RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2207
         (305 letters)



>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           pleckstrin homology (PH) domain, C-terminus.  FGD5
           regulates promotes angiogenesis of vascular endothelial
           growth factor (VEGF) in vascular endothelial cells,
           including network formation, permeability, directional
           movement, and proliferation. The specific function of
           FGD6 is unknown. In general, FGDs have a RhoGEF (DH)
           domain, followed by a PH domain, a FYVE domain and a
           C-terminal PH domain. All FGDs are guanine nucleotide
           exchange factors that activate the Rho GTPase Cdc42, an
           important regulator of membrane trafficking. The RhoGEF
           domain is responsible for GEF catalytic activity, while
           the PH domain is involved in intracellular targeting of
           the DH domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 90

 Score =  107 bits (268), Expect = 2e-29
 Identities = 44/89 (49%), Positives = 62/89 (69%), Gaps = 4/89 (4%)

Query: 213 SGWLH--KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF--K 268
           SG+L+  K+  ++WKR WFVLKD+V+Y YKASED+ AL SIP+LGY +    E       
Sbjct: 2   SGYLYRRKRKKKSWKRLWFVLKDKVLYTYKASEDVVALESIPLLGYTVVPAKEGFEGDES 61

Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWMKA 297
            VFQL H+GQ P +F AD+ ++ +RW++A
Sbjct: 62  LVFQLLHKGQLPYIFRADDAETAQRWIEA 90


>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins
           1, 2, and 3 pleckstrin homology (PH) domain.  PEPP1
           (also called PLEKHA4/PH domain-containing family A
           member 4 and RHOXF1/Rhox homeobox family member 1), and
           related homologs PEPP2 (also called PLEKHA5/PH
           domain-containing family A member 5) and PEPP3 (also
           called PLEKHA6/PH domain-containing family A member 6),
           have PH domains that interact specifically with
           PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3
           specifically are: TAPP1 (tandem PH-domain-containing
           protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd-
           Ins(3,5)P2 (centaurin-beta2). All of these proteins
           contain at least 5 of the 6 conserved amino acids that
           make up the putative phosphatidylinositol 3,4,5-
           trisphosphate-binding motif (PPBM) located at their
           N-terminus. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 104

 Score = 98.9 bits (247), Expect = 5e-26
 Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 5/94 (5%)

Query: 213 SGWLHKKSG---RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQD--NF 267
           SGWLHK+ G   +NWK+ WFVLKD  +Y YK  E+ KAL SI +  Y +   +  D  N 
Sbjct: 10  SGWLHKQGGSGLKNWKKRWFVLKDNCLYYYKDPEEEKALGSILLPSYTISPASPSDEINR 69

Query: 268 KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
           K+ F+ +H G     F AD ++  E+WMKA+  A
Sbjct: 70  KFAFKAEHAGMRTYYFAADTQEEMEQWMKALSLA 103


>gnl|CDD|216454 pfam01363, FYVE, FYVE zinc finger.  The FYVE zinc finger is named
           after four proteins that it has been found in: Fab1,
           YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been
           shown to bind two Zn++ ions. The FYVE finger has eight
           potential zinc coordinating cysteine positions. Many
           members of this family also include two histidines in a
           motif R+HHC+XCG, where + represents a charged residue
           and X any residue. We have included members which do not
           conserve these histidine residues but are clearly
           related.
          Length = 68

 Score = 91.3 bits (227), Expect = 1e-23
 Identities = 29/68 (42%), Positives = 37/68 (54%), Gaps = 2/68 (2%)

Query: 76  PLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPL--EYKKFRNFRVCE 133
           P W+PDS V+ C  C   F+   RRHHCR CGKV C  CS     L  +    +  RVC+
Sbjct: 1   PRWVPDSDVTNCMGCGKPFSFFRRRHHCRNCGKVFCSSCSSKKIALLPKLGINKPVRVCD 60

Query: 134 ECYHYLVQ 141
           +CY  L +
Sbjct: 61  DCYDKLQK 68


>gnl|CDD|214499 smart00064, FYVE, Protein present in Fab1, YOTB, Vac1, and EEA1.
           The FYVE zinc finger is named after four proteins where
           it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1.
           The FYVE finger has been shown to bind two Zn2+ ions.
           The FYVE finger has eight potential zinc coordinating
           cysteine positions. The FYVE finger is structurally
           related to the PHD finger and the RING finger. Many
           members of this family also include two histidines in a
           motif R+HHC+XCG, where + represents a charged residue
           and X any residue. The FYVE finger functions in the
           membrane recruitment of cytosolic proteins by binding to
           phosphatidylinositol 3-phosphate (PI3P), which is
           prominent on endosomes. The R+HHC+XCG motif is critical
           for PI3P binding.
          Length = 68

 Score = 84.4 bits (209), Expect = 5e-21
 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 75  APLWIPDSRVSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYK-KFRNFRVCE 133
            P WIPD  VS C  C   F +T RRHHCR CG++ C  CS   APL      R  RVC+
Sbjct: 1   RPHWIPDEEVSNCMGCGKEFNLTKRRHHCRNCGRIFCSKCSSKKAPLPKLGIERPVRVCD 60

Query: 134 ECYHYL 139
           +CY  L
Sbjct: 61  DCYENL 66


>gnl|CDD|238022 cd00065, FYVE, FYVE domain; Zinc-binding domain; targets proteins
           to membrane lipids via interaction with
           phosphatidylinositol-3-phosphate, PI3P; present in Fab1,
           YOTB, Vac1, and EEA1;.
          Length = 57

 Score = 72.5 bits (178), Expect = 1e-16
 Identities = 24/54 (44%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 84  VSMCQRCTSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKF-RNFRVCEECY 136
            S C  C   FT+T RRHHCR CG++ C  CS    PL      +  RVC+ CY
Sbjct: 2   ASSCMGCGKPFTLTRRRHHCRNCGRIFCSKCSSNRIPLPSMGGGKPVRVCDSCY 55


>gnl|CDD|215766 pfam00169, PH, PH domain.  PH stands for pleckstrin homology.
          Length = 101

 Score = 72.1 bits (177), Expect = 4e-16
 Identities = 27/98 (27%), Positives = 52/98 (53%), Gaps = 7/98 (7%)

Query: 212 HSGWLHKKSG---RNWKRYWFVLKDQVM--YKYKASEDIKALLSIPVLGYELEALNEQDN 266
             GWL KK     ++WK+ +FVL D V+  YK       +   SIP+ G ++  + + ++
Sbjct: 3   KEGWLLKKGSGGRKSWKKRYFVLFDGVLLYYKDSKKSSSRPKGSIPLSGCQVTKVPDSED 62

Query: 267 FK--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
            K    F+++   ++  +  A++E+  + W+KA+R A 
Sbjct: 63  GKRKNCFEIRTGDRETFLLQAESEEERKEWVKAIRSAI 100



 Score = 29.0 bits (65), Expect = 1.0
 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 1/40 (2%)

Query: 8   TEDYNNEFSVIAISR-SFTLRARSANERLEWIDAIQTAIK 46
                N F +    R +F L+A S  ER EW+ AI++AI+
Sbjct: 62  DGKRKNCFEIRTGDRETFLLQAESEEERKEWVKAIRSAIR 101


>gnl|CDD|241540 cd13389, PH1_FGD5_FGD6, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins 5 and 6
           Pleckstrin Homology (PH) domain.  FGD5 regulates
           promotes angiogenesis of vascular endothelial growth
           factor (VEGF) in vascular endothelial cells, including
           network formation, permeability, directional movement,
           and proliferation. The specific function of FGD6 is
           unknown. In general, FGDs have a RhoGEF (DH) domain,
           followed by a PH domain, a FYVE domain and a C-terminal
           PH domain. All FGDs are guanine nucleotide exchange
           factors that activate the Rho GTPase Cdc42, an important
           regulator of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the PH
           domain is involved in intracellular targeting of the DH
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 71.9 bits (177), Expect = 9e-16
 Identities = 27/60 (45%), Positives = 40/60 (66%)

Query: 1   MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSFLNRRS 60
           MKV LP+ E+Y+NEF + +  RSFTL A SA ER EW+ A+  AI++  +   +F + +S
Sbjct: 64  MKVSLPEDEEYSNEFQIESTKRSFTLSASSAEERDEWVKALSRAIEDYTKKRRTFGSNKS 123


>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase
           suppressor of ras) (CNK) pleckstrin homology (PH)
           domain.  CNK family members function as protein
           scaffolds, regulating the activity and the subcellular
           localization of RAS activated RAF. There is a single CNK
           protein present in Drosophila and Caenorhabditis elegans
           in contrast to mammals which have 3 CNK proteins (CNK1,
           CNK2, and CNK3). All of the CNK members contain a
           sterile a motif (SAM), a conserved region in CNK (CRIC)
           domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and, with
           the exception of CNK3, a PH domain. A CNK2 splice
           variant CNK2A also has a PDZ domain-binding motif at its
           C terminus and Drosophila CNK (D-CNK) also has a domain
           known as the Raf-interacting region (RIR) that mediates
           binding of the Drosophila Raf kinase. This cd contains
           CNKs from mammals, chickens, amphibians, fish, and
           crustacea. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 70.9 bits (174), Expect = 2e-15
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 214 GWLHKKS------GRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 267
           GWL KK       G+ WKRYWFVLK   +Y Y   +D KA   I +  +++E  +E    
Sbjct: 17  GWLWKKKEAKGFFGQKWKRYWFVLKGSSLYWYNNPQDEKAEGFINLPDFKIERASECKK- 75

Query: 268 KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTL 304
           KY F+  H       F A+N     +W+  +  A   
Sbjct: 76  KYAFKASHPKIKTFYFAAENLDDMNKWLSKLITAINK 112


>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain.  Domain commonly found
           in eukaryotic signalling proteins. The domain family
           possesses multiple functions including the abilities to
           bind inositol phosphates, and various proteins. PH
           domains have been found to possess inserted domains
           (such as in PLC gamma, syntrophins) and to be inserted
           within other domains. Mutations in Brutons tyrosine
           kinase (Btk) within its PH domain cause X-linked
           agammaglobulinaemia (XLA) in patients. Point mutations
           cluster into the positively charged end of the molecule
           around the predicted binding site for
           phosphatidylinositol lipids.
          Length = 102

 Score = 69.9 bits (171), Expect = 3e-15
 Identities = 29/99 (29%), Positives = 54/99 (54%), Gaps = 8/99 (8%)

Query: 212 HSGWLHKKSG---RNWKRYWFVLKDQVMYKYK---ASEDIKALLSIPVLGYELEALNEQD 265
             GWL+KKSG   ++WK+ +FVL +  +  YK     +  K   SI + G  +    + D
Sbjct: 3   KEGWLYKKSGGGKKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSIDLSGCTVREAPDPD 62

Query: 266 NF--KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
           +    + F++K   +  L+  A++E+  E+W++A+R+A 
Sbjct: 63  SSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEALRKAI 101



 Score = 31.8 bits (72), Expect = 0.11
 Identities = 9/25 (36%), Positives = 17/25 (68%)

Query: 22  RSFTLRARSANERLEWIDAIQTAIK 46
           ++  L+A S  ER +W++A++ AI 
Sbjct: 78  KTLLLQAESEEEREKWVEALRKAIA 102


>gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia proteins pleckstrin
           homology (PH) domain, C-terminus.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Not much is known about
           FGD2.  FGD1 is the best characterized member of the
           group with mutations here leading to the X-linked
           disorder known as faciogenital dysplasia (FGDY). Both
           FGD1 and FGD3 are targeted by the ubiquitin ligase
           SCF(FWD1/beta-TrCP) upon phosphorylation of two serine
           residues in its DSGIDS motif and subsequently degraded
           by the proteasome. However, FGD1 and FGD3 induced
           significantly different morphological changes in HeLa
           Tet-Off cells and while FGD1 induced long finger-like
           protrusions, FGD3 induced broad sheet-like protrusions
           when the level of GTP-bound Cdc42 was significantly
           increased by the inducible expression of FGD3. They also
           reciprocally regulated cell motility in inducibly
           expressed in HeLa Tet-Off cells, FGD1 stimulated cell
           migration while FGD3 inhibited it. FGD1 and FGD3
           therefore play different roles to regulate cellular
           functions, even though their intracellular levels are
           tightly controlled by the same destruction pathway
           through SCF(FWD1/beta-TrCP). FGD4 is one of the genes
           associated with Charcot-Marie-Tooth neuropathy type 4
           (CMT4), a group of progressive motor and sensory axonal
           and demyelinating neuropathies that are distinguished
           from other forms of CMT by autosomal recessive
           inheritance. Those affected have distal muscle weakness
           and atrophy associated with sensory loss and,
           frequently, pes cavus foot deformity. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 67.3 bits (165), Expect = 3e-14
 Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 10/105 (9%)

Query: 206 NDSGSQHS---GWLH-KKSGRNWKRYWFVLKD---QVMYKYKASEDIKALLSIPVLGYEL 258
                ++S    +L   + G+ W++ W V+      V+Y Y A +D++A  +IP+ GYE+
Sbjct: 1   ASLVPENSLLCSFLQYSEKGKTWQKVWCVIPRTEPLVLYLYGAPQDVRAPRTIPLPGYEV 60

Query: 259 EALNEQDNF--KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
                ++    K+VF+L  Q +    F A++E+  +RW++A+  A
Sbjct: 61  SVPPPEERLDGKHVFKL-SQSKQSHYFSAESEELQQRWLEALSRA 104


>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and
           related proteins Pleckstrin homology (PH) domain.
           RhoGAP25 (also called ArhGap25) like other RhoGaps are
           involved in cell polarity, cell morphology and
           cytoskeletal organization. They act as GTPase activators
           for the Rac-type GTPases by converting them to an
           inactive GDP-bound state and control actin remodeling by
           inactivating Rac downstream of Rho leading to suppress
           leading edge protrusion and promotes cell retraction to
           achieve cellular polarity and are able to suppress RAC1
           and CDC42 activity in vitro. Overexpression of these
           proteins induces cell rounding with partial or complete
           disruption of actin stress fibers and formation of
           membrane ruffles, lamellipodia, and filopodia. This
           hierarchy contains RhoGAP22, RhoGAP24, and RhoGAP25.
           Members here contain an N-terminal PH domain followed by
           a RhoGAP domain and either a BAR or TATA Binding Protein
           (TBP) Associated Factor 4 (TAF4) domain. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 66.6 bits (163), Expect = 7e-14
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 12/102 (11%)

Query: 212 HSGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEAL--NEQDNF 267
            SGWL K+ G  +NW+R WFVL+   +Y YK  ++ K    IP+ G  ++ L  N ++  
Sbjct: 5   KSGWLKKQGGIVKNWQRRWFVLRGDQLYYYKDEDESKPQGCIPLPGNTVKELPFNPEEPG 64

Query: 268 KYVFQLK--------HQGQDPLVFGADNEQSYERWMKAMREA 301
           K++F++             D  +  A+++   E W+K +R  
Sbjct: 65  KFLFEIIPGDGGTRRSANHDSYLLMANSQAEMEEWVKVIRRV 106


>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain.  Yeast Boi
           proteins Boi1 and Boi2 are functionally redundant and
           important for cell growth with Boi mutants displaying
           defects in bud formation and in the maintenance of cell
           polarity.They appear to be linked to Rho-type GTPase,
           Cdc42 and Rho3. Boi1 and Boi2 display two-hybrid
           interactions with the GTP-bound ("active") form of
           Cdc42, while Rho3 can suppress of the lethality caused
           by deletion of Boi1 and Boi2. These findings suggest
           that Boi1 and Boi2 are targets of Cdc42 that promote
           cell growth in a manner that is regulated by Rho3. Boi
           proteins contain a N-terminal SH3 domain, followed by a
           SAM (sterile alpha motif) domain, a proline-rich region,
           which mediates binding to the second SH3 domain of Bem1,
           and C-terminal PH domain. The PH domain is essential for
           its function in cell growth and is important for
           localization to the bud, while the SH3 domain is needed
           for localization to the neck. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 95

 Score = 60.1 bits (146), Expect = 8e-12
 Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 212 HSGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF-K 268
           HSGW+ K+  R   WK  +FVLK   +Y  K+  D K    I + G+ +   +      +
Sbjct: 1   HSGWMKKRGERYGTWKTRYFVLKGTRLYYLKSENDSKEKGLIDLTGHRVTVDDSNSKPGR 60

Query: 269 YVFQLKH-QGQDPLVFGADNEQSYERWMKAMREAT 302
           Y F+L     +    F  D ++    WMKA+ +AT
Sbjct: 61  YGFKLVPPAVEKVHYFAVDEKEVLREWMKALMKAT 95


>gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin
           domain-containing protein 1 and related proteins
           Pleckstrin Homology (PH) domain, repeat 2.  Members here
           include FARP1 (also called Chondrocyte-derived
           ezrin-like protein; PH domain-containing family C member
           2), FARP2 (also called FIR/FERM domain including RhoGEF;
           FGD1-related Cdc42-GEF/FRG), and FARP6 (also called Zinc
           finger FYVE domain-containing protein 24). They are
           members of the Dbl family guanine nucleotide exchange
           factors (GEFs) which are upstream positive regulators of
           Rho GTPases. Little is known about FARP1 and FARP6,
           though FARP1 has increased expression in differentiated
           chondrocytes. FARP2 is thought to regulate neurite
           remodeling by mediating the signaling pathways from
           membrane proteins to Rac. It is found in brain, lung,
           and testis, as well as embryonic hippocampal and
           cortical neurons. FARP1 and FARP2 are composed of a
           N-terminal FERM domain, a proline-rich (PR) domain,
           Dbl-homology (DH), and two C-terminal PH domains. FARP6
           is composed of Dbl-homology (DH), and two C-terminal PH
           domains separated by a FYVE domain. This hierarchy
           contains the second PH repeat. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 113

 Score = 59.6 bits (145), Expect = 2e-11
 Identities = 34/97 (35%), Positives = 57/97 (58%), Gaps = 5/97 (5%)

Query: 210 SQHSGWLHKK--SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 267
           +Q SG+L +K  +   W++ W V  +  ++ YK+ +D   L S+P+LGY +   +E DN 
Sbjct: 18  NQMSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDEFPLASLPLLGYSVGLPSEADNI 77

Query: 268 K--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
              YVF+L+        F A++E ++ERWM+ +R AT
Sbjct: 78  DKDYVFKLQF-KSHVYFFRAESEYTFERWMEVIRSAT 113


>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain.  PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 92

 Score = 57.4 bits (138), Expect = 9e-11
 Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 6/92 (6%)

Query: 212 HSGWLHKKSG---RNWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGYELEALNEQDN 266
             GWL K+ G   ++WK+ WFVL D V+  YK+ +D   K    IP+       L     
Sbjct: 1   KEGWLKKRGGKGLKSWKKRWFVLFDDVLLYYKSKKDSSKKPKGLIPLSDGLEVELVSSSG 60

Query: 267 FKYVFQLKHQGQD-PLVFGADNEQSYERWMKA 297
               F+L    +       A++E+  E W++A
Sbjct: 61  KPNCFELVTPDRGRTYYLQAESEEEREEWLEA 92



 Score = 27.7 bits (61), Expect = 2.9
 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 2/42 (4%)

Query: 1  MKVCLPQTEDYNNEFSVI--AISRSFTLRARSANERLEWIDA 40
          ++V L  +    N F ++     R++ L+A S  ER EW++A
Sbjct: 51 LEVELVSSSGKPNCFELVTPDRGRTYYLQAESEEEREEWLEA 92


>gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing,
           family D (with coiled-coil domains) member 1 PH domain. 
           Human PLEKHD1 (also called UPF0639, pleckstrin homology
           domain containing, family D (with M protein repeats)
           member 1) is a single transcript and contains a single
           PH domain. PLEKHD1 is conserved in human, chimpanzee, ,
           dog, cow, mouse, chicken, zebrafish, and Caenorhabditis
           elegans. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 139

 Score = 54.3 bits (131), Expect = 2e-09
 Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 16/107 (14%)

Query: 211 QHSGWLHKK----SGRNWKRYWFVLKDQVMYKYKASE----------DIKALLSIPVLGY 256
           Q SG L K+        W + +FVLK+  +  Y  SE          +I     IP+ G 
Sbjct: 13  QLSGVLWKRPFGRQSAKWSKRFFVLKECFLLYYAESEKKDFEKTRRFNIHPKGVIPLGGC 72

Query: 257 ELEALNEQDNFKYVFQLKHQG-QDPLVFGADNEQSYERWMKAMREAT 302
            +EA  +     Y F + H   +  ++  AD+E+  E W+  +REAT
Sbjct: 73  SIEAGRDPGR-PYCFLISHPDFKGSIILAADSEEEQESWLDMLREAT 118


>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase
           suppressor of ras) (CNK) pleckstrin homology (PH)
           domain.  CNK family members function as protein
           scaffolds, regulating the activity and the subcellular
           localization of RAS activated RAF. There is a single CNK
           protein present in Drosophila and Caenorhabditis elegans
           in contrast to mammals which have 3 CNK proteins (CNK1,
           CNK2, and CNK3). All of the CNK members contain a
           sterile a motif (SAM), a conserved region in CNK (CRIC)
           domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and a PH
           domain. A CNK2 splice variant CNK2A also has a PDZ
           domain-binding motif at its C terminus and Drosophila
           CNK (D-CNK) also has a domain known as the
           Raf-interacting region (RIR) that mediates binding of
           the Drosophila Raf kinase. This cd contains CNKs from
           insects, spiders, mollusks, and nematodes. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 90

 Score = 50.0 bits (120), Expect = 3e-08
 Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 6/87 (6%)

Query: 214 GWLHKKS-----GRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK 268
           GWL+++      G  W + WFVLK   +Y +++ E  KA   I + G+ +    E  + K
Sbjct: 3   GWLYQRRRKGKGGGKWAKRWFVLKGSNLYGFRSQESTKADCVIFLPGFTVSPAPEVKSRK 62

Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWM 295
           Y F++ H G     F A++++  ++W+
Sbjct: 63  YAFKVYHTGT-VFYFAAESQEDMKKWL 88


>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH)
           domain.  The sesquipedalian family has 2 mammalian
           members: Ses1 and Ses2, which are also callled 7 kDa
           inositol polyphosphate phosphatase-interacting protein 1
           and 2. They play a role in endocytic trafficking and are
           required for receptor recycling from endosomes, both to
           the trans-Golgi network and the plasma membrane. Members
           of this family form homodimers and heterodimers.
           Sesquipedalian interacts with inositol polyphosphate
           5-phosphatase OCRL-1 (INPP5F) also known as Lowe
           oculocerebrorenal syndrome protein, a phosphatase enzyme
           that is involved in actin polymerization and is found in
           the trans-Golgi network and INPP5B. Sesquipedalian
           contains a single PH domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 120

 Score = 50.7 bits (122), Expect = 3e-08
 Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 8/104 (7%)

Query: 204 TANDSGSQHSGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDIKALLSIPVL-GYELEA 260
            + +S     G+L KK  RN  +++ WFVLK  +++ ++   D +  L + VL G  +E 
Sbjct: 2   ASCNSPVDKEGYLWKKGERNTSYQKRWFVLKGNLLFYFEKKGD-REPLGVIVLEGCTVEL 60

Query: 261 LNEQDNFKYVFQLKHQGQDP--LVFGADNEQSYERWMKAMREAT 302
             +++   Y F ++  G      V  A++++  E WMKA+  A+
Sbjct: 61  SEDEEP--YAFAIRFDGPGSRSYVLAAESQEDMESWMKALSRAS 102


>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
           (AtPH1) PH domain.  AtPH1 is expressed in all plant
           tissue and is proposed to be the plant homolog of human
           pleckstrin. Pleckstrin consists of two PH domains
           separated by a linker region, while AtPH has a single PH
           domain with a short N-terminal extension. AtPH1 binds
           PtdIns3P specifically and is thought to be an adaptor
           molecule since it has no obvious catalytic functions. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 117

 Score = 49.3 bits (118), Expect = 1e-07
 Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 208 SGSQHSGWLHKKSG--RNWKRYWFVLKDQVMYKYKAS-EDIKALLSIPVLGYELEALNEQ 264
           S  + +GWL K+ G  + W+R WFVLK   ++ +K    D +    I  L   L   + +
Sbjct: 5   SDPEKAGWLTKQGGSIKTWRRRWFVLKQGKLFYFKDEDPDSEPRGVID-LSDCLTVKSAE 63

Query: 265 DNFKYVFQLK-HQGQDPLVFGADNEQSYERWMKA 297
           +     F  +    +      AD+E+  E W+ A
Sbjct: 64  EATNKEFAFEVSTPERTFYLIADSEKEKEEWISA 97



 Score = 28.5 bits (64), Expect = 2.0
 Identities = 15/35 (42%), Positives = 17/35 (48%)

Query: 11  YNNEFSVIAISRSFTLRARSANERLEWIDAIQTAI 45
               F V    R+F L A S  E+ EWI AI  AI
Sbjct: 68  KEFAFEVSTPERTFYLIADSEKEKEEWISAIGRAI 102


>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat
           2.  MyoX, a MyTH-FERM myosin, is a molecular motor that
           has crucial functions in the transport and/or tethering
           of integrins in the actin-based extensions known as
           filopodia, microtubule binding, and in netrin-mediated
           axon guidance. It functions as a dimer. MyoX walks on
           bundles of actin, rather than single filaments, unlike
           the other unconventional myosins. MyoX is present in
           organisms ranging from humans to choanoflagellates, but
           not in Drosophila and Caenorhabditis elegans.MyoX
           consists of a N-terminal motor/head region, a neck made
           of 3 IQ motifs, and a tail consisting of a coiled-coil
           domain, a PEST region, 3 PH domains, a myosin tail
           homology 4 (MyTH4), and a FERM domain at its very
           C-terminus. The first PH domain in the MyoX tail is a
           split-PH domain, interupted by the second PH domain such
           that PH 1a and PH 1b flanks PH 2. The third PH domain
           (PH 3) follows the PH 1b domain. This cd contains the
           second PH repeat. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 48.2 bits (115), Expect = 2e-07
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 8/49 (16%)

Query: 213 SGWLHKKSG-------RNWKRYWFVLKDQV-MYKYKASEDIKALLSIPV 253
           SGWL+KK G       +NWK  WFVL+D V  Y     E  KAL +I +
Sbjct: 10  SGWLYKKGGGSSTLSRKNWKSRWFVLRDTVLKYYENDQEGAKALGTIDI 58


>gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH)
           domain, repeat 2.  The functions of these fungal
           proteins are unknown, but they all contain 2 PH domains.
           This cd represents the second PH repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 102

 Score = 48.0 bits (115), Expect = 2e-07
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 7/89 (7%)

Query: 215 WLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQD----NFKYV 270
            L KK    WK+YW VL+++ +  YK   +   +  IP+   ++  + E D    + K+ 
Sbjct: 14  VLKKKGVNQWKKYWLVLRNRSLSFYKDQSEYSPVKIIPI--DDIIDVVELDPLSKSKKWC 71

Query: 271 FQLKHQGQDPLVFGADNEQSYERWMKAMR 299
            Q+    +  + F AD+E+S  +W+ A++
Sbjct: 72  LQIITPEK-RIRFCADDEESLIKWLGALK 99


