Diaphorina citri psyllid: psy2154


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MEYIERTKLMMGSGSSDRMDSRPPRLPSMGLGHINSCSEKVATRRANERREQYRQVRAHVRKDDGRLQAYGWSLPAKLTSTPPVHPLPPPSSSAQVPVPVPVYCRPLTEKEPGMKVSVPQEMAIGDFV
cccHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEECcccccccccccccccccccccccccccccEEEEccccccccccEEEECccccccccc
*********************************************************AHVRKDDGRLQAYGWSLPA***********************VPVYCRPLTEKEPGMKVSVPQEMAIGDFV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYIERTKLMMGSGSSDRMDSRPPRLPSMGLGHINSCSEKVATRRANERREQYRQVRAHVRKDDGRLQAYGWSLPAKLTSTPPVHPLPPPSSSAQVPVPVPVYCRPLTEKEPGMKVSVPQEMAIGDFV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
JNK-interacting protein 3 The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK-signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins. Syd is required for efficient kinesin-I mediated axonal transport.confidentQ9GQF1
JNK-interacting protein 3 The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK-signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins. Syd is required for efficient kinesin-I mediated axonal transport.confidentQ29EP6
C-Jun-amino-terminal kinase-interacting protein 3 The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins.confidentQ9UPT6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted