_probs=7.2

Q ss_pred             CceEEecCc
Q psy2132          26 PNVHLLGDD   34 (48)
Q Consensus        26 P~V~l~g~~   34 (48)
                      ||||+...+
T Consensus        17 pHvHv~~g~   25 (66)
T PF13711_consen   17 PHVHVRYGG   25 (66)
T ss_pred             CeEEEEcCC
Confidence            899998555


No 10 
>COG1279 Lysine efflux permease [General function prediction only]
Probab=40.51  E-value=5.4  Score=26.68  Aligned_cols=10  Identities=60%  Similarity=0.903  Sum_probs=8.5

Q ss_pred             eEEeCCceEE
Q psy2132          21 TTILNPNVHL   30 (48)
Q Consensus        21 ttilnP~V~l   30 (48)
                      .|++||||.+
T Consensus       118 vT~LNPhvyL  127 (202)
T COG1279         118 VTLLNPHVYL  127 (202)
T ss_pred             HHHhCchhhh
Confidence            5899999975


No 11 
>PF00586 AIRS:  AIR synthase related protein, N-terminal domain;  InterPro: IPR000728 This family includes Hydrogen expression/formation protein, HypE, which may be involved in the maturation of NifE hydrogenase; AIR synthase and FGAM synthase, which are involved in de novo purine biosynthesis; and selenide, water dikinase, an enzyme which synthesizes selenophosphate from selenide and ATP.; GO: 0003824 catalytic activity; PDB: 3VIU_A 2Z1T_A 2Z1U_A 3C9U_B 3C9S_A 3C9R_A 1VQV_A 3C9T_B 3M84_A 3QTY_A ....
Probab=37.92  E-value=25  Score=19.28  Aligned_cols=10  Identities=60%  Similarity=0.723  Sum_probs=7.1

Q ss_pred             cCceeEEEEe
Q psy2132          32 GDDAACIAYV   41 (48)
Q Consensus        32 g~~~A~iaY~   41 (48)
                      |||||++..-
T Consensus         1 GdDaavi~~~   10 (96)
T PF00586_consen    1 GDDAAVIRIP   10 (96)
T ss_dssp             TSSSEEEEET
T ss_pred             CCceEEEEcC
Confidence            6788877654


No 12 
>PF04213 HtaA:  Htaa;  InterPro: IPR007331 This domain is found in HtaA, a secreted protein implicated in iron acquisition and transport [].
Probab=34.92  E-value=81  Score=19.73  Aligned_cols=24  Identities=29%  Similarity=0.367  Sum_probs=19.5

Q ss_pred             eeeEEeCCceEEecCceeEEEEee
Q psy2132          19 VNTTILNPNVHLLGDDAACIAYVR   42 (48)
Q Consensus        19 ~~ttilnP~V~l~g~~~A~iaY~r   42 (48)
                      ...+|.||+|.+-|..+.+.+=+.
T Consensus        77 Ldlt~snp~I~~~g~~g~L~adv~  100 (168)
T PF04213_consen   77 LDLTISNPRIVFDGGTGTLYADVS  100 (168)
T ss_pred             EEEEEeCCEEEEECCeEEEEEEEE
Confidence            467999999999999877776554


No 13 
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional
Probab=34.39  E-value=34  Score=26.35  Aligned_cols=34  Identities=38%  Similarity=0.608  Sum_probs=25.2

Q ss_pred             eeeeeccCCcCCceeeeEEeCCc-----eEEecCceeEE
Q psy2132           5 KFYFDNVVGKNCKAVNTTILNPN-----VHLLGDDAACI   38 (48)
Q Consensus         5 kFyFen~~~~~~~~~~ttilnP~-----V~l~g~~~A~i   38 (48)
                      |.|+--..++..-..++.|+.|.     |..+|||.|-+
T Consensus       256 ~~yvaaAFPSaCGKTnlAMl~p~~~gwkv~~VGDDIAwm  294 (601)
T PRK04210        256 KTYFAAAFPSACGKTNLAMLIPPIPGWKVETVGDDIAWI  294 (601)
T ss_pred             EEEEEEecccccccccHhhcCCCCCCceeEEeecceeee
Confidence            45666555666667788899887     89999995543