>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol
           3-beta-glucosyltransferase Pleckstrin homology (PH)
           domain, repeat 1.  ATG26 (also called
           UGT51/UDP-glycosyltransferase 51), a member of the
           glycosyltransferase 28 family, resulting in the
           biosynthesis of sterol glucoside. ATG26 in decane
           metabolism and autophagy. There are 32 known
           autophagy-related (ATG) proteins, 17 are components of
           the core autophagic machinery essential for all
           autophagy-related pathways and 15 are the additional
           components required only for certain pathways or
           species. The core autophagic machinery includes 1) the
           ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18, and
           ATG27), 2) the phosphatidylinositol 3-kinase complex
           (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3) the
           ubiquitin-like protein system (ATG3, ATG4, ATG5, ATG7,
           ATG8, ATG10, ATG12, and ATG16). Less is known about how
           the core machinery is adapted or modulated with
           additional components to accommodate the nonselective
           sequestration of bulk cytosol (autophagosome formation)
           or selective sequestration of specific cargos (Cvt
           vesicle, pexophagosome, or bacteria-containing
           autophagosome formation). The pexophagosome-specific
           additions include the ATG30-ATG11-ATG17
           receptor-adaptors complex, the coiled-coil protein
           ATG25, and the sterol glucosyltransferase ATG26. ATG26
           is necessary for the degradation of medium peroxisomes.
           It contains 2 GRAM domains and a single PH domain. PH
           domains are only found in eukaryotes. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. PH domains also have
           diverse functions. They are often involved in targeting
           proteins to the plasma membrane, but few display strong
           specificity in lipid binding. Any specificity is usually
           determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 130

 Score = 47.6 bits (114), Expect = 6e-07
 Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%)

Query: 213 SGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDI 245
           SG+L K+  R   + RYWFVLK  V+  Y++S D+
Sbjct: 32  SGYLSKRGKRTPRYNRYWFVLKGDVLSWYRSSTDL 66



 Score = 30.2 bits (69), Expect = 0.52
 Identities = 11/44 (25%), Positives = 19/44 (43%)

Query: 2   KVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAI 45
              +   +     F +   SR++T +A S     EW+ A+Q  I
Sbjct: 80  SAEITDKDKETTHFKITTNSRTYTFKADSEPSAKEWVKALQKVI 123


>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
           (PH) domain.  SH3BP2 (the gene that encodes the adaptor
           protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
           near the Huntington's Disease Gene on Human Chromosome
           4pl6.3. SH3BP2 lies in a region that is often missing in
           individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
           function mutations in SH3BP2 causes enhanced B-cell
           antigen receptor (BCR)-mediated activation of nuclear
           factor of activated T cells (NFAT), resulting in a rare,
           genetic disorder called cherubism. This results in an
           increase in the signaling complex formation with Syk,
           phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
           recently discovered that Tankyrase regulates 3BP2
           stability through ADP-ribosylation and ubiquitylation by
           the E3-ubiquitin ligase. Cherubism mutations uncouple
           3BP2 from Tankyrase-mediated protein destruction, which
           results in its stabilization and subsequent
           hyperactivation of the Src, Syk, and Vav signaling
           pathways. SH3BP2 is also a potential negative regulator
           of the abl oncogene. PH domains have diverse functions,
           but in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 113

 Score = 46.6 bits (111), Expect = 8e-07
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 8/98 (8%)

Query: 212 HSGWLHKKSGR-----NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQ-D 265
           HSG+L KK G       W   + ++    +Y +K S+  K      + GY   A  E   
Sbjct: 11  HSGYLTKKGGSQKQLLKWPLRYVIIHKGCVYYFKNSQSAKPKGVFSLNGYNRRAAEETTS 70

Query: 266 NFKYVFQLKHQGQD--PLVFGADNEQSYERWMKAMREA 301
             K+VF++ H  +D     F A +E   + WM+++R+ 
Sbjct: 71  KKKFVFKIIHLSKDHRTWYFSAKSEDEMKEWMESLRKE 108


>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin
           homology (PH) domain.  RhoGap24 (also called ARHGAP24,
           p73RhoGAp, and Filamin-A-associated RhoGAP) like other
           RhoGAPs are involved in cell polarity, cell morphology
           and cytoskeletal organization. They act as GTPase
           activators for the Rac-type GTPases by converting them
           to an inactive GDP-bound state and control actin
           remodeling by inactivating Rac downstream of Rho leading
           to suppress leading edge protrusion and promotes cell
           retraction to achieve cellular polarity and are able to
           suppress RAC1 and CDC42 activity in vitro.
           Overexpression of these proteins induces cell rounding
           with partial or complete disruption of actin stress
           fibers and formation of membrane ruffles, lamellipodia,
           and filopodia. Members here contain an N-terminal PH
           domain followed by a RhoGAP domain and either a BAR or
           TATA Binding Protein (TBP) Associated Factor 4 (TAF4)
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 46.1 bits (109), Expect = 1e-06
 Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 12/98 (12%)

Query: 214 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYEL--EALNEQDNFKY 269
           GWL K+ G  + W   WFVLK   +Y +K  ++ K L +I + G  +     NE++  K+
Sbjct: 7   GWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNRVTEHPCNEEEPGKF 66

Query: 270 VFQLKHQG--------QDPLVFGADNEQSYERWMKAMR 299
           +F++   G         +  +  A  +   E W+K++R
Sbjct: 67  LFEVVPGGDRERMTANHETYLLMASTQNDMEDWVKSIR 104


>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
           domain, repeat 1.  The functions of these fungal
           proteins are unknown, but they all contain 2 PH domains.
           This cd represents the first PH repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 106

 Score = 45.3 bits (108), Expect = 2e-06
 Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 25/104 (24%)

Query: 212 HSGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKY 269
            SGWL K+S   + WK+ WFVL+   +  YK  ++ K    I +   EL A+    + K 
Sbjct: 8   KSGWLLKRSRKTKTWKKRWFVLRPCQLSYYKDEKEYKLRRVINL--SELTAVAPLKDKKR 65

Query: 270 VFQLKHQGQDPLVFG-----------ADNEQSYERWMKAMREAT 302
                       VF            A +E+    W++A+RE +
Sbjct: 66  KN----------VFAIYTPSKNYHFQASSEKDANEWVEAIREES 99


>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin
           homology (PH) domain.  RhoGAP2 (also called RhoGap22 or
           ArhGap22) are involved in cell polarity, cell morphology
           and cytoskeletal organization. They activate a GTPase
           belonging to the RAS superfamily of small GTP-binding
           proteins. The encoded protein is insulin-responsive, is
           dependent on the kinase Akt, and requires the
           Akt-dependent 14-3-3 binding protein which binds
           sequentially to two serine residues resulting in
           regulation of cell motility. Members here contain an
           N-terminal PH domain followed by a RhoGAP domain and
           either a BAR or TATA Binding Protein (TBP) Associated
           Factor 4 (TAF4) domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 116

 Score = 44.9 bits (106), Expect = 3e-06
 Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 14/101 (13%)

Query: 213 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEAL--NEQDNFK 268
           +GWL K+    +NW++ WFVL+   ++ YK  E+ K    I + G ++  L  N ++  K
Sbjct: 6   AGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDEEETKPQGCISLQGSQVNELPPNPEEPGK 65

Query: 269 YVFQLKHQGQ----------DPLVFGADNEQSYERWMKAMR 299
           ++F++   G           +  +  A+++   E W+KA+R
Sbjct: 66  HLFEILPGGAGDREKVPMNHEAFLLMANSQSDMEDWVKAIR 106


>gnl|CDD|241290 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor protein-Binding,
           family B, member 1 Interacting Protein pleckstrin
           homology (PH) domain.  APBB1IP consists of a
           Ras-associated (RA) domain, a PH domain, a
           family-specific BPS region, and a C-terminal SH2 domain.
           Grb7, Grb10 and Grb14 are paralogs that are also present
           in this hierarchy. These adapter proteins bind a variety
           of receptor tyrosine kinases, including the insulin and
           insulin-like growth factor-1 (IGF1) receptors. Grb10 and
           Grb14 are important tissue-specific negative regulators
           of insulin and IGF1 signaling based and may contribute
           to type 2 (non-insulin-dependent) diabetes in humans.
           RA-PH function as a single structural unit and is
           dimerized via a helical extension of the PH domain. The
           PH domain here are proposed to bind phosphoinositides
           non-cannonically ahd are unlikely to bind an activated
           GTPase. The tandem RA-PH domains are present in a second
           adapter-protein family, MRL proteins, Caenorhabditis
           elegans protein MIG-1012, the mammalian proteins RIAM
           and lamellipodin and the Drosophila melanogaster protein
           Pico12, all of which are Ena/VASP-binding proteins
           involved in actin-cytoskeleton rearrangement. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 124

 Score = 43.8 bits (104), Expect = 1e-05
 Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 20/107 (18%)

Query: 211 QHSGWLH-KKSGRN-WKRYWFVLKDQVMY-----KYKASEDIKALLSIPVLGYEL-EALN 262
           +  G+L+ K+ G+  WK+ +FVL+   +Y     K K S D++ L       Y +   LN
Sbjct: 7   EIEGFLYLKEDGKKSWKKRYFVLRASGLYYSPKGKSKESRDLQCLAQFD--DYNVYTGLN 64

Query: 263 EQDNFK----YVFQLKHQGQDPL------VFGADNEQSYERWMKAMR 299
            +  +K    + F LK                A++EQS   W+ A+R
Sbjct: 65  GKKKYKAPTDFGFCLKPNKVQEKGSKDIKYLCAEDEQSRTCWLTAIR 111


>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for
           Phosphoinositides-1-like Pleckstrin homology (PH)
           domain.  GRP1/cytohesin3 and the related proteins ARNO
           (ARF nucleotide-binding site opener)/cytohesin-2 and
           cytohesin-1 are ARF exchange factors that contain a
           pleckstrin homology (PH) domain thought to target these
           proteins to cell membranes through binding
           polyphosphoinositides. The PH domains of all three
           proteins exhibit relatively high affinity for
           PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G)
           and triglycine (3G) splice variants, differing only in
           the number of glycine residues in the PH domain,
           strongly influence the affinity and specificity for
           phosphoinositides. The 2G variants selectively bind
           PtdIns(3,4,5)P3 with high affinity,the 3G variants bind
           PtdIns(3,4,5)P3 with about 30-fold lower affinity and
           require the polybasic region for plasma membrane
           targeting. These ARF-GEFs share a common, tripartite
           structure consisting of an N-terminal coiled-coil
           domain, a central domain with homology to the yeast
           protein Sec7, a PH domain, and a C-terminal polybasic
           region. The Sec7 domain is autoinhibited by conserved
           elements proximal to the PH domain. GRP1 binds to the
           DNA binding domain of certain nuclear receptors
           (TRalpha, TRbeta, AR, ER, but not RXR), and can repress
           thyroid hormone receptor (TR)-mediated transactivation
           by decreasing TR-complex formation on thyroid hormone
           response elements. ARNO promotes sequential activation
           of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin
           acts as a PI 3-kinase effector mediating biological
           responses including cell spreading and adhesion,
           chemotaxis, protein trafficking, and cytoskeletal
           rearrangements, only some of which appear to depend on
           their ability to activate ARFs. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 43.1 bits (102), Expect = 2e-05
 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 7/53 (13%)

Query: 212 HSGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALN 262
             GWL K  GR  +WKR WF+L D  +Y ++ + D +    IP     LE L+
Sbjct: 5   REGWLLKLGGRVKSWKRRWFILTDNCLYYFEYTTDKEPRGIIP-----LENLS 52


>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin
           homology (PH) domain.  TBC1D2A (also called
           PARIS-1/Prostate antigen recognized and identified by
           SEREX 1 and ARMUS) contains a PH domain and a TBC-type
           GTPase catalytic domain. TBC1D2A integrates signaling
           between Arf6, Rac1, and Rab7 during junction
           disassembly. Activated Rac1 recruits TBC1D2A to locally
           inactivate Rab7 via its C-terminal TBC/RabGAP domain and
           facilitate E-cadherin degradation in lysosomes. The
           TBC1D2A PH domain mediates localization at cell-cell
           contacts and coprecipitates with cadherin complexes. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 41.5 bits (98), Expect = 4e-05
 Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 19/99 (19%)

Query: 211 QHSGWLHKKSG----RNWKRYWFVLKD---QVMYKYKASEDIKALLSIPVLG----YELE 259
           +  G+L+K       + WK  WFV  +   Q+ Y Y++ +DI  L SI + G    Y+ E
Sbjct: 1   RLCGYLNKLETKGLLKTWKSRWFVFDERKCQLYY-YRSPQDITPLGSIDLSGAAFSYDPE 59

Query: 260 ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAM 298
           A          F++   G+   +  A + Q+   W++ +
Sbjct: 60  AEKGT------FEIHTPGRV-YILKASDRQAMLYWLQEL 91



 Score = 29.2 bits (66), Expect = 0.87
 Identities = 8/36 (22%), Positives = 15/36 (41%)

Query: 12 NNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKE 47
             F +    R + L+A      L W+  +Q+  +E
Sbjct: 62 KGTFEIHTPGRVYILKASDRQAMLYWLQELQSKRRE 97


>gnl|CDD|241460 cd13306, PH1_AFAP, Actin filament associated protein family
           Pleckstrin homology (PH) domain, repeat 1.  There are 3
           members of the AFAP family of adaptor proteins: AFAP1,
           AFAP1L1, and AFAP1L2/XB130. AFAP1 is a cSrc binding
           partner and actin cross-linking protein. AFAP1L1 is
           thought to play a similar role to AFAP1 in terms of
           being an actin cross-linking protein, but it
           preferentially binds to cortactin and not cSrc, thereby
           playing a role in invadosome formation. AFAP1L2 is a
           cSrc binding protein, but does not bind to actin
           filaments. AFAP1L2 acts as an intermediary between the
           RET/PTC kinase and PI-3kinase pathway in the thyroid.
           The AFAPs share a similar structure of a SH3 binding
           motif, 3 SH2 binding motifs, 2 PH domains, a coiled-coil
           region corresponding to the AFAP1 leucine zipper, and an
           actin binding domain. The amino terminal PH1 domain of
           AFAP1 has been known to function in intra-molecular
           regulation of AFAP1. In addition, the PH1 domain is a
           binding partner for PKCa and phospholipids. This cd is
           the first PH domain of AFAP. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 107

 Score = 40.9 bits (96), Expect = 7e-05
 Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 1/88 (1%)

Query: 216 LHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK-YVFQLK 274
             KK    W +   V+KD  +  YK+S+D +  L + +LG  +  + +    K +  ++ 
Sbjct: 19  WRKKWLGQWAKQLCVIKDNRLLCYKSSKDQQPQLDLNLLGCNVIYVPKDGRRKKHELKIT 78

