Query         psy2138
Match_columns 208
No_of_seqs    80 out of 82
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 17:00:05 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2138.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2138hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3554|consensus              100.0 1.6E-62 3.4E-67  460.6   5.5  166    4-206   352-526 (693)
  2 smart00401 ZnF_GATA zinc finge  98.9 1.1E-09 2.4E-14   75.8   3.2   46   37-82      3-49  (52)
  3 PF00320 GATA:  GATA zinc finge  98.5 2.5E-08 5.4E-13   64.3   0.8   34   40-73      1-35  (36)
  4 cd00202 ZnF_GATA Zinc finger D  98.5   8E-08 1.7E-12   67.2   2.2   42   39-81      1-43  (54)
  5 PHA00733 hypothetical protein   51.9     6.4 0.00014   31.7   0.7   29  115-145    99-127 (128)
  6 PHA00616 hypothetical protein   51.6     4.6 9.9E-05   27.5  -0.1   22  122-143     6-27  (44)
  7 PF13894 zf-C2H2_4:  C2H2-type   50.9     3.1 6.7E-05   22.4  -0.9   22  117-140     2-23  (24)
  8 TIGR02443 conserved hypothetic  47.5      10 0.00022   27.4   1.1   30   35-64      7-37  (59)
  9 KOG3554|consensus               44.2      16 0.00034   36.5   2.2   45  154-198   559-604 (693)
 10 PF09526 DUF2387:  Probable met  36.2      20 0.00043   26.5   1.2   30   35-64      6-36  (71)
 11 COG5347 GTPase-activating prot  27.7      31 0.00068   32.1   1.3   28   37-65     20-47  (319)
 12 KOG3576|consensus               26.9      21 0.00045   32.3  -0.1   32  111-144   169-200 (267)
 13 PF00096 zf-C2H2:  Zinc finger,  25.5      11 0.00024   20.7  -1.3   17  122-138     5-21  (23)
 14 PF04022 Staphylcoagulse:  Stap  23.1      39 0.00084   20.9   0.7   11    9-19      2-12  (27)
 15 PRK09723 putative fimbrial-lik  22.6      41  0.0009   32.7   1.1   30   45-75    159-196 (421)
 16 KOG3623|consensus               21.9      40 0.00087   35.5   0.9   24  112-137   919-942 (1007)
 17 TIGR03826 YvyF flagellar opero  21.5      54  0.0012   27.1   1.4   27   34-68     78-104 (137)
 18 PF05766 NinG:  Bacteriophage L  21.0      48  0.0011   28.8   1.1   18   36-53     86-103 (189)
 19 PRK08351 DNA-directed RNA poly  20.8      49  0.0011   24.0   0.9   17   37-53     15-32  (61)

No 1  
>KOG3554|consensus
Probab=100.00  E-value=1.6e-62  Score=460.64  Aligned_cols=166  Identities=37%  Similarity=0.671  Sum_probs=144.5

Q ss_pred             ceeecCCCCCCCCCCccC---CCCcccCCCCCCCCCCCCCCCccccCcccceecCCC---cccccccchhhhccCCCCCC
Q psy2138           4 AEVDMAEYNPHDLFFHDV---GPGMVNGANGDVLISNKPCESCNVTVSTNWFPWYSG---TKICINCHAFWRKYGGLKIP   77 (208)
Q Consensus         4 kQVYIP~YnKPNPn~I~~---~~g~~NG~~g~~~~~g~~CEsC~t~~S~QWYsWGP~---cRLC~sCW~YWKKYGGLK~p   77 (208)
                      ||||||+|||||||||++   ++| |||++.. .+.|++||||||+||.|||+|||+   ||||++||+|||||||||||
T Consensus       352 kqvYIP~ynKPnpnqI~~~n~k~g-~~gtt~~-~~~g~~CEsC~ttqs~qWYsWGppnmqcrLCasCWiyWKKygGLk~p  429 (693)
T KOG3554|consen  352 KQVYIPTYNKPNPNQISPYNTKPG-MNGTTFQ-NQDGRACESCYTTQSLQWYSWGPPNMQCRLCASCWIYWKKYGGLKMP  429 (693)
T ss_pred             heeeccCCCCCCcceecccCCCcC-ccccccc-CCCCCcccccccccccceeccCCCCccchhhHHHHHHHHHhcCcCCc
Confidence            899999999999999987   555 7886422 245999999999999999999999   99999999999999999999


