Diaphorina citri psyllid: psy2144


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MRITTNDVTGTEVECMATEMSKVIPTPRSWPIFGTLISILKEGGGKQLHRYVEKRHQELGPIYKEKIGPVEAYFLNDTADVRKVFALEGTYPKHILPQCWEKYRKLYGCDRGLYFMDGPEWMKYRKIMNKYLLKNYSAGPQQELTKELFKAFEHDIVESTKANNKPIIIAHMLGTPFISHYKELSKEIHDLSQVVHKIFEHSAALSMLPINLSIKLKLSAWTKFVESVHQSLALASELLHKMEPFNGDGLSSKLKEVENVSPESIRRMVIDFILAAGDTTAISTQWIFYLLGRHPSVQDQLYQELQKNNDCLNNEIINHVIREGLRMYPIAPFITRFMPKDVEIRGYLIPKGSLVLLSVFSSSHNPAYFPSPEQFQPSRWKRDANKKYINVVEPYASLPYAMGARSCVGRKLAQTQMCLTIAQ
cccccccccccccccccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHccccEEEccccccEEEECcHHHHHHHHHHcccccccccccHHHHHHHHccccccccccccHHHHHHHHHcccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccCCccccEEEccEECccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcc
************VECMATEMSKVIPTPRSWPIFGTLISILKEGGGKQLHRYVEKRHQELGPIYKEKIGPVEAYFLNDTADVRKVFALEGTYPKHILPQCWEKYRKLYGCDRGLYFMDGPEWMKYRKIMNKYLLKNYSAGPQQELTKELFKAFEHDIVESTKANNKPIIIAHMLGTPFISHYKELSKEIHDLSQVVHKIFEHSAALSMLPINLSIKLKLSAWTKFVESVHQSLALASELLHK**********************SIRRMVIDFILAAGDTTAISTQWIFYLLGRHPSVQDQLYQELQKNNDCLNNEIINHVIREGLRMYPIAPFITRFMPKDVEIRGYLIPKGSLVLLSVFSSSHNPAYFPSPEQFQPSRWKRDANKKYINVVEPYASLPYAMGARSCVGRKLAQTQMCLTIAQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRITTNDVTGTEVECMATEMSKVIPTPRSWPIFGTLISILKEGGGKQLHRYVEKRHQELGPIYKEKIGPVEAYFLNDTADVRKVFALEGTYPKHILPQCWEKYRKLYGCDRGLYFMDGPEWMKYRKIMNKYLLKNYSAGPQQELTKELFKAFEHDIVESTKANNKPIIIAHMLGTPFISHYKELSKEIHDLSQVVHKIFEHSAALSMLPINLSIKLKLSAWTKFVESVHQSLALASELLHKMEPFNGDGLSSKLKEVENVSPESIRRMVIDFILAAGDTTAISTQWIFYLLGRHPSVQDQLxxxxxxxxxxxxxxxxxxxxxEGLRMYPIAPFITRFMPKDVEIRGYLIPKGSLVLLSVFSSSHNPAYFPSPEQFQPSRWKRDANKKYINVVEPYASLPYAMGARSCVGRKLAQTQMCLTIAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome P450 315a1, mitochondrial Required for CNS development: midline glial cells. Involved in the metabolism of insect hormones: responsible for ecdysteroid C2-hydroxylase activity. May be involved in the breakdown of synthetic insecticides.confidentQ9VGH1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0008395 [MF]steroid hydroxylase activityprobableGO:0003824, GO:0004497, GO:0003674, GO:0016491
GO:0010295 [MF](+)-abscisic acid 8'-hydroxylase activityprobableGO:0004497, GO:0016709, GO:0016705, GO:0003824, GO:0003674, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K9V, chain A
Confidence level:very confident
Coverage over the Query: 17-423
View the alignment between query and template
View the model in PyMOL