Query: 275 HQGQDPLVFGADNEQSYERWMKAMREAT 302
             G + LV    +++  E W+K +RE +
Sbjct: 79  PPGAEALVLAVQSKEQAEEWLKVIREVS 106


>gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin
           homology (PH) domain.  ARHGAP family genes encode
           Rho/Rac/Cdc42-like GTPase activating proteins with a
           RhoGAP domain. These proteins functions as a
           GTPase-activating protein (GAP) for RHOA and CDC42.
           ARHGAP21 controls the Arp2/3 complex and F-actin
           dynamics at the Golgi complex by regulating the activity
           of the small GTPase Cdc42. It is recruited to the Golgi
           by to GTPase, ARF1, through its PH domain and its
           helical motif. It is also required for CTNNA1
           recruitment to adherens junctions. ARHGAP21 and it
           related proteins all contains a PH domain and a RhoGAP
           domain. Some of the members have additional N-terminal
           domains including PDZ, SH3, and SPEC. The ARHGAP21 PH
           domain interacts with the GTPbound forms of both ARF1
           and ARF6 ARF-binding domain/ArfBD. The members here
           include: ARHGAP15, ARHGAP21, and ARHGAP23. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 113

 Score = 40.0 bits (94), Expect = 2e-04
 Identities = 28/114 (24%), Positives = 42/114 (36%), Gaps = 34/114 (29%)

Query: 214 GWLHKK----------SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNE 263
           GWLH K          S R+WK+ W VL+   +Y YK   +    LS         A + 
Sbjct: 4   GWLHFKQSVLEKGKRASDRSWKQVWAVLRGHSLYLYKDKRETSPALSA--------AEDS 55

Query: 264 QDNF----------------KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
           +                   K VF+L        +F A++      W+KA++E 
Sbjct: 56  EQRIDIRSCIVDIAYSYTKRKNVFRLTTSDGSEYLFQAEDRDDMLGWIKAIQEN 109


>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
          domains Pleckstrin homology (PH) domain.  ACAP (also
          called centaurin beta) functions both as a Rab35
          effector and as an Arf6-GTPase-activating protein (GAP)
          by which it controls actin remodeling and membrane
          trafficking. ACAP contain an NH2-terminal
          bin/amphiphysin/Rvs (BAR) domain, a
          phospholipid-binding domain, a PH domain, a GAP domain,
          and four ankyrin repeats. The AZAPs constitute a family
          of Arf GAPs that are characterized by an NH2-terminal
          pleckstrin homology (PH) domain and a central Arf GAP
          domain followed by two or more ankyrin repeats. On the
          basis of sequence and domain organization, the AZAP
          family is further subdivided into four subfamilies: 1)
          the ACAPs contain an NH2-terminal bin/amphiphysin/Rvs
          (BAR) domain (a phospholipid-binding domain that is
          thought to sense membrane curvature), a single PH
          domain followed by the GAP domain, and four ankyrin
          repeats; 2) the ASAPs also contain an NH2-terminal BAR
          domain, the tandem PH domain/GAP domain, three ankyrin
          repeats, two proline-rich regions, and a COOH-terminal
          Src homology 3 domain; 3) the AGAPs contain an
          NH2-terminal GTPase-like domain (GLD), a split PH
          domain, and the GAP domain followed by four ankyrin
          repeats; and 4) the ARAPs contain both an Arf GAP
          domain and a Rho GAP domain, as well as an NH2-terminal
          sterile-a motif (SAM), a proline-rich region, a
          GTPase-binding domain, and five PH domains. PMID
          18003747 and 19055940 Centaurin can bind to
          phosphatidlyinositol (3,4,5)P3. PH domains have diverse
          functions, but in general are involved in targeting
          proteins to the appropriate cellular location or in the
          interaction with a binding partner. They share little
          sequence conservation, but all have a common fold,
          which is electrostatically polarized. Less than 10% of
          PH domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 98

 Score = 39.5 bits (93), Expect = 2e-04
 Identities = 14/31 (45%), Positives = 21/31 (67%)

Query: 15 FSVIAISRSFTLRARSANERLEWIDAIQTAI 45
          F V++ ++S+ L+A S  +R  WI AIQ AI
Sbjct: 63 FEVVSPTKSYMLQAESEEDRQAWIQAIQAAI 93



 Score = 33.4 bits (77), Expect = 0.026
 Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 3/32 (9%)

Query: 212 HSGWLHKKS---GRNWKRYWFVLKDQVMYKYK 240
             G+L K+S    + WKR WF +++  +   K
Sbjct: 1   KEGYLFKRSSNAFKTWKRRWFSIQNGQLVYQK 32


>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) members 1 and 2
           (PLEKHH1) PH domain, repeat 1.  PLEKHH1 and PLEKHH2
           (also called PLEKHH1L) are thought to function in
           phospholipid binding and signal transduction. There are
           3 Human PLEKHH genes: PLEKHH1, PLEKHH2, and PLEKHH3.
           There are many isoforms, the longest of which contain a
           FERM domain, a MyTH4 domain, two PH domains, a peroximal
           domain, a vacuolar domain, and a coiled coil stretch.
           The FERM domain has a cloverleaf tripart structure
           (FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe,
           B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the
           FERM domain is part of the PH domain family. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 96

 Score = 39.6 bits (93), Expect = 2e-04
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%)

Query: 213 SGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGY 256
           +G+L K  G+   WKR WFVLK+  ++ YK+  D+  K    I + G 
Sbjct: 2   AGYLTKLGGKVKTWKRRWFVLKNGELFYYKSPNDVIRKPQGQIALDGS 49



 Score = 31.5 bits (72), Expect = 0.11
 Identities = 11/34 (32%), Positives = 18/34 (52%)

Query: 15 FSVIAISRSFTLRARSANERLEWIDAIQTAIKEN 48
          F ++   R++ L A S N+  EWI  IQ  ++  
Sbjct: 61 FEIVTEKRTYYLTADSENDLDEWIRVIQNVLRRQ 94


>gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH)
           domain.  Fermitin functions as a mediator of integrin
           inside-out signalling. The recruitment of Fermitin
           proteins and Talin to the membrane mediates the terminal
           event of integrin signalling, via interaction with
           integrin beta subunits. Fermatin has FERM domain
           interrupted with a pleckstrin homology (PH) domain.
           Fermitin family homologs (Fermt1, 2, and 3, also known
           as Kindlins) are each encoded by a different gene. In
           mammalian studies, Fermt1 is generally expressed in
           epithelial cells, Fermt2 is expressed inmuscle tissues,
           and Fermt3 is expressed in hematopoietic lineages.
           Specifically Fermt2 is expressed in smooth and striated
           muscle tissues in mice and in the somites (a trunk
           muscle precursor) and neural crest in Xenopus embryos.
           As such it has been proposed that Fermt2 plays a role in
           cardiomyocyte and neural crest differentiation.
           Expression of mammalian Fermt3 is associated with
           hematopoietic lineages: the anterior ventral blood
           islands, vitelline veins, and early myeloid cells. In
           Xenopus embryos this expression, also include the
           notochord and cement gland. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 39.3 bits (92), Expect = 3e-04
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 218 KKSGRNWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGYELEALNEQDNFKYVFQLK- 274
           K + + +KRYWFV KD  +  YK+ E+     +  I + G E+         K+  +L  
Sbjct: 14  KFTLKGFKRYWFVFKDTHLSYYKSKEESNGAPIQQINLKGCEVTPDVNVSQGKFGIKLLI 73

Query: 275 --HQGQDPLVFGADNEQSYERWMKAMREA 301
              +G + +    D+E+ Y +WM A R A
Sbjct: 74  PSPEGMNEVWLRCDSEEQYAKWMAACRLA 102


>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate
           4-phosphatase and Type II inositol 3,4-bisphosphate
           4-phosphatase Pleckstrin homology (PH) domain.  INPP4A
           (also called Inositol polyphosphate 4-phosphatase type
           I) and INPP4B (also called Inositol polyphosphate
           4-phosphatase type II) both catalyze the hydrolysis of
           the 4-position phosphate of phosphatidylinositol
           3,4-bisphosphate and inositol 1,3,4-trisphosphate. They
           differ in that INPP4A additionally catalyzes the
           hydrolysis of the 4-position phosphate of inositol
           3,4-bisphosphate, while INPP4B catalyzes the hydrolysis
           of the 4-position phosphate of inositol
           1,4-bisphosphate. They both have a single PH domain
           followed by a C2 domain. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 116

 Score = 39.1 bits (92), Expect = 4e-04
 Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 3/92 (3%)

Query: 211 QHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYV 270
           Q   +  +KS    +R WF L+  +++ +K++E       + VL        E D   + 
Sbjct: 5   QMGFF--RKSEVFKER-WFKLRGNLLFYFKSNEPGSEPAGVIVLENCRVQREEPDPGGFA 61

Query: 271 FQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
           F L  + +    F   +E+  + W++A+++A+
Sbjct: 62  FSLVFKDEKKYRFSCRSEEERDEWIEAIKQAS 93



 Score = 30.3 bits (69), Expect = 0.40
 Identities = 13/32 (40%), Positives = 17/32 (53%)

Query: 28  ARSANERLEWIDAIQTAIKENEQHLLSFLNRR 59
            RS  ER EWI+AI+ A  E  +  L  L  +
Sbjct: 76  CRSEEERDEWIEAIKQASYEYLRSQLLILREK 107


>gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 4 pleckstrin
           homology (PH) domain, C-terminus, in insect and related
           arthropods.  In general, FGDs have a RhoGEF (DH) domain,
           followed by an N-terminal PH domain, a FYVE domain and a
           C-terminal PH domain. All FGDs are guanine nucleotide
           exchange factors that activates the Rho GTPase Cdc42, an
           important regulator of membrane trafficking. The RhoGEF
           domain is responsible for GEF catalytic activity, while
           the N-terminal PH domain is involved in intracellular
           targeting of the DH domain. FGD4 is one of the genes
           associated with Charcot-Marie-Tooth neuropathy type 4
           (CMT4), a group of progressive motor and sensory axonal
           and demyelinating neuropathies that are distinguished
           from other forms of CMT by autosomal recessive
           inheritance. Those affected have distal muscle weakness
           and atrophy associated with sensory loss and,
           frequently, pes cavus foot deformity. This cd contains
           insects, crustaceans, and chelicerates. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 96

 Score = 38.0 bits (88), Expect = 6e-04
 Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 12/96 (12%)

Query: 213 SGWLHKKS--GRNWKRYWFVLK-DQVMYKYKASEDIKALLSIPVLGY---ELEALNEQDN 266
           SG+L  K+   + W R WF L  D V+Y YK+ ED  AL + PV G+     E  + +D 
Sbjct: 2   SGYLKLKTNGRKTWIRRWFALHPDFVLYSYKSEEDKLALTATPVPGFLVTLGEKGSAEDP 61

Query: 267 FK-----YVFQLKHQGQDPLVFGADNEQSYERWMKA 297
                    F++ H  +    F A++    ++W+ A
Sbjct: 62  LNDKDRIRAFKMFHV-KKSYYFQANDGDEKDKWVHA 96


>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH)
           domain.  Btk is a member of the Tec family of
           cytoplasmic protein tyrosine kinases that includes BMX,
           IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a
           role in the maturation of B cells. Tec proteins general
           have an N-terminal PH domain, followed by a Tek homology
           (TH) domain, a SH3 domain, a SH2 domain and a kinase
           domain. The Btk PH domain binds phosphatidylinositol
           3,4,5-trisphosphate and responds to signalling via
           phosphatidylinositol 3-kinase. The PH domain is also
           involved in membrane anchoring which is confirmed by the
           discovery of a mutation of a critical arginine residue
           in the BTK PH domain. This results in severe human
           immunodeficiency known as X-linked agammaglobulinemia
           (XLA) in humans and a related disorder is mice.PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 140

 Score = 38.7 bits (91), Expect = 7e-04
 Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 13/100 (13%)

Query: 213 SGWLHKKS-GR------NWKRYWFVLKDQVM--YKYKASEDIKALLSIP---VLGYELEA 260
            G L K+S G+      N+K  WFVL    +  Y+    +  K   SI    +   E   
Sbjct: 2   EGLLVKRSQGKKRFGPVNYKERWFVLTKSSLSYYEGDGGKRGKEKGSIDLSKIKCVEEVK 61

Query: 261 LNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMRE 300
            +     KY FQ+ +     L   A +E+  + W+ A+R+
Sbjct: 62  DDASFERKYPFQVVY-DDYTLYVFAPSEEDRDEWILALRK 100


>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin
           homology (PH) domain.  DOCK-D subfamily (also called
           Zizimin subfamily) consists of Dock9/Zizimin1,
           Dock10/Zizimin3, and Dock11/Zizimin2. DOCK-D has a
           N-terminal DUF3398 domain, a PH-like domain, a Dock
           Homology Region 1, DHR1 (also called CZH1), a C2 domain,
           and a C-terminal DHR2 domain (also called CZH2).
           Zizimin1 is enriched in the brain, lung, and kidney;
           zizimin2 is found in B and T lymphocytes, and zizimin3
           is enriched in brain, lung, spleen and thymus. Zizimin1
           functions in autoinhibition and membrane targeting.
           Zizimin2 is an immune-related and age-regulated guanine
           nucleotide exchange factor, which facilitates filopodial
           formation through activation of Cdc42, which results in
           activation of cell migration. No function has been
           determined for Zizimin3 to date. The N-terminal half of
           zizimin1 binds to the GEF domain through three distinct
           areas, including CZH1, to inhibit the interaction with
           Cdc42. In addition its PH domain binds phosphoinositides
           and mediates zizimin1 membrane targeting. DOCK is a
           family of proteins involved in intracellular signalling
           networks. They act as guanine nucleotide exchange
           factors for small G proteins of the Rho family, such as
           Rac and Cdc42. There are 4 subfamilies of DOCK family
           proteins based on their sequence homology: A-D. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 38.0 bits (89), Expect = 0.001
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 28/122 (22%)