Q ss_pred             ccCCCCCCCccCCCCCCCCCCCcccccCCCCCCCCCCCCccCCCCCchhhhhhhhhcccccccCCcccC-CCC--CCCcc
Q psy2138          78 GKLSDGELDYLKPNKKSGSSSLSEEDRIGPSGLVGHRPHRCSVPGCSKEFKLKAHLHRHLATGHGLVAR-PGS--PRPIM  154 (208)
Q Consensus        78 ~~~e~~~~~~~~~~~~s~~~~~~~~~~~~p~~~~~~~~~~~~i~~~~ke~~~r~hl~R~~~~~~g~~~r-~g~--p~~~~  154 (208)
                      |++|+++...                    +..++             +...+.|++|.  +.||++++ +|+  |+..+
T Consensus       430 tqle~~~~~~--------------------~p~~e-------------~p~~r~~~Sr~--~p~s~~a~~t~a~~~k~~~  474 (693)
T KOG3554|consen  430 TQLEGEDKGP--------------------PPPVE-------------PPAPRSHASRG--TPQSLPARATGAVNPKTAQ  474 (693)
T ss_pred             chhccccCCC--------------------CCCCC-------------CCCCCccccCC--CcccCCcccccccCcccHH
Confidence            9999887431                    00111             22347889987  78888888 666  89999


Q ss_pred             cccceEEEecChhhHHHHHhhhcccChhhhhcCCCcccCHHHHHhhhhhhcc
Q psy2138         155 KTRNAFYLRATPLTRISRRLCRHVIQPRHAARSPFWCINIAAVKTDCEYIES  206 (208)
Q Consensus       155 KTR~AF~L~Tt~~tRlARrlck~~~~~R~aARrPf~~IN~~aIk~ec~~r~~  206 (208)
                      ||||+|+|+||.|||||||+|+++||+|++|||||.+||.++||+||++|++
T Consensus       475 k~rQ~f~l~tt~lt~lar~~crnlL~~~~Aarrp~~~in~~aikae~a~r~~  526 (693)
T KOG3554|consen  475 KTRQAFALHTTKLTRLARRDCRNLLRPREAARRPYTPINFAAIKAECAQRLP  526 (693)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhcCHHHHhhCccchhhHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999998864


No 2  
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=98.89  E-value=1.1e-09  Score=75.85  Aligned_cols=46  Identities=33%  Similarity=0.711  Sum_probs=40.9

Q ss_pred             CCCCCCccccCcccceecCCC-cccccccchhhhccCCCCCCccCCC
Q psy2138          37 NKPCESCNVTVSTNWFPWYSG-TKICINCHAFWRKYGGLKIPGKLSD   82 (208)
Q Consensus        37 g~~CEsC~t~~S~QWYsWGP~-cRLC~sCW~YWKKYGGLK~p~~~e~   82 (208)
                      ++.|++|+++++++|..+... ..||..|++||+|+|.++.|..++.
T Consensus         3 ~~~C~~C~~~~T~~WR~g~~g~~~LCnaCgl~~~k~~~~~rp~~~~~   49 (52)
T smart00401        3 GRSCSNCGTTETPLWRRGPSGNKTLCNACGLYYKKHGGLKRPLSLKK   49 (52)
T ss_pred             CCCcCCCCCCCCCccccCCCCCCcEeecccHHHHHcCCCCCcccccc
Confidence            688999999999999884444 6999999999999999999988864


No 3  
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=98.53  E-value=2.5e-08  Score=64.29  Aligned_cols=34  Identities=29%  Similarity=0.846  Sum_probs=25.7

Q ss_pred             CCCccccCcccceecCCC-cccccccchhhhccCC
Q psy2138          40 CESCNVTVSTNWFPWYSG-TKICINCHAFWRKYGG   73 (208)
Q Consensus        40 CEsC~t~~S~QWYsWGP~-cRLC~sCW~YWKKYGG   73 (208)
                      |++|.+++|++|...... ..||..|++||||||.
T Consensus         1 C~~C~tt~t~~WR~~~~g~~~LCn~Cg~~~kk~~~   35 (36)
T PF00320_consen    1 CSNCGTTETPQWRRGPNGNRTLCNACGLYYKKYGK   35 (36)
T ss_dssp             -TTT--ST-SSEEEETTSEE-EEHHHHHHHHHHSS
T ss_pred             CcCCcCCCCchhhcCCCCCCHHHHHHHHHHHHhCC
Confidence            899999999999996545 4499999999999984


No 4  
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=98.47  E-value=8e-08  Score=67.19  Aligned_cols=42  Identities=29%  Similarity=0.698  Sum_probs=34.5