No 14 
>PF03389 MobA_MobL:  MobA/MobL family;  InterPro: IPR005053 This entry represents a domain found at the N terminus of MobA in Escherichia coli, and MobL in Thiobacillus ferrooxidans (Acidithiobacillus ferrooxidans), as well as in conjugal transfer protein TraA. MobA and MobL are mobilisation proteins, which are essential for specific plasmid transfer.; GO: 0009291 unidirectional conjugation; PDB: 2NS6_A.
Probab=32.18  E-value=19  Score=23.41  Aligned_cols=10  Identities=30%  Similarity=0.564  Sum_probs=7.6

Q ss_pred             eCCceEEecC
Q psy2132          24 LNPNVHLLGD   33 (48)
Q Consensus        24 lnP~V~l~g~   33 (48)
                      -|||+|++-.
T Consensus       113 ~NpHaHim~t  122 (216)
T PF03389_consen  113 RNPHAHIMFT  122 (216)
T ss_dssp             TEEEEEEEE-
T ss_pred             CCCEEEEEee
Confidence            5899999843


No 15 
>PRK00028 infC translation initiation factor IF-3; Reviewed
Probab=25.45  E-value=44  Score=21.44  Aligned_cols=24  Identities=33%  Similarity=0.459  Sum_probs=18.8

Q ss_pred             cCCceeeeEEeCCceEEecCceeE
Q psy2132          14 KNCKAVNTTILNPNVHLLGDDAAC   37 (48)
Q Consensus        14 ~~~~~~~ttilnP~V~l~g~~~A~   37 (48)
                      ++..++|-.|..|.|+++|+++-.
T Consensus         8 ~~~~~iNe~I~~~~Vrli~~dG~~   31 (177)
T PRK00028          8 KKEPRINEQIRAREVRLIGDDGEQ   31 (177)
T ss_pred             cccCCcCcCcCCCEEEEECCCCcC
Confidence            344667888999999999988643


No 16 
>PF14534 DUF4440:  Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A.
Probab=24.51  E-value=1.1e+02  Score=15.62  Aligned_cols=22  Identities=23%  Similarity=0.288  Sum_probs=14.7

Q ss_pred             eeeEEeCCceEEecCceeEEEEe
Q psy2132          19 VNTTILNPNVHLLGDDAACIAYV   41 (48)
Q Consensus        19 ~~ttilnP~V~l~g~~~A~iaY~   41 (48)
                      ...++..+.|+++||. |++.+.
T Consensus        55 ~~~~~~~~~v~~~gd~-a~~~~~   76 (107)
T PF14534_consen   55 SSIKFEDVEVRVLGDT-AVVRGR   76 (107)
T ss_dssp             EEEEEEEEEEEEETTE-EEEEEE
T ss_pred             ceEEEEEEEEEEECCE-EEEEEE
Confidence            3346666899999885 555553


No 17 
>PF13577 SnoaL_4:  SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B.
Probab=22.94  E-value=1.4e+02  Score=16.09  Aligned_cols=29  Identities=34%  Similarity=0.427  Sum_probs=21.7

Q ss_pred             eeeeEEeCCceEEecCceeEEEEeeeeee
Q psy2132          18 AVNTTILNPNVHLLGDDAACIAYVRLTQY   46 (48)
Q Consensus        18 ~~~ttilnP~V~l~g~~~A~iaY~rLtq~   46 (48)
                      ...-.+.||.|.+=||.+-+.+|+-.++.
T Consensus        67 ~~~H~~~~~~v~~dgd~A~~~~~~~~~~~   95 (127)
T PF13577_consen   67 ATRHMVTNPVVDVDGDTATVRSYVLATHR   95 (127)
T ss_dssp             EEEEEEEEEEEEEETTEEEEEEEEEEEEE
T ss_pred             ceeEEccceEEEEcCCEEEEEEEEEEEEE
Confidence            44456789999998988778888766543


Done!