Query: 205 ANDSGSQHSGWLHKK----------SGRNWKRYWFVLKDQV-------MYKYKASEDIKA 247
           + +SG    G+L+K           + +++KR +F LK  V        YK + S++ K 
Sbjct: 1   SGESGITKEGYLYKGPENSSMFISLAMKSFKRRFFHLKQLVDGSYILEFYKDEKSKEAKG 60

Query: 248 LLSIPVLGYELEALNE-QDNFK---YVFQLKHQGQDPLVFGADNEQSYERWMKAMREATT 303
            +        L++      N K   + F+L+ Q     V  A++E   + W+  + +   
Sbjct: 61  TIY-------LDSCTGVVQNSKRRKFCFELRMQDGKSYVLAAESESEMDDWISKLNKILQ 113

Query: 304 LS 305
           ++
Sbjct: 114 IN 115



 Score = 29.2 bits (66), Expect = 1.4
 Identities = 8/30 (26%), Positives = 17/30 (56%)

Query: 21  SRSFTLRARSANERLEWIDAIQTAIKENEQ 50
            +S+ L A S +E  +WI  +   ++ N++
Sbjct: 88  GKSYVLAAESESEMDDWISKLNKILQINKE 117


>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human
           MTMR5) Pleckstrin Homology (PH) domain.  Sbf1 is a
           myotubularin-related pseudo-phosphatase. Both Sbf1 and
           myotubularin interact with the SET domains of Hrx and
           other epigenetic regulatory proteins, but Sbf1 lacks
           phosphatase activity due to several amino acid changes
           in its structurally preserved catalytic pocket. It
           contains pleckstrin (PH), GEF, and myotubularin homology
           domains that are thought to be responsible for signaling
           and growth control. Sbf1 functions as an inhibitor of
           cellular growth. The N-terminal GEF homology domain
           serves to inhibit the transforming effects of Sbf1. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 106

 Score = 37.7 bits (88), Expect = 0.001
 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 6/40 (15%)

Query: 212 HSGWLHKKSG--RNWKRYWFVL---KDQVMYKYKASEDIK 246
             G+L+K+    + WK+ WFVL   K Q+ Y Y++ ED K
Sbjct: 5   CEGYLYKRGALLKGWKQRWFVLDLTKHQLRY-YESKEDTK 43


>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
           protein) 1 Pleckstrin homology (PH) domain.  RASA1 (also
           called RasGap1 or p120) is a member of the RasGAP family
           of GTPase-activating proteins. RASA1 contains N-terminal
           SH2-SH3-SH2 domains, followed by two C2 domains, a PH
           domain, a RasGAP domain, and a BTK domain. Splice
           variants lack the N-terminal domains. It is a cytosolic
           vertebrate protein that acts as a suppressor of RAS via
           its C-terminal GAP domain function, enhancing the weak
           intrinsic GTPase activity of RAS proteins resulting in
           the inactive GDP-bound form of RAS, allowing control of
           cellular proliferation and differentiation.
           Additionally, it is involved in mitogenic signal
           transmission towards downstream interacting partners
           through its N-terminal SH2-SH3-SH2 domains. RASA1
           interacts with a number of proteins including: G3BP1,
           SOCS3, ANXA6, Huntingtin, KHDRBS1, Src, EPHB3, EPH
           receptor B2, Insulin-like growth factor 1 receptor,
           PTK2B, DOK1, PDGFRB, HCK, Caveolin 2, DNAJA3, HRAS,
           GNB2L1 and NCK1. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 37.3 bits (87), Expect = 0.001
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 14/100 (14%)

Query: 212 HSGWLHKKSGRN--WKRYWFVL--KDQVMYKYKASEDIKAL----LSIPVLGYELEALNE 263
             G+L KKSG+N  WK  +FVL   +Q +Y ++  +  K      LS   +    ++L  
Sbjct: 5   KKGYLLKKSGKNKKWKNLYFVLEGAEQHLYFFENEKRTKPKGLIDLSYSSVYPVHDSLFG 64

Query: 264 QDNFKYVFQLKHQGQDPLV---FGADNEQSYERWMKAMRE 300
           + N    FQ+  +  +        AD  +  + WMKA+R 
Sbjct: 65  RPN---CFQIVVRALNESTIYYLCADTAELAQDWMKALRA 101


>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin
           homology (PH) domain.  SWAP-70 (also called
           Differentially expressed in FDCP 6/DEF-6 or IRF4-binding
           protein) functions in cellular signal transduction
           pathways (in conjunction with Rac), regulates cell
           motility through actin rearrangement, and contributes to
           the transformation and invasion activity of mouse embryo
           fibroblasts. Metazoan SWAP-70 is found in B lymphocytes,
           mast cells, and in a variety of organs. Metazoan SWAP-70
           contains an N-terminal EF-hand motif, a centrally
           located PH domain, and a C-terminal coiled-coil domain.
           The PH domain of Metazoan SWAP-70 contains a
           phosphoinositide-binding site and a nuclear localization
           signal (NLS), which localize SWAP-70 to the plasma
           membrane and nucleus, respectively. The NLS is a
           sequence of four Lys residues located at the N-terminus
           of the C-terminal a-helix; this is a unique
           characteristic of the Metazoan SWAP-70 PH domain. The
           SWAP-70 PH domain binds PtdIns(3,4,5)P3 and
           PtdIns(4,5)P2 embedded in lipid bilayer vesicles. There
           are additional plant SWAP70 proteins, but these are not
           included in this hierarchy. Rice SWAP70 (OsSWAP70)
           exhibits GEF activity toward the its Rho GTPase, OsRac1,
           and regulates chitin-induced production of reactive
           oxygen species and defense gene expression in rice.
           Arabidopsis SWAP70 (AtSWAP70) plays a role in both PAMP-
           and effector-triggered immunity. Plant SWAP70 contains
           both DH and PH domains, but their arrangement is the
           reverse of that in typical DH-PH-type Rho GEFs, wherein
           the DH domain is flanked by a C-terminal PH domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 110

 Score = 37.3 bits (87), Expect = 0.001
 Identities = 17/47 (36%), Positives = 24/47 (51%)

Query: 5   LPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQH 51
           LP  E     F V    +++ L A     R EWI AIQTAI+ +++ 
Sbjct: 62  LPDREGKKCRFCVKTPDKTYELSASDHKTRQEWIQAIQTAIRLSQEG 108



 Score = 35.0 bits (81), Expect = 0.009
 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 3/35 (8%)

Query: 214 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIK 246
           G+L KK      W+  WFVLK   +  YK SED+K
Sbjct: 12  GYLWKKGHLLPTWRERWFVLKPNSLSYYK-SEDLK 45


>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
           Pleckstrin homology (PH) domain.  The binding of TAPP2
           (also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
           not PI(3,4, 5)P3, function as negative regulators of
           insulin and PI3K signalling pathways (i.e.
           TAPP/utrophin/syntrophin complex). TAPP2 contains two
           sequential PH domains in which the C-terminal PH domain
           specifically binds PtdIns(3,4)P2 with high affinity. The
           N-terminal PH domain does not interact with any
           phosphoinositide tested. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. The members here are most
           sequence similar to TAPP2 proteins, but may not be
           actual TAPP2 proteins. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 37.4 bits (87), Expect = 0.002
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)

Query: 212 HSGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDIKALLSIPV 253
            +G+L KK  R   WK+ WFVL+   +  YK  ++ + L  I +
Sbjct: 8   KAGYLEKKGERRKTWKKRWFVLRPTKLAYYKNDKEYRLLRLIDL 51



 Score = 30.5 bits (69), Expect = 0.32
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 1   MKVCLP-QTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKE 47
           +  C   Q + ++N F ++  +R+F ++A S  E   WI AI  A + 
Sbjct: 54  IHTCTEVQLKKHDNTFGIVTPARTFYVQADSKAEMESWISAINLARQA 101


>gnl|CDD|241253 cd01218, PH_Phafin2-like, Phafin2 (also called EAPF, FLJ13187,
           ZFYVE18 or PLEKHF2) Pleckstrin Homology (PH) domain.
           Phafin2 is differentially expressed in the liver cancer
           cell and regulates the structure and function of the
           endosomes through Rab5-dependent processes. Phafin2
           modulates the cell's response to extracellular
           stimulation by modulating the receptor density on the
           cell surface. Phafin2 contains a PH domain and a FYVE
           domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 123

 Score = 37.2 bits (87), Expect = 0.002
 Identities = 13/37 (35%), Positives = 22/37 (59%)

Query: 5   LPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAI 41
           L  T +  N + +I+  +SF + A +A E+ EW+D I
Sbjct: 84  LEDTGELKNGWQIISPKKSFVVYAATATEKSEWMDHI 120


>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH)
           domain, repeat 3.  MyoX, a MyTH-FERM myosin, is a
           molecular motor that has crucial functions in the
           transport and/or tethering of integrins in the
           actin-based extensions known as filopodia, microtubule
           binding, and in netrin-mediated axon guidance. It
           functions as a dimer. MyoX walks on bundles of actin,
           rather than single filaments, unlike the other
           unconventional myosins. MyoX is present in organisms
           ranging from humans to choanoflagellates, but not in
           Drosophila and Caenorhabditis elegans.MyoX consists of a
           N-terminal motor/head region, a neck made of 3 IQ
           motifs, and a tail consisting of a coiled-coil domain, a
           PEST region, 3 PH domains, a myosin tail homology 4
           (MyTH4), and a FERM domain at its very C-terminus. The
           first PH domain in the MyoX tail is a split-PH domain,
           interupted by the second PH domain such that PH 1a and
           PH 1b flanks PH 2. The third PH domain (PH 3) follows
           the PH 1b domain. This cd contains the third MyoX PH
           repeat. PLEKHH3/Pleckstrin homology (PH) domain
           containing, family H (with MyTH4 domain) member 3 is
           also part of this CD and like MyoX contains a FERM
           domain, a MyTH4 domain, and a single PH domain. Not much
           is known about the function of PLEKHH3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 123

 Score = 37.3 bits (87), Expect = 0.002
 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%)

Query: 202 EVTANDSGSQHSGWLHKKSG-RNW---KRYWFVLKDQVMYKYKASED 244
           +    D      GWL K+ G       K+ WFVL    +  YK+SE 
Sbjct: 5   QTDEGDQEVIEKGWLLKEGGKGGNLTKKKRWFVLTPNSLDYYKSSER 51


>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 1.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the first PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 108

 Score = 36.6 bits (85), Expect = 0.002
 Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 3/93 (3%)

Query: 214 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEA-LNEQDNFKYV 270
           G+L KK     NWK  WFVL +  +  YK   D      I + G  + +   E +    V
Sbjct: 7   GFLVKKGHVVNNWKARWFVLLEDKLEYYKKKTDSSPKGMILLKGCTITSPCLEYEKRPLV 66

Query: 271 FQLKHQGQDPLVFGADNEQSYERWMKAMREATT 303
           F+L           A + +  + W K + +A T
Sbjct: 67  FKLTTAKGQDHFLQACSREERDAWAKDITKAIT 99


>gnl|CDD|241254 cd01219, PH1_FGD1, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 1 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Mutations in the FGD1 gene
           are responsible for the X-linked disorder known as
           faciogenital dysplasia (FGDY). Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 36.5 bits (84), Expect = 0.003
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSF 55
           F V    RS  L+AR+  E+ +WI AI+  I  +EQ L +F
Sbjct: 67  FLVSGKQRSLELQARTEEEKKDWIQAIEATINRHEQTLETF 107


>gnl|CDD|241538 cd13387, PH1_FGD3, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 3 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Both FGD1 and FGD3 are
           targeted by the ubiquitin ligase SCF(FWD1/beta-TrCP)
           upon phosphorylation of two serine residues in its
           DSGIDS motif and subsequently degraded by the
           proteasome. However, FGD1 and FGD3 induced significantly
           different morphological changes in HeLa Tet-Off cells
           and while FGD1 induced long finger-like protrusions,
           FGD3 induced broad sheet-like protrusions when the level
           of GTP-bound Cdc42 was significantly increased by the
           inducible expression of FGD3. They also reciprocally
           regulated cell motility in inducibly expressed in HeLa
           Tet-Off cells, FGD1 stimulated cell migration while FGD3
           inhibited it. FGD1 and FGD3 therefore play different
           roles to regulate cellular functions, even though their
           intracellular levels are tightly controlled by the same
           destruction pathway through SCF(FWD1/beta-TrCP).  PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 36.1 bits (83), Expect = 0.004
 Identities = 15/41 (36%), Positives = 25/41 (60%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSF 55
           F +    RS  L+AR+  E+ EWI  IQ  I++++Q+  +F
Sbjct: 67  FIITGKKRSLELQARTEEEKKEWIQVIQATIEKHKQNSETF 107


>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH)
           domain.  PKB (also called Akt), a member of the AGC
           kinase family, is a phosphatidylinositol 3'-kinase
           (PI3K)-dependent Ser/Thr kinase which alters the
           activity of the targeted protein. The name AGC is based
           on the three proteins that it is most similar to
           cAMP-dependent protein kinase 1 (PKA; also known as
           PKAC), cGMP-dependent protein kinase (PKG; also known as
           CGK1) and protein kinase C (PKC). Human Akt has three
           isoforms derived for distinct genes: Akt1/PKBalpha,
           Akt2/PKBbeta, and Akt3/PKBgamma. All Akts have an
           N-terminal PH domain with an activating Thr
           phosphorylation site, a kinase domain, and a short
           C-terminal regulatory tail with an activating Ser
           phosphorylation site. The PH domain recruits Akt to the
           plasma membrane by binding to phosphoinositides
           (PtdIns-3,4-P2) and is required for activation. The
           phosphorylation of Akt at its Thr and Ser
           phosphorylation sites leads to increased Akt activity
           toward forkhead transcription factors, the mammalian
           target of rapamycin (mTOR), and the
           Bcl-xL/Bcl-2-associated death promoter (BAD), all of
           which possess a consensus motif R-X-R-XX-ST-B (X = amino
           acid, B = bulky hydrophobic residue) for Akt
           phosphorylation. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 121