Q ss_pred             CCCCccccCcccceecCCC-cccccccchhhhccCCCCCCccCC
Q psy2138          39 PCESCNVTVSTNWFPWYSG-TKICINCHAFWRKYGGLKIPGKLS   81 (208)
Q Consensus        39 ~CEsC~t~~S~QWYsWGP~-cRLC~sCW~YWKKYGGLK~p~~~e   81 (208)
                      .|++|++++++||..+... ..||..|++||+||| ...|..+.
T Consensus         1 ~C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~~-~~rp~~~~   43 (54)
T cd00202           1 ACSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKHG-VMRPLSKR   43 (54)
T ss_pred             CCCCCCCCCCcccccCCCCcchHHHHHHHHHHhcC-CCCCcccC
Confidence            4999999999999995424 899999999999998 44455544


No 5  
>PHA00733 hypothetical protein
Probab=51.93  E-value=6.4  Score=31.66  Aligned_cols=29  Identities=28%  Similarity=0.603  Sum_probs=20.3

Q ss_pred             CCccCCCCCchhhhhhhhhcccccccCCccc
Q psy2138         115 PHRCSVPGCSKEFKLKAHLHRHLATGHGLVA  145 (208)
Q Consensus       115 ~~~~~i~~~~ke~~~r~hl~R~~~~~~g~~~  145 (208)
                      ++.|.+  |++.|....+|.+|..+.|++.|
T Consensus        99 ~~~C~~--CgK~F~~~~sL~~H~~~~h~~~~  127 (128)
T PHA00733         99 SKVCPV--CGKEFRNTDSTLDHVCKKHNICV  127 (128)
T ss_pred             CccCCC--CCCccCCHHHHHHHHHHhcCccc
Confidence            355654  77777777777777777777654


No 6  
>PHA00616 hypothetical protein
Probab=51.60  E-value=4.6  Score=27.53  Aligned_cols=22  Identities=27%  Similarity=0.428  Sum_probs=19.7

Q ss_pred             CCchhhhhhhhhcccccccCCc
Q psy2138         122 GCSKEFKLKAHLHRHLATGHGL  143 (208)
Q Consensus       122 ~~~ke~~~r~hl~R~~~~~~g~  143 (208)
                      -||+.|.-+++|.+|..+.||.
T Consensus         6 ~CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          6 RCGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             hhhHHHhhHHHHHHHHHHhcCC
Confidence            4999999999999999888884


No 7  
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=50.89  E-value=3.1  Score=22.43  Aligned_cols=22  Identities=36%  Similarity=0.901  Sum_probs=15.3

Q ss_pred             ccCCCCCchhhhhhhhhccccccc
Q psy2138         117 RCSVPGCSKEFKLKAHLHRHLATG  140 (208)
Q Consensus       117 ~~~i~~~~ke~~~r~hl~R~~~~~  140 (208)
                      .|.+  |++.|..+..|.+|..+.
T Consensus         2 ~C~~--C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    2 QCPI--CGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             E-SS--TS-EESSHHHHHHHHHHH
T ss_pred             CCcC--CCCcCCcHHHHHHHHHhh
Confidence            4555  999999988888886543


No 8  
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=47.51  E-value=10  Score=27.44  Aligned_cols=30  Identities=17%  Similarity=0.433  Sum_probs=25.3

Q ss_pred             CCCCCCCCccccCcccceecCCC-ccccccc
Q psy2138          35 ISNKPCESCNVTVSTNWFPWYSG-TKICINC   64 (208)
Q Consensus        35 ~~g~~CEsC~t~~S~QWYsWGP~-cRLC~sC   64 (208)
                      .-|-.|-.|.++++..||.=... .+.|..|
T Consensus         7 IAGA~CP~C~~~Dtl~~~~e~~~e~vECv~C   37 (59)
T TIGR02443         7 IAGAVCPACSAQDTLAMWKENNIELVECVEC   37 (59)
T ss_pred             eccccCCCCcCccEEEEEEeCCceEEEeccC
Confidence            34677999999999999986666 8888888


No 9  
>KOG3554|consensus
Probab=44.17  E-value=16  Score=36.54  Aligned_cols=45  Identities=13%  Similarity=0.080  Sum_probs=37.8

Q ss_pred             ccccceEEEecChhhHHHHHhh-hcccChhhhhcCCCcccCHHHHH
Q psy2138         154 MKTRNAFYLRATPLTRISRRLC-RHVIQPRHAARSPFWCINIAAVK  198 (208)
Q Consensus       154 ~KTR~AF~L~Tt~~tRlARrlc-k~~~~~R~aARrPf~~IN~~aIk  198 (208)
                      ..+|.+..|.|+.+.|++|++- .+.+.+++.+++|...||...|.
T Consensus       559 ~~~k~~~~~lt~i~rr~~~~in~~s~~il~Krsy~~~~g~d~~~~l  604 (693)
T KOG3554|consen  559 PATKSTISFLTPICRRALRRINPGSAFILGKRSYEPHNGIDDEKIL  604 (693)
T ss_pred             CCCCccceeeccchHhhhcccCCCcchhhhhhccccccCCcchhhh
Confidence            4556666666999999999988 88999999999999999966554


No 10 
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=36.25  E-value=20  Score=26.52  Aligned_cols=30  Identities=17%  Similarity=0.398  Sum_probs=24.9

Q ss_pred             CCCCCCCCccccCcccceecCCC-ccccccc
Q psy2138          35 ISNKPCESCNVTVSTNWFPWYSG-TKICINC   64 (208)
Q Consensus        35 ~~g~~CEsC~t~~S~QWYsWGP~-cRLC~sC   64 (208)
                      .-|-.|-.|.++++..||.=... .+-|..|
T Consensus         6 IAGa~CP~C~~~D~i~~~~e~~ve~vECV~C   36 (71)
T PF09526_consen    6 IAGAVCPKCQAMDTIMMWRENGVEYVECVEC   36 (71)
T ss_pred             ecCccCCCCcCccEEEEEEeCCceEEEecCC
Confidence            34677999999999999875556 8999988


No 11 
>COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion]
Probab=27.66  E-value=31  Score=32.14  Aligned_cols=28  Identities=32%  Similarity=0.828  Sum_probs=24.5

Q ss_pred             CCCCCCccccCcccceecCCCcccccccc
Q psy2138          37 NKPCESCNVTVSTNWFPWYSGTKICINCH   65 (208)
Q Consensus        37 g~~CEsC~t~~S~QWYsWGP~cRLC~sCW   65 (208)
                      .+-|--|.+.. .||-+|.=.+-||..|=
T Consensus        20 Nk~CaDCga~~-P~W~S~nlGvfiCi~Ca   47 (319)
T COG5347          20 NKKCADCGAPN-PTWASVNLGVFLCIDCA   47 (319)
T ss_pred             cCccccCCCCC-CceEecccCeEEEeecc
Confidence            47799999999 99999998888888883


No 12 
>KOG3576|consensus
Probab=26.92  E-value=21  Score=32.29  Aligned_cols=32  Identities=41%  Similarity=0.831  Sum_probs=26.9

Q ss_pred             CCCCCCccCCCCCchhhhhhhhhcccccccCCcc
Q psy2138         111 VGHRPHRCSVPGCSKEFKLKAHLHRHLATGHGLV  144 (208)
Q Consensus       111 ~~~~~~~~~i~~~~ke~~~r~hl~R~~~~~~g~~  144 (208)
                      ++-||.+|++  |.|.|.-|-.|.-|+...||++
T Consensus       169 tgvrpykc~~--c~kaftqrcsleshl~kvhgv~  200 (267)
T KOG3576|consen  169 TGVRPYKCSL--CEKAFTQRCSLESHLKKVHGVQ  200 (267)
T ss_pred             cCccccchhh--hhHHHHhhccHHHHHHHHcCch
Confidence            3448999998  9999999988888888889874


No 13 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=25.48  E-value=11  Score=20.70  Aligned_cols=17  Identities=41%  Similarity=0.761  Sum_probs=14.2

Q ss_pred             CCchhhhhhhhhccccc
Q psy2138         122 GCSKEFKLKAHLHRHLA  138 (208)
Q Consensus       122 ~~~ke~~~r~hl~R~~~  138 (208)
                      .|++.|..+..|.+|..
T Consensus         5 ~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    5 ICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             TTTEEESSHHHHHHHHH
T ss_pred             CCCCccCCHHHHHHHHh
Confidence            59999999998988854


No 14 
>PF04022 Staphylcoagulse:  Staphylocoagulase repeat;  InterPro: IPR001443 Staphylocoagulase is an extracellular protein produced by several strains of Staphylococcus aureus and which specifically forms a complex with prothrombin [, ]. This complex named staphylothrombin can clot fibrinogen without any proteolytic cleavage of prothrombin. The C terminus of staphylocoagulase contains the tandem repeat which does not seem to be required for the procoagulant activity.
Probab=23.13  E-value=39  Score=20.85  Aligned_cols=11  Identities=18%  Similarity=0.054  Sum_probs=8.3

