Query         psy2194
Match_columns 92
No_of_seqs    106 out of 120
Neff          2.4 
Searched_HMMs 46136
Date          Fri Aug 16 18:38:12 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2194.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2194hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04180 LTV:  Low temperature   99.7   4E-18 8.7E-23  136.9   4.0   35   54-88      1-35  (421)
  2 KOG2637|consensus               99.6 8.3E-17 1.8E-21  134.0   2.1   42   47-88      1-42  (446)
  3 PF07635 PSCyt1:  Planctomycete  61.5     6.8 0.00015   23.8   1.8   25   23-47     32-58  (59)
  4 COG5030 APS2 Clathrin adaptor   56.6      18 0.00038   27.6   3.6   53   12-67      3-61  (152)
  5 TIGR03806 chp_HNE_0200 conserv  38.6      21 0.00045   28.9   1.7   28   22-49    270-299 (317)
  6 PF03529 TF_Otx:  Otx1 transcri  38.1      12 0.00025   26.2   0.2   10    7-16     51-60  (88)
  7 COG4295 Uncharacterized protei  37.0     6.8 0.00015   32.1  -1.2   27   37-75    123-149 (285)
  8 cd01802 AN1_N ubiquitin-like d  33.9      39 0.00085   22.7   2.2   24   44-67      1-24  (103)
  9 PF10984 DUF2794:  Protein of u  25.0      59  0.0013   22.4   1.9   20   55-74     32-51  (85)
 10 PF14747 DUF4473:  Domain of un  18.7      34 0.00073   22.2  -0.3   10   27-36     68-77  (82)

No 1  
>PF04180 LTV:  Low temperature viability protein ;  InterPro: IPR007307 The low-temperature viability protein LTV1 was identified in Saccharomyces cerevisiae, the exact function of this protein is unknown. 
Probab=99.71  E-value=4e-18  Score=136.93  Aligned_cols=35  Identities=66%  Similarity=1.035  Sum_probs=33.6

Q ss_pred             cCCCCeeEEEEeccCCCCCCCCCCCCCcEEEeccC
Q psy2194          54 DKKNAITFHLVHRSQKDPLLVDETAPQHVQMALKT   88 (92)
Q Consensus        54 DKKnA~TFqLVHRSQ~DPL~~DedAsq~VLvPv~~   88 (92)
                      |||||+|||||||||+|||+||++||+|||+|+..
T Consensus         1 dKK~a~tf~lVHRsq~DPl~~D~~A~~~VL~p~~~   35 (421)
T PF04180_consen    1 DKKNAVTFQLVHRSQRDPLIADEDAPQHVLVPVDR   35 (421)
T ss_pred             CCCcceEEEEeccCCCCccccCCCcccceeeeccC
Confidence            79999999999999999999999999999999953


No 2  
>KOG2637|consensus
Probab=99.63  E-value=8.3e-17  Score=133.98  Aligned_cols=42  Identities=62%  Similarity=0.858  Sum_probs=40.0

Q ss_pred             CCCcccccCCCCeeEEEEeccCCCCCCCCCCCCCcEEEeccC
Q psy2194          47 KNKKRFIDKKNAITFHLVHRSQKDPLLVDETAPQHVQMALKT   88 (92)
Q Consensus        47 k~KKkFIDKKnA~TFqLVHRSQ~DPL~~DedAsq~VLvPv~~   88 (92)
                      ||||||||||+||||+||||||+||+++|++||+||+++.+.
T Consensus         1 ~gkKkfIdkKkAqtF~LVhRsq~DP~~~De~a~~r~~e~~ee   42 (446)
T KOG2637|consen    1 MGKKKFIDKKKAQTFHLVHRSQRDPLYHDENAPQRVLERAEE   42 (446)
T ss_pred             CCccccccccccceeEeccCCCCCcccccCCcccchhhhhhh
Confidence            799999999999999999999999999999999999998753


No 3  
>PF07635 PSCyt1:  Planctomycete cytochrome C;  InterPro: IPR011429 These proteins share a region of homology at their N terminus that contains the C-{CPWHF}-{CPWR}-C-H-{CFYW} motif typical of cytochrome c.
Probab=61.49  E-value=6.8  Score=23.81  Aligned_cols=25  Identities=24%  Similarity=0.429  Sum_probs=20.2