 Score = 35.8 bits (83), Expect = 0.005
 Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%)

Query: 212 HSGWLHKKSG--RNWKRYWFVLK 232
             GWL K+    + W+  WFVLK
Sbjct: 5   KEGWLTKRGEYIKTWRPRWFVLK 27


>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, C-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain specifically
           binds PtdIns(3,4)P2 with high affinity. The N-terminal
           PH domain does not interact with any phosphoinositide
           tested. They also contain a C-terminal PDZ-binding motif
           that interacts with several PDZ-binding proteins,
           including PTPN13 (known previously as PTPL1 or FAP-1) as
           well as the scaffolding proteins MUPP1 (multiple
           PDZ-domain-containing protein 1), syntrophin and
           utrophin. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 114

 Score = 35.8 bits (83), Expect = 0.006
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)

Query: 213 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIP 252
           SG+  K+    +NWKR +F+L D  +  YK+  D + L +IP
Sbjct: 11  SGYCVKQGAVRKNWKRRYFILDDNTISYYKSETDKEPLRTIP 52



 Score = 30.4 bits (69), Expect = 0.40
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 13  NEFSVIAISRSFTLRARSANERLEWIDAIQTAI 45
           N F +I  SR+F ++A S  +   WI AI  AI
Sbjct: 72  NLFEIITTSRTFYIQADSPEDMHSWIKAISGAI 104


>gnl|CDD|241418 cd13264, PH_ITSN, Intersectin Pleckstrin homology (PH) domain.
           ITSNs, an adaptor protein family, play a role in endo-
           and exocytosis, actin cytoskeleton rearrangement and
           signal transduction. There are two human ITSN genes:
           ITSN1 and ITSN2. They share significant sequence
           identity and a similar domain structure having both
           short and long isoforms produced by alternative
           splicing. The short isoform (ITSN-S) consists of two
           Eps15 homology domains (EH1 and EH2), a coiled-coil
           region (CCR) and five Src homology 3 domains (SH3A-E).
           The EH domains bind to Asn-Pro-Phe motifs and are
           implicated in endocytosis and vesicle transport. The SH3
           domains bind to proline-rich sequences and are commonly
           found in proteins implicated in cell signalling
           pathways, cytoskeletal organization and membrane
           traffic. The long isoform (ITSN-L) contains three
           additional C-terminal domains, a Dbl homology domain
           (DH), a Pleckstrin homology domain (PH) and a C2 domain.
           The tandem DH-PH domains are present in all Dbl family
           of GEFs. ITSN acts specifically on Cdc42 through its DH
           domain with no portion of the PH domain making contact
           with Cdc42. This is in contrast to Dbs which requires
           the PH domain for full catalytic activity. The ITSN PH
           domain binds phosphoinositides. C2 domains are usually
           involved in Ca2+-dependent and Ca2+-independent
           phospholipid binding. There are more than 30 proteins
           that interact with ITSNs. ITSN-S is present in mammals,
           frogs, flies and nematodes, while ITSN-L is present only
           in vertebrates. PH domains have diverse functions, but
           in general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 132

 Score = 35.9 bits (83), Expect = 0.006
 Identities = 14/30 (46%), Positives = 18/30 (60%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTA 44
           F +  I R +TLRA S NER  W+  I+ A
Sbjct: 93  FHISHIDRVYTLRAESINERTAWVQKIKAA 122


>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
           (PH) domain, repeat 2.  ADAP (also called centaurin
           alpha) is a phophatidlyinositide binding protein
           consisting of an N-terminal ArfGAP domain and two PH
           domains. In response to growth factor activation, PI3K
           phosphorylates phosphatidylinositol 4,5-bisphosphate to
           phosphatidylinositol 3,4,5-trisphosphate. Centaurin
           alpha 1 is recruited to the plasma membrane following
           growth factor stimulation by specific binding of its PH
           domain to phosphatidylinositol 3,4,5-trisphosphate.
           Centaurin alpha 2 is constitutively bound to the plasma
           membrane since it binds phosphatidylinositol
           4,5-bisphosphate and phosphatidylinositol
           3,4,5-trisphosphate with equal affinity. This cd
           contains the second PH domain repeat. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 34.9 bits (81), Expect = 0.008
 Identities = 15/46 (32%), Positives = 23/46 (50%), Gaps = 2/46 (4%)

Query: 2   KVCLPQ--TEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAI 45
           +  LP      +   F+++   R+F L A +  ER EWI AIQ  +
Sbjct: 58  REGLPAGIKGHWGFGFTLVTPDRTFVLSAETEEERREWITAIQKVL 103



 Score = 32.2 bits (74), Expect = 0.085
 Identities = 22/100 (22%), Positives = 41/100 (41%), Gaps = 15/100 (15%)

Query: 214 GWLHK---KSGRNWKRYWFVLKDQ-VMYKYKASEDIKALLSIPVLGYELE--------AL 261
           G+L K   K    +++ WF L D+ +MY +K   D      I  +G + E          
Sbjct: 6   GYLEKTGPKQTDGFRKRWFTLDDRRLMY-FKDPLDAFPKGEIF-IGSKEEGYSVREGLPA 63

Query: 262 NEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
             + ++ + F L        V  A+ E+    W+ A+++ 
Sbjct: 64  GIKGHWGFGFTL-VTPDRTFVLSAETEEERREWITAIQKV 102


>gnl|CDD|241423 cd13269, PH_alsin, Alsin Pleckstrin homology (PH) domain.  The ALS2
           gene encodes alsin, a GEF, that has dual specificity for
           Rac1 and Rab5 GTPases. Alsin mutations in the form of
           truncated proteins are responsible for motor function
           disorders including juvenile-onset amyotrophic lateral
           sclerosis, familial juvenile primary lateral sclerosis,
           and infantile-onset ascending hereditary spastic
           paralysis. The alsin protein is widely expressed in the
           developing CNS including neurons of the cerebral cortex,
           brain stem, spinal cord, and cerebellum. Alsin contains
           a regulator of chromosome condensation 1 (RCC1) domain,
           a Rho guanine nucleotide exchanging factor (RhoGEF)
           domain, a PH domain, a Membrane Occupation and
           Recognition Nexus (MORN), a vacuolar protein sorting 9
           (Vps9) domain, and a Dbl homology (DH) domain. Alsin
           interacts with Rab5 through its Vps9 domain and through
           this interaction modulates early endosome fusion and
           trafficking. The GEF activity of alsin towards Rab5 is
           regulated by Rac1 function. The GEF activity of alsin
           for Rac1 occurs via its DH domain and this interaction
           plays a role in promoting spinal motor neuron survival
           via multiple Rac-dependent signaling pathways. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 106

 Score = 35.1 bits (81), Expect = 0.008
 Identities = 14/42 (33%), Positives = 20/42 (47%)

Query: 5   LPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIK 46
           +P  +   N   +     SFTL A +  E+ EW+ AI  AI 
Sbjct: 60  IPDEDSGQNALKITTPEESFTLVASTPQEKAEWLRAINQAID 101


>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein
           Pleckstrin homology (PH) domain.  M-RIP is proposed to
           play a role in myosin phosphatase regulation by RhoA.
           M-RIP contains 2 PH domains followed by a Rho binding
           domain (Rho-BD), and a C-terminal myosin binding subunit
           (MBS) binding domain (MBS-BD). The amino terminus of
           M-RIP with its adjacent PH domains and polyproline
           motifs mediates binding to both actin and Galpha. M-RIP
           brings RhoA and MBS into close proximity where M-RIP can
           target RhoA to the myosin phosphatase complex to
           regulate the myosin phosphorylation state. M-RIP does
           this via its C-terminal coiled-coil domain which
           interacts with the MBS leucine zipper domain of myosin
           phosphatase, while its Rho-BD, directly binds RhoA in a
           nucleotide-independent manner. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 103

 Score = 33.8 bits (78), Expect = 0.018
 Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)

Query: 214 GWLHKKSGRN-WKRYWFVLKDQVMYKYKASED 244
           GWL K+     WK++WFVL+D  +  Y+ S  
Sbjct: 3   GWLMKQDEDGEWKKHWFVLRDASLRYYRDSVA 34


>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain.  There
           are 2 members of the evectin family (also called
           pleckstrin homology domain containing, family B): evt-1
           (also called PLEKHB1) and evt-2 (also called PLEKHB2).
           evt-1 is specific to the nervous system, where it is
           expressed in photoreceptors and myelinating glia. evt-2
           is widely expressed in both neural and nonneural
           tissues. Evectins possess a single N-terminal PH domain
           and a C-terminal hydrophobic region. evt-1 is thought to
           function as a mediator of post-Golgi trafficking in
           cells that produce large membrane-rich organelles. It is
           a candidate gene for the inherited human retinopathy
           autosomal dominant familial exudative vitreoretinopathy
           and a susceptibility gene for multiple sclerosis. evt-2
           is essential for retrograde endosomal membrane transport
           from the plasma membrane (PM) to the Golgi. Two membrane
           trafficking pathways pass through recycling endosomes: a
           recycling pathway and a retrograde pathway that links
           the PM to the Golgi/ER. Its PH domain that is unique in
           that it specifically recognizes phosphatidylserine (PS),
           but not polyphosphoinositides. PS is an anionic
           phospholipid class in eukaryotic biomembranes, is highly
           enriched in the PM, and plays key roles in various
           physiological processes such as the coagulation cascade,
           recruitment and activation of signaling molecules, and
           clearance of apoptotic cells. PH domains are only found
           in eukaryotes. They share little sequence conservation,
           but all have a common fold, which is electrostatically
           polarized. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 33.8 bits (78), Expect = 0.021
 Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 2/22 (9%)

Query: 213 SGWLHKKSG--RNWKRYWFVLK 232
           SGWL ++S   + WK+ WFVL 
Sbjct: 6   SGWLLRQSTILKRWKKNWFVLY 27


>gnl|CDD|241537 cd13386, PH1_FGD2, FYVE, RhoGEF and PH domain
           containing/faciogenital dysplasia protein 2 pleckstrin
           homology (PH), N-terminal domain.  In general, FGDs have
           a RhoGEF (DH) domain, followed by an N-terminal PH
           domain, a FYVE domain and a C-terminal PH domain. All
           FGDs are guanine nucleotide exchange factors that
           activates the Rho GTPase Cdc42, an important regulator
           of membrane trafficking. The RhoGEF domain is
           responsible for GEF catalytic activity, while the
           N-terminal PH domain is involved in intracellular
           targeting of the DH domain. Not much is known about
           FGD2.  FGD1 is the best characterized member of the
           group with mutations here leading to the X-linked
           disorder known as faciogenital dysplasia (FGDY). PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 107

 Score = 33.8 bits (77), Expect = 0.022
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 1   MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHLLSF 55
           MKV      ++ + F V    R+  L+ARS  E + WI A Q AI + E+   +F
Sbjct: 53  MKVRELMDAEFPHSFLVSGKQRTLELQARSQEEMIAWIKAFQAAIDQKEKRNETF 107


>gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH)
           domain.  Beta spectrin binds actin and functions as a
           major component of the cytoskeleton underlying cellular
           membranes. Beta spectrin consists of multiple spectrin
           repeats followed by a PH domain, which binds to
           inositol-1,4,5-trisphosphate. The PH domain of
           beta-spectrin is thought to play a role in the
           association of spectrin with the plasma membrane of
           cells. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 105

 Score = 33.7 bits (78), Expect = 0.022
 Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 5/89 (5%)

Query: 218 KKSGRNWKRYWFVLKDQVMYKYK-----ASEDIKALLSIPVLGYELEALNEQDNFKYVFQ 272
           K S R+WK+ + VLK Q +  YK     ASE       + + G   E  ++    K+VF+
Sbjct: 17  KASNRSWKKVYCVLKGQELSFYKDQKAAASESYAGEPPLNLSGAVCEVASDYKKKKHVFR 76

Query: 273 LKHQGQDPLVFGADNEQSYERWMKAMREA 301
           L+       +F A +E+    W++ ++ A
Sbjct: 77  LRLSDGSEYLFQAKDEEEMNDWVQKLQAA 105


>gnl|CDD|241444 cd13290, PH_ORP9, Human Oxysterol binding protein related protein
          9 Pleckstrin homology (PH) domain.  Human ORP9 is
          proposed to function in regulation of Akt
          phosphorylation. ORP9 has 2 forms, a long (ORP9L) and a
          short (ORP9S). ORP9L contains an N-terminal PH domain,
          a FFAT motif (two phenylalanines in an acidic tract),
          and a C-terminal OSBP-related domain. ORP1S is
          truncated and contains a FFAT motif and an OSBP-related
          domain. Oxysterol binding proteins are a multigene
          family that is conserved in yeast, flies, worms,
          mammals and plants. In general OSBPs and ORPs have been
          found to be involved in the transport and metabolism of
          cholesterol and related lipids in eukaryotes. They all
          contain a C-terminal oxysterol binding domain, and most
          contain an N-terminal PH domain. OSBP PH domains bind
          to membrane phosphoinositides and thus likely play an
          important role in intracellular targeting. They are
          members of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP),
          Goodpasture antigen binding protein (GPBP), and Four
          phosphate adaptor protein 1 (FAPP1). They have a wide
          range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 102

 Score = 33.2 bits (76), Expect = 0.039
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 9  EDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQ 50
          ED ++ F++    ++F  +AR A ER  WI A++  I  + Q
Sbjct: 59 ED-DSTFTITVDQKTFHFQARDAEERERWIRALEDTILRHSQ 99