Q ss_pred             CCCCCCCCCCc
Q psy2138           9 AEYNPHDLFFH   19 (208)
Q Consensus         9 P~YnKPNPn~I   19 (208)
                      |+||||.--..
T Consensus         2 p~~nkps~tna   12 (27)
T PF04022_consen    2 PTYNKPSETNA   12 (27)
T ss_pred             CcccCcccccc
Confidence            89999976544


No 15 
>PRK09723 putative fimbrial-like adhesin protein; Provisional
Probab=22.60  E-value=41  Score=32.67  Aligned_cols=30  Identities=20%  Similarity=0.541  Sum_probs=20.8

Q ss_pred             ccCcccceecCCC--------cccccccchhhhccCCCC
Q psy2138          45 VTVSTNWFPWYSG--------TKICINCHAFWRKYGGLK   75 (208)
Q Consensus        45 t~~S~QWYsWGP~--------cRLC~sCW~YWKKYGGLK   75 (208)
                      ..++.||+.|-.+        |+.|.+=|-||- +||+=
T Consensus       159 ~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~y~~-~gg~~  196 (421)
T PRK09723        159 GDSSEQYFNWSNPSEDTLYWSCNNANSTNKYWA-VGGIV  196 (421)
T ss_pred             cCCcceeEeccCCcHHHhhhhhhccccchhhee-cccEE
Confidence            3455699999988        555555577884 67653


No 16 
>KOG3623|consensus
Probab=21.89  E-value=40  Score=35.47  Aligned_cols=24  Identities=50%  Similarity=0.995  Sum_probs=21.3

Q ss_pred             CCCCCccCCCCCchhhhhhhhhcccc
Q psy2138         112 GHRPHRCSVPGCSKEFKLKAHLHRHL  137 (208)
Q Consensus       112 ~~~~~~~~i~~~~ke~~~r~hl~R~~  137 (208)
                      +.|||.|.|  |-|.||-|.||-.|-
T Consensus       919 GqRPyqC~i--CkKAFKHKHHLtEHk  942 (1007)
T KOG3623|consen  919 GQRPYQCII--CKKAFKHKHHLTEHK  942 (1007)
T ss_pred             CCCCcccch--hhHhhhhhhhhhhhh
Confidence            348999998  999999999999884


No 17 
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=21.54  E-value=54  Score=27.05  Aligned_cols=27  Identities=22%  Similarity=0.610  Sum_probs=20.3

Q ss_pred             CCCCCCCCCccccCcccceecCCCcccccccchhh
Q psy2138          34 LISNKPCESCNVTVSTNWFPWYSGTKICINCHAFW   68 (208)
Q Consensus        34 ~~~g~~CEsC~t~~S~QWYsWGP~cRLC~sCW~YW   68 (208)
                      .+.+.+||+|+++--.        -|+|.+|-..=
T Consensus        78 ~nl~~~CE~CG~~I~~--------Gr~C~~C~~~l  104 (137)
T TIGR03826        78 PNLGYPCERCGTSIRE--------GRLCDSCAGEL  104 (137)
T ss_pred             CCCcCcccccCCcCCC--------CCccHHHHHHH
Confidence            4568999999987433        38899997654


No 18 
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=20.97  E-value=48  Score=28.83  Aligned_cols=18  Identities=33%  Similarity=0.765  Sum_probs=14.3

Q ss_pred             CCCCCCCccccCccccee
Q psy2138          36 SNKPCESCNVTVSTNWFP   53 (208)
Q Consensus        36 ~g~~CEsC~t~~S~QWYs   53 (208)
                      .|.+|.||++..+.||-+
T Consensus        86 ~~~~CiSCG~~~~~~~da  103 (189)
T PF05766_consen   86 AGKPCISCGRKHGGQWDA  103 (189)
T ss_pred             cCCCcccCCCcCCCCccc
Confidence            478999999977777754


No 19 
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=20.77  E-value=49  Score=23.98  Aligned_cols=17  Identities=29%  Similarity=0.821  Sum_probs=13.9

Q ss_pred             CCCCCCccccC-ccccee
Q psy2138          37 NKPCESCNVTV-STNWFP   53 (208)
Q Consensus        37 g~~CEsC~t~~-S~QWYs   53 (208)
                      +..|+.|++.+ +.+|+-
T Consensus        15 ~~~CP~Cgs~~~T~~W~G   32 (61)
T PRK08351         15 EDRCPVCGSRDLSDEWFD   32 (61)
T ss_pred             CCcCCCCcCCcccccccc
Confidence            34699999998 889974


Done!