Q ss_pred             cCCCCCChHHHHHHhhc--ccccccCC
Q psy2194          23 YLPGSPDEQEIYRRLIY--PSLIALGK   47 (92)
Q Consensus        23 y~p~s~d~~~~y~~~~~--~~~im~~k   47 (92)
                      ..||.++++..|+|+..  +...||.+
T Consensus        32 ivpG~~~~S~L~~~i~~~~~~~~MPP~   58 (59)
T PF07635_consen   32 IVPGDPEESLLWQRITSQDDDGRMPPK   58 (59)
T ss_pred             ecCCChHHhHHHHHHHccCCCCCCCcC
Confidence            46999999999999875  56777765


No 4  
>COG5030 APS2 Clathrin adaptor complex, small subunit [Intracellular trafficking and secretion]
Probab=56.61  E-value=18  Score=27.55  Aligned_cols=53  Identities=30%  Similarity=0.415  Sum_probs=42.0

Q ss_pred             eeeEEeecccc------cCCCCCChHHHHHHhhcccccccCCCCcccccCCCCeeEEEEecc
Q psy2194          12 SYLLVENKPCR------YLPGSPDEQEIYRRLIYPSLIALGKNKKRFIDKKNAITFHLVHRS   67 (92)
Q Consensus        12 ~~~~~~~~~cr------y~p~s~d~~~~y~~~~~~~~im~~k~KKkFIDKKnA~TFqLVHRS   67 (92)
                      -|+|..||.|.      |-|.|-+++.---+-||+......-+-..|++-|++   ++|.|-
T Consensus         3 ~~vli~nrqgk~RL~K~yt~~~~~e~~kli~~i~~lIs~R~~ke~N~~e~k~~---kiVYrr   61 (152)
T COG5030           3 KFVLIFNRQGKPRLVKWYTPVSDPEQAKLIADIYELISARKPKESNFIEGKNE---KIVYRR   61 (152)
T ss_pred             EEEEEEcCCCceeeeEeeccCCcHHHHHHHHHHHHHHHcCCchhcccccccCc---EEEeee
Confidence            36788888884      789999999888888899888766677789999987   566653


No 5  
>TIGR03806 chp_HNE_0200 conserved hypothetical protein, HNE_0200 family. The model TIGR03805 describes an uncharacterized protein family that contains repeats associated with the formation of a right-handed helical stack of parallel beta strands, homologous to those found in a number of carbohydrate-binding proteins and sugar hydrolases. This model describes another uncharacterized protein family, found in the same species as TIGR03805 member proteins, usually as the adjacent gene or in a fusion protein. An example is HNE_0200 from Hyphomonas neptunium ATCC 15444. Sometimes two members of this family are with a single member of TIGR03805. The function is unknown.
Probab=38.56  E-value=21  Score=28.86  Aligned_cols=28  Identities=18%  Similarity=0.390  Sum_probs=23.5

Q ss_pred             ccCCCCCChHHHHHHhh--cccccccCCCC
Q psy2194          22 RYLPGSPDEQEIYRRLI--YPSLIALGKNK   49 (92)
Q Consensus        22 ry~p~s~d~~~~y~~~~--~~~~im~~k~K   49 (92)
                      .-.||.+++|..|.|+-  -|...||..++
T Consensus       270 ~IvPGdpe~SiL~~R~~~~d~~~~MPp~G~  299 (317)
T TIGR03806       270 DIVPGDPEKSILLYRMHSTEPGVRMPELGR  299 (317)
T ss_pred             eecCCChhhChHHHHHhcCCccccCCcCCC
Confidence            46799999999999986  46789998776


No 6  
>PF03529 TF_Otx:  Otx1 transcription factor;  InterPro: IPR013851 Otx proteins constitute a class of vertebrate homeodomain-containing transcription factors that have been shown to be essential for anterior head formation, including brain morphogenesis. They are orthologous to the product of the Drosophila head gap gene, orthodenticle (Otd), and appear to play similar roles in both, since the developmental abnormalities caused by disruption of these transcription factors in one, can be recovered by substitution of the factor(s) from the other. Such studies have provided strong evidence that there exists a conserved genetic programme for insect and mammalian brain development, which presumably arose in a more primitive common ancestor [, ]. Two vertebrate orthodenticle-related transcription factors have been indentified, Otx1 and Otx2, which have sizes of 355 and 289 residues respectively. They contain a bicoid-like homeodomain, which features a conserved lysine residue at position 9 of the DNA recognition helix, which is thought to confer high-affinity binding to TAATCC/T elements on DNA []. Otd-like transcription factors have also been found in zebrafish and certain lamprey species.  This entry represents a conserved region found in the C-terminal region of these proteins.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0007275 multicellular organismal development, 0005634 nucleus
Probab=38.10  E-value=12  Score=26.18  Aligned_cols=10  Identities=60%  Similarity=1.142  Sum_probs=8.4