>gnl|CDD|241255 cd01220, PH1_FARP1-like, FERM, RhoGEF and pleckstrin
           domain-containing protein 1 and related proteins
           Pleckstrin Homology (PH) domain, repeat 1.  Members here
           include FARP1 (also called Chondrocyte-derived
           ezrin-like protein; PH domain-containing family C member
           2), FARP2 (also called FIR/FERM domain including RhoGEF;
           FGD1-related Cdc42-GEF/FRG), and FARP6 (also called Zinc
           finger FYVE domain-containing protein 24). They are
           members of the Dbl family guanine nucleotide exchange
           factors (GEFs) which are upstream positive regulators of
           Rho GTPases. Little is known about FARP1 and FARP6,
           though FARP1 has increased expression in differentiated
           chondrocytes. FARP2 is thought to regulate neurite
           remodeling by mediating the signaling pathways from
           membrane proteins to Rac. It is found in brain, lung,
           and testis, as well as embryonic hippocampal and
           cortical neurons. FARP1 and FARP2 are composed of a
           N-terminal FERM domain, a proline-rich (PR) domain,
           Dbl-homology (DH), and two C-terminal PH domains. FARP6
           is composed of Dbl-homology (DH), and two C-terminal PH
           domains separated by a FYVE domain. This hierarchy
           contains the first PH repeat. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 123

 Score = 33.1 bits (76), Expect = 0.049
 Identities = 21/92 (22%), Positives = 42/92 (45%), Gaps = 5/92 (5%)

Query: 214 GWLHKKSGRNWK-RYWFVLKDQVMYKYK---ASEDIKALLSIPVLGYELEALNEQDNFKY 269
           G L K S +  + R +F+  D ++Y  +   ++   K    +P+ G  +E    +    +
Sbjct: 26  GCLLKLSKKGLQQRMFFLFSDVLIYTSRGPTSTLQFKVHGQLPLRGLMVEESEPEMGVPH 85

Query: 270 VFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
            F + + G   L   A +E+  ERW++ +  A
Sbjct: 86  CFTI-YGGNRALTVAASSEEEKERWLEDLSRA 116



 Score = 28.4 bits (64), Expect = 2.4
 Identities = 9/34 (26%), Positives = 19/34 (55%)

Query: 12  NNEFSVIAISRSFTLRARSANERLEWIDAIQTAI 45
            + F++   +R+ T+ A S  E+  W++ +  AI
Sbjct: 84  PHCFTIYGGNRALTVAASSEEEKERWLEDLSRAI 117


>gnl|CDD|235514 PRK05580, PRK05580, primosome assembly protein PriA; Validated.
          Length = 679

 Score = 34.7 bits (81), Expect = 0.052
 Identities = 33/119 (27%), Positives = 46/119 (38%), Gaps = 47/119 (39%)

Query: 26  LRARSANERLEW-----IDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPL--- 77
           +R     E   +     ++AI+  ++  EQ LL FLNRR            G  AP    
Sbjct: 339 MRELLRGENGSFLSPPLLEAIKQRLERGEQVLL-FLNRR------------G-YAPFLLC 384

Query: 78  ----WIPDSRVSMCQRCTSVFTV-TFRR----HHC-------RACGKVVCGPCSDYLAP 120
               W     V+ C  C +  T+  F+R    HHC       +AC +  CG  S  L P
Sbjct: 385 RDCGW-----VAECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPE--CG--STDLVP 434


>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin
           homology (PH) domain.  The kinesin-3 family motors KIFIA
           (Caenorhabditis elegans homolog unc-104) and KIFIB
           transport synaptic vesicle precursors that contain
           synaptic vesicle proteins, such as synaptophysin,
           synaptotagmin and the small GTPase RAB3A, but they do
           not transport organelles that contain plasma membrane
           proteins. They have a N-terminal motor domain, followed
           by a coiled-coil domain, and a C-terminal PH domain.
           KIF1A adopts a monomeric form in vitro, but acts as a
           processive dimer in vivo. KIF1B has alternatively
           spliced isoforms distinguished by the presence or
           absence of insertion sequences in the conserved
           amino-terminal region of the protein; this results in
           their different motor activities. KIF1A and KIF1B bind
           to RAB3 proteins through the adaptor protein
           mitogen-activated protein kinase (MAPK) -activating
           death domain (MADD; also calledDENN), which was first
           identified as a RAB3 guanine nucleotide exchange factor
           (GEF). PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 32.9 bits (76), Expect = 0.053
 Identities = 12/30 (40%), Positives = 18/30 (60%)

Query: 12  NNEFSVIAISRSFTLRARSANERLEWIDAI 41
            N F+V   + S+ L+ARS  E  +W+ AI
Sbjct: 77  PNVFAVYTPTNSYLLQARSEKEMHDWLYAI 106



 Score = 30.6 bits (70), Expect = 0.34
 Identities = 21/101 (20%), Positives = 35/101 (34%), Gaps = 33/101 (32%)

Query: 195 YVPQ-RLIEVTANDSGSQHSGWLH--KKSGRNWKRYWFVLKDQVMYKYK----------- 240
            V +  LI  +         G+L   + +   W R W VL+   ++ Y            
Sbjct: 1   LVAEVELIPKSPV---VSKKGYLLFLEDATDGWVRRWVVLRRPYLHIYSSEKDGDERGVI 57

Query: 241 --------ASEDIKALLSIPVL--------GYELEALNEQD 265
                    S D +ALL  P +         Y L+A +E++
Sbjct: 58  NLSTARVEYSPDQEALLGRPNVFAVYTPTNSYLLQARSEKE 98


>gnl|CDD|241463 cd13309, PH_SKIP, SifA and kinesin-interacting protein Pleckstrin
           homology (PH) domain.  SKIP (also called
           PLEKHM2/Pleckstrin homology domain-containing family M
           member 2) is a soluble cytosolic protein that contains a
           RUN domain and a PH domain separated by a unstructured
           linker region. SKIP is a target of the Salmonella
           effector protein SifA and the SifA-SKIP complex
           regulates kinesin-1 on the bacterial vacuole. The PH
           domain of SKIP binds to the N-terminal region of SifA
           while the N-terminus of SKIP is proposed to bind the TPR
           domain of the kinesin light chain. The opposite side of
           the SKIP PH domain is proposed to bind
           phosphoinositides. TSifA, SKIP, SseJ, and RhoA family
           GTPases are also thought to promote host membrane
           tubulation. Recently, it was shown that the lysosomal
           GTPase Arl8 binds to the kinesin-1 linker SKIP and that
           both are required for the normal intracellular
           distribution of lysosomes. Interestingly, two kinesin
           light chain binding motifs (WD) in SKIP have now been
           identified to match a consensus sequence for a kinesin
           light chain binding site found in several proteins
           including calsyntenin-1/alcadein, caytaxin, and vaccinia
           virus A36. SKIP has also been shown to interact with
           Rab1A. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 32.7 bits (75), Expect = 0.057
 Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 8/97 (8%)

Query: 213 SGWLHKKSGR------NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDN 266
            G L  K+G        WK  +F+LK+ V+Y+Y    D   LLSI + G +       +N
Sbjct: 3   EGPLMYKTGTSYLGGETWKPGYFLLKNGVLYQYPDRSDRLPLLSISLGGEQCGGCRRINN 62

Query: 267 FK--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
               + F+L    +  L   A +E     W++++ ++
Sbjct: 63  TDRPHSFELILTDRPSLELAAPDEYEASEWLQSLCQS 99


>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and
          PH domain Pleckstrin homology (PH) domain, repeat 1.
          ARAP proteins (also called centaurin delta) are
          phosphatidylinositol 3,4,5-trisphosphate-dependent
          GTPase-activating proteins that modulate actin
          cytoskeleton remodeling by regulating ARF and RHO
          family members. They bind phosphatidylinositol
          3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
          phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
          binding. There are 3 mammalian ARAP proteins: ARAP1,
          ARAP2, and ARAP3. All ARAP proteins contain a
          N-terminal SAM (sterile alpha motif) domain, 5 PH
          domains, an ArfGAP domain, 2 ankyrin domain, A RhoGap
          domain, and a Ras-associating domain. This hierarchy
          contains the first PH domain in ARAP. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 93

 Score = 32.3 bits (74), Expect = 0.057
 Identities = 14/35 (40%), Positives = 21/35 (60%)

Query: 13 NEFSVIAISRSFTLRARSANERLEWIDAIQTAIKE 47
          N+F V+  +R+F  RA S +ER  W+  +  AI E
Sbjct: 58 NKFEVVTGNRTFVFRAESEDERNLWVSTLMAAISE 92



 Score = 32.3 bits (74), Expect = 0.069
 Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 10/93 (10%)

Query: 213 SGWLHKKSGRN---WKRYWFVLK-DQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK 268
           SGWL K S +    +++ W V   D + Y + + +++ +   IP+    ++ +    + K
Sbjct: 3   SGWLDKLSPQGNYVFQKRWVVFDGDSLRY-FNSEKEMYSKGIIPL--SSIKTVRSVGDNK 59

Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
             F++   G    VF A++E     W+  +  A
Sbjct: 60  --FEV-VTGNRTFVFRAESEDERNLWVSTLMAA 89


>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related
           protein Pleckstrin homology (PH) domain.  Plant ORPs
           contain a N-terminal PH domain and a C-terminal
           OSBP-related domain. Not much is known about its
           specific function in plants to date. Members here
           include: Arabidopsis, spruce, and petunia. Oxysterol
           binding proteins are a multigene family that is
           conserved in yeast, flies, worms, mammals and plants. In
           general OSBPs and ORPs have been found to be involved in
           the transport and metabolism of cholesterol and related
           lipids in eukaryotes. They all contain a C-terminal
           oxysterol binding domain, and most contain an N-terminal
           PH domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 32.5 bits (74), Expect = 0.063
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)

Query: 214 GWLHK--KSGRNWKRYWFVLKDQVM--YKYKASEDIKALLSIPVLGYELEALNEQDNFKY 269
           G L+K    G+ W+  WFVL+D V+  YK    + +K    + +    +      D   Y
Sbjct: 3   GILYKWVNYGKGWRSRWFVLQDGVLSYYKVHGPDKVKPSGEVHLKVSSIRESRSDDKKFY 62

Query: 270 VFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
           +F     G   L   A++ +    W++A++ A
Sbjct: 63  IF----TGTKTLHLRAESREDRAAWLEALQAA 90



 Score = 29.4 bits (66), Expect = 0.86
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 15 FSVIAISRSFTLRARSANERLEWIDAIQTA 44
          F +   +++  LRA S  +R  W++A+Q A
Sbjct: 61 FYIFTGTKTLHLRAESREDRAAWLEALQAA 90


>gnl|CDD|241403 cd13249, PH_anillin_2, Anillin Pleckstrin homology (PH) domain.
           Anillin is an actin binding protein involved in
           cytokinesis. It has a C-terminal PH domain, which has
           been shown to be necessary, but not sufficient for
           targetting of anillin to ectopic septin containing foci.
           PH domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 111

 Score = 31.6 bits (72), Expect = 0.14
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 13/98 (13%)

Query: 213 SGWLHKKSG----RNWKRYWFVLKDQVMYKYKASEDIKA----LLSIPVLGYELEALNEQ 264
           SG+L ++      ++W R + VLK   +  Y + E+I+A    LL+IP+         ++
Sbjct: 5   SGYLSQQQSVEGLQSWTRLYCVLKGGNLLCYYSPEEIEAKVEPLLTIPINKDTRIRAVDK 64

Query: 265 DNFKYVFQLKHQGQDP-----LVFGADNEQSYERWMKA 297
           D     F L      P      VF AD+ +  + WM+A
Sbjct: 65  DAQGRSFNLSIINPYPGDEVTHVFSADSREDLQLWMEA 102


>gnl|CDD|140324 PTZ00303, PTZ00303, phosphatidylinositol kinase; Provisional.
          Length = 1374

 Score = 33.5 bits (76), Expect = 0.15
 Identities = 25/88 (28%), Positives = 30/88 (34%), Gaps = 24/88 (27%)

Query: 76  PLWIPDSRVS-MCQRCTSVFT-----VTFRRHHCRACGKVVCGPCSDYLAPLEYKKF--- 126
           P W  D   S  C  C   F      +  R HHCR+CG  +C  C    A   + K    
Sbjct: 451 PSWQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKP 510

Query: 127 ------RNFRVCEECY---------HYL 139
                     VC+ CY         HYL
Sbjct: 511 GSSDEAEERLVCDTCYKEYETVSQLHYL 538


>gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2
           Pleckstrin Homology (PH) domain, N-terminal domain.
           Tiam1 activates Rac GTPases to induce membrane ruffling
           and cell motility while Tiam2 (also called STEF (SIF
           (still life) and Tiam1 like-exchange factor) contributes
           to neurite growth. Tiam1/2 are Dbl-family of GEFs that
           possess a Dbl(DH) domain with a PH domain in tandem.
           DH-PH domain catalyzes the GDP/GTP exchange reaction in
           the GTPase cycle and facillitating the switch between
           inactive GDP-bound and active GTP-bound states. Tiam1/2
           possess two PH domains, which are often referred to as
           PHn and PHc domains. The DH-PH tandem domain is made up
           of the PHc domain while the PHn is part of a novel
           N-terminal PHCCEx domain which is made up of the PHn
           domain, a coiled coil region(CC), and an extra region
           (Ex). PHCCEx mediates binding to plasma membranes and
           signalling proteins in the activation of Rac GTPases.
           The PH domain resembles the beta-spectrin PH domain,
           suggesting non-canonical phosphatidylinositol binding.
           CC and Ex form a positively charged surface for protein
           binding. There are 2 motifs in Tiam1/2-interacting
           proteins that bind to the PHCCEx domain: Motif-I in
           CD44, ephrinBs, and the NMDA receptor and Motif-II in
           Par3 and JIP2.Neither of these fall in the PHn domain.
           PH domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 127

 Score = 32.0 bits (73), Expect = 0.15
 Identities = 29/109 (26%), Positives = 41/109 (37%), Gaps = 20/109 (18%)

Query: 213 SGWLHKK--------------SGRNWKRYWFVLKDQVMYKYKASE-DIKALLSIPVLGYE 257
           +GWL  K              S R WK+YW  LK   +  Y+  E       S P     
Sbjct: 6   AGWLSVKNFLTHKKKKKLELASRRKWKKYWVTLKGCTLLFYECDERTGIDDNSTPKHALF 65

Query: 258 LE-----ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
           +E     A+ E      VF L +   D  +F A ++   E W+ A+  A
Sbjct: 66  VEGSIAQAVPEHPKKDNVFCLSNSFGDAYLFQATSQTELENWITAIHSA 114