Q ss_pred             cccceeeeEE
Q psy2194           7 GIDCTSYLLV   16 (92)
Q Consensus         7 ~~~~~~~~~~   16 (92)
                      |+||.+||--
T Consensus        51 g~DC~sYLsP   60 (88)
T PF03529_consen   51 GMDCGSYLSP   60 (88)
T ss_pred             cccccccccc
Confidence            7899999953


No 7  
>COG4295 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=37.04  E-value=6.8  Score=32.12  Aligned_cols=27  Identities=44%  Similarity=0.685  Sum_probs=20.8

Q ss_pred             hhcccccccCCCCcccccCCCCeeEEEEeccCCCCCCCC
Q psy2194          37 LIYPSLIALGKNKKRFIDKKNAITFHLVHRSQKDPLLVD   75 (92)
Q Consensus        37 ~~~~~~im~~k~KKkFIDKKnA~TFqLVHRSQ~DPL~~D   75 (92)
                      -+|||||.+            +..|-=|||-|+.|||.|
T Consensus       123 ~lY~sL~k~------------~eeyY~fhr~~~s~LYsD  149 (285)
T COG4295         123 SLYPSLIKY------------KEEYYEFHREQKSPLYSD  149 (285)
T ss_pred             cchHhhhcc------------cHHHHHhhhhhcCccccc
Confidence            589999932            345667899999999865


No 8  
>cd01802 AN1_N ubiquitin-like domain of AN1. AN1 (also known as ANUBL1 and RSD-7) is ubiquitin-like protein with a testis-specific expression in rats that has an N-terminal ubiquitin-like domain and a C-terminal zinc-binding domain. Unlike ubiquitin polyproteins and most ubiquitin fusion proteins, the N-terminal ubiquitin-like domain of An1 does not undergo proteolytic processing.  The function of AN1 is unknown.
Probab=33.91  E-value=39  Score=22.69  Aligned_cols=24  Identities=21%  Similarity=0.259  Sum_probs=20.1

Q ss_pred             ccCCCCcccccCCCCeeEEEEecc
Q psy2194          44 ALGKNKKRFIDKKNAITFHLVHRS   67 (92)
Q Consensus        44 m~~k~KKkFIDKKnA~TFqLVHRS   67 (92)
                      |..|+.-+||+-.|-+||+|+-|-
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~   24 (103)
T cd01802           1 MANKKEPPFFNEDNMGPFHYKLPF   24 (103)
T ss_pred             CCCccCCCccccCCcceeEEeecc
Confidence            345667799999999999999994


No 9  
>PF10984 DUF2794:  Protein of unknown function (DUF2794);  InterPro: IPR021252  This is a bacterial family of proteins with unknown function. 
Probab=25.05  E-value=59  Score=22.40  Aligned_cols=20  Identities=20%  Similarity=0.448  Sum_probs=17.2

Q ss_pred             CCCCeeEEEEeccCCCCCCC
Q psy2194          55 KKNAITFHLVHRSQKDPLLV   74 (92)
Q Consensus        55 KKnA~TFqLVHRSQ~DPL~~   74 (92)
                      -++..+|++..|+..-|+|-
T Consensus        32 ~~~~A~Fsvfrr~~E~PlYr   51 (85)
T PF10984_consen   32 LRDRAVFSVFRRAAERPLYR   51 (85)
T ss_pred             CCceEEEEEeeccCCCccEE
Confidence            35677999999999999985


No 10 
>PF14747 DUF4473:  Domain of unknown function (DUF4473)
Probab=18.71  E-value=34  Score=22.19  Aligned_cols=10  Identities=30%  Similarity=0.547  Sum_probs=7.0

Q ss_pred             CCChHHHHHH
Q psy2194          27 SPDEQEIYRR   36 (92)
Q Consensus        27 s~d~~~~y~~   36 (92)
                      |++||++|..
T Consensus        68 s~~DQ~~y~~   77 (82)
T PF14747_consen   68 SEEDQTAYNA   77 (82)
T ss_pred             CHHHHHHHHH
Confidence            5577888844


Done!