>gnl|CDD|241539 cd13388, PH1_FGD4, FYVE, RhoGEF and PH domain
          containing/faciogenital dysplasia protein 4 pleckstrin
          homology (PH), N-terminal domain.  In general, FGDs
          have a RhoGEF (DH) domain, followed by an N-terminal PH
          domain, a FYVE domain and a C-terminal PH domain. All
          FGDs are guanine nucleotide exchange factors that
          activates the Rho GTPase Cdc42, an important regulator
          of membrane trafficking. The RhoGEF domain is
          responsible for GEF catalytic activity, while the
          N-terminal PH domain is involved in intracellular
          targeting of the DH domain. FGD4 is one of the genes
          associated with Charcot-Marie-Tooth neuropathy type 4
          (CMT4), a group of progressive motor and sensory axonal
          and demyelinating neuropathies that are distinguished
          from other forms of CMT by autosomal recessive
          inheritance. Those affected have distal muscle weakness
          and atrophy associated with sensory loss and,
          frequently, pes cavus foot deformity. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 92

 Score = 31.3 bits (71), Expect = 0.15
 Identities = 13/40 (32%), Positives = 17/40 (42%)

Query: 1  MKVCLPQTEDYNNEFSVIAISRSFTLRARSANERLEWIDA 40
          M+V      +  N F V    R   L   +  E+ EWIDA
Sbjct: 53 MQVLEGDNLETENTFYVRGKQRCVELCTGTQKEKEEWIDA 92


>gnl|CDD|241388 cd13234, PHsplit_PLC_gamma, Phospholipase C-gamma Split pleckstrin
           homology (PH) domain.  PLC-gamma (PLCgamma) is activated
           by receptor and non-receptor tyrosine kinases due to the
           presence of its SH2 and SH3 domains. There are two main
           isoforms of PLC-gamma expressed in human specimens,
           PLC-gamma1 and PLC-gamma2. PLC-gamma consists of an
           N-terminal PH domain, a EF hand domain, a catalytic
           domain split into X and Y halves internal to which is a
           PH domain split by two SH2 domains and a single SH3
           domain, and a C-terminal C2 domain. The split PH domain
           is present in this hierarchy. PLCs (EC 3.1.4.3) play a
           role in the initiation of cellular activation,
           proliferation, differentiation and apoptosis. They are
           central to inositol lipid signalling pathways,
           facilitating intracellular Ca2+ release and protein
           kinase C (PKC) activation. Specificaly, PLCs catalyze
           the cleavage of phosphatidylinositol-4,5-bisphosphate
           (PIP2) and result in the release of 1,2-diacylglycerol
           (DAG) and inositol 1,4,5-triphosphate (IP3). These
           products trigger the activation of protein kinase C
           (PKC) and the release of Ca2+ from intracellular stores.
           There are fourteen kinds of mammalian phospholipase C
           proteins which are are classified into six isotypes
           (beta, gamma, delta, epsilon, zeta, eta). PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 105

 Score = 31.2 bits (71), Expect = 0.19
 Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 7/86 (8%)

Query: 224 WKRYWFVLKDQVMYKYKASED--IKALL--SIPVLGYELEALNEQDNFK-YVFQL--KHQ 276
           W  ++FVL    +Y  + +E+  + +LL   + V    +    E  N + +VF L  K  
Sbjct: 17  WTPHYFVLTSNKIYYSEETENSPLGSLLRGILDVPSCHVVIRPEGKNSRPFVFILSPKQL 76

Query: 277 GQDPLVFGADNEQSYERWMKAMREAT 302
               L   AD ++    W++ +RE T
Sbjct: 77  SDPSLDVAADTQEELFDWVQKIREIT 102


>gnl|CDD|241428 cd13274, PH_DGK_type2, Type 2 Diacylglycerol kinase Pleckstrin
          homology (PH) domain.  DGK (also called DAGK) catalyzes
          the conversion of diacylglycerol (DAG) to phosphatidic
          acid (PA) utilizing ATP as a source of the phosphate.
          In non-stimulated cells, DGK activity is low and DAG is
          used for glycerophospholipid biosynthesis. Upon
          receptor activation of the phosphoinositide pathway,
          DGK activity increases which drives the conversion of
          DAG to PA. DGK acts as a switch by terminating the
          signalling of one lipid while simultaneously activating
          signalling by another. There are 9 mammalian DGK
          isoforms all with conserved catalytic domains and two
          cysteine rich domains. These are further classified
          into 5 groups according to the presence of additional
          functional domains and substrate specificity: Type 1 -
          DGK-alpha, DGK-beta, DGK-gamma - contain EF-hand motifs
          and a recoverin homology domain; Type 2 - DGK-delta,
          DGK-eta, and DGK-kappa- contain a pleckstrin homology
          domain, two cysteine-rich zinc finger-like structures,
          and a separated catalytic region; Type 3 - DGK-epsilon
          - has specificity for arachidonate-containing DAG; Type
          4 - DGK-zeta, DGK-iota- contain a MARCKS homology
          domain, ankyrin repeats, a C-terminal nuclear
          localization signal, and a PDZ-binding motif; Type 5 -
          DGK-theta - contains a third cysteine-rich domain, a
          pleckstrin homology domain and a proline rich region.
          The type 2 DGKs are present as part of this Metazoan
          DGK hierarchy. They have a N-terminal PH domain, two
          cysteine rich domains, followed by bipartite catalytic
          domains, and a C-terminal SAM domain. Their catalytic
          domains and perhaps other DGK catalytic domains may
          function as two independent units in a coordinated
          fashion. They may also require other motifs for maximal
          activity because several DGK catalytic domains have
          very little DAG kinase activity when expressed as
          isolated subunits. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 97

 Score = 30.8 bits (70), Expect = 0.20
 Identities = 15/37 (40%), Positives = 21/37 (56%)

Query: 8  TEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTA 44
          T++ N+ F+VI   R   L A S  E  EWI A++T 
Sbjct: 54 TKNVNHSFTVITPFRKLILCAESRKEMEEWISALKTV 90


>gnl|CDD|241437 cd13283, PH_GPBP, Goodpasture antigen binding protein Pleckstrin
          homology (PH) domain.  The GPBP (also called Collagen
          type IV alpha-3-binding protein/hCERT; START
          domain-containing protein 11/StARD11; StAR-related
          lipid transfer protein 11) is a kinase that
          phosphorylates an N-terminal region of the alpha 3
          chain of type IV collagen, which is commonly known as
          the goodpasture antigen. Its splice variant the
          ceramide transporter (CERT) mediates the cytosolic
          transport of ceramide. There have been additional
          splice variants identified, but all of them function as
          ceramide transport proteins. GPBP and CERT both contain
          an N-terminal PH domain, followed by a serine rich
          domain, and a C-terminal START domain. However, GPBP
          has an additional serine rich domain just upstream of
          its START domain. They are members of the oxysterol
          binding protein (OSBP) family which includes OSBP,
          OSBP-related proteins (ORP), Goodpasture antigen
          binding protein (GPBP), and Four phosphate adaptor
          protein 1 (FAPP1). They have a wide range of purported
          functions including sterol transport, cell cycle
          control, pollen development and vessicle transport from
          Golgi recognize both PI lipids and ARF proteins. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 100

 Score = 30.7 bits (70), Expect = 0.24
 Identities = 11/31 (35%), Positives = 15/31 (48%)

Query: 13 NEFSVIAISRSFTLRARSANERLEWIDAIQT 43
            F V      + LRA S  ER  W+DA++ 
Sbjct: 59 CRFDVSVNDSVWYLRAESPEERQRWVDALEA 89


>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2
           Pleckstrin homology (PH) domain.  Human FAPP1 (also
           called PLEKHA3/Pleckstrin homology domain-containing,
           family A member 3) regulates secretory transport from
           the trans-Golgi network to the plasma membrane. It is
           recruited through binding of PH domain to
           phosphatidylinositol 4-phosphate (PtdIns(4)P) and a
           small GTPase ADP-ribosylation factor 1 (ARF1). These two
           binding sites have little overlap the FAPP1 PH domain to
           associate with both ligands simultaneously and
           independently. FAPP1 has a N-terminal PH domain followed
           by a short proline-rich region. FAPP1 is a member of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), and Goodpasture
           antigen binding protein (GPBP). They have a wide range
           of purported functions including sterol transport, cell
           cycle control, pollen development and vessicle transport
           from Golgi recognize both PI lipids and ARF proteins.
           FAPP2 (also called PLEKHA8/Pleckstrin homology
           domain-containing, family A member 8), a member of the
           Glycolipid lipid transfer protein(GLTP) family has an
           N-terminal PH domain that targets the TGN and C-terminal
           GLTP domain. FAPP2 functions to traffic glucosylceramide
           (GlcCer) which is made in the Golgi. It's interaction
           with vesicle-associated membrane protein-associated
           protein (VAP) could be a means of regulation. Some
           FAPP2s share the FFAT-like motifs found in GLTP. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 100

 Score = 30.4 bits (69), Expect = 0.29
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)

Query: 215 WLHKKSGRNWKRYWFVLKDQVMYKYKASEDI 245
           W +  SG  W+  WFVL D V+  YK+ E++
Sbjct: 8   WTNYLSG--WQPRWFVLDDGVLSYYKSQEEV 36


>gnl|CDD|241456 cd13302, PH2_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
           domain, repeat 2.  Pleckstrin is a protein found in
           platelets. This name is derived from platelet and
           leukocyte C kinase substrate and the KSTR string of
           amino acids. Pleckstrin 2 contains two PH domains and a
           DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
           pleckstrin 1, pleckstrin 2 does not contain obvious
           sites of PKC phosphorylation. Pleckstrin 2 plays a role
           in actin rearrangement, large lamellipodia and
           peripheral ruffle formation, and may help orchestrate
           cytoskeletal arrangement. The PH domains of pleckstrin 2
           are thought to contribute to lamellipodia formation.
           This cd contains the second PH domain repeat. PH domains
           have diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 109

 Score = 30.6 bits (69), Expect = 0.29
 Identities = 14/34 (41%), Positives = 18/34 (52%), Gaps = 1/34 (2%)

Query: 12  NNEFSVIAISR-SFTLRARSANERLEWIDAIQTA 44
            N F +I      + L+A +  ER EWI AIQ A
Sbjct: 75  GNLFEIITADEVHYYLQAATPAERTEWIKAIQMA 108


>gnl|CDD|241267 cd01234, PH_CADPS, Ca2+-dependent activator protein (also called
           CAPS) Pleckstrin homology (PH) domain.  CADPS/CAPS
           consists of two members, CAPS1 which regulates
           catecholamine release from neuroendocrine cells and
           CAPS2 which is involved in the release of two
           neurotrophins, brain-derived neurotrophic factor (BDNF)
           and neurotrophin-3 (NT-3) from cerebellar granule cells.
           CADPS plays an important role in vesicle exocytosis in
           neurons and endocrine cells where it functions to prime
           the exocytic machinery for Ca2+-triggered fusion.
           Priming involves the assembly of trans SNARE complexes.
           The initial interaction of vesicles with target
           membranes is mediated by diverse stage-specific
           tethering factors or multi-subunit tethering complexes.
           CADPS and Munc13 proteins are proposed to be the
           functional homologs of the stage-specific tethering
           factors that prime membrane fusion. Interestingly,
           regions in the C-terminal half of CADPS are similar to
           the C-terminal region of Munc13-1 that was reported to
           bind syntaxin-1. CADPS has independent interactions with
           each of the SNARE proteins (Q-SNARE and R-SNARE)
           required for vesicle fusion. CADPS interacts with
           Q-SNARE proteins syntaxin-1 (H3 SNARE) and SNAP-25 (SN1)
           and might promote Q-SNARE heterodimer formation. Through
           its N-terminal R-SNARE VAMP-2 interactions, CADPS bound
           to heterodimeric Q-SNARE complexes could be involved in
           catalyzing the zippering of VAMP-2 into recipient
           complexes. It also contains a central PH domain that
           binds to phosphoinositide 4,5 bisphosphate containing
           liposomes. Membrane association may also be mediated by
           binding to phosphatidlyserine via general electrostatic
           interactions. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 122

 Score = 30.8 bits (70), Expect = 0.31
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 21/107 (19%)

Query: 212 HSGWLH---KKSGRNWKRYWFVLKDQVM--------YKYKASEDIKALLSIPVLGYELEA 260
           H G+L+   K   + WK+ +FVL  QV         Y+ K SE  +    + + GY ++ 
Sbjct: 10  HCGYLYALGKSVWKKWKKRYFVLV-QVSQYTFAMCSYREKKSEPQE---MMQLDGYTVDY 65

Query: 261 LNEQDNF-----KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
              Q +      ++ F    +G D ++F +D+E   + W++A+  AT
Sbjct: 66  TEPQPDLGLEGGRFFFNAVKEG-DSVLFASDDENDRQLWVQALYRAT 111


>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
           3-Phosphoinositides Pleckstrin homology (PH) domain.
           DAPP1 (also known as PHISH/3'
           phosphoinositide-interacting SH2 domain-containing
           protein or Bam32) plays a role in B-cell activation and
           has potential roles in T-cell and mast cell function.
           DAPP1 promotes B cell receptor (BCR) induced activation
           of Rho GTPases Rac1 and Cdc42, which feed into
           mitogen-activated protein kinases (MAPK) activation
           pathways and affect cytoskeletal rearrangement. DAPP1can
           also regulate BCR-induced activation of extracellular
           signal-regulated kinase (ERK), and c-jun NH2-terminal
           kinase (JNK). DAPP1 contains an N-terminal SH2 domain
           and a C-terminal pleckstrin homology (PH) domain with a
           single tyrosine phosphorylation site located centrally.
           DAPP1 binds strongly to both PtdIns(3,4,5)P3 and
           PtdIns(3,4)P2. The PH domain is essential for plasma
           membrane recruitment of PI3K upon cell activation. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 96

 Score = 30.3 bits (69), Expect = 0.36
 Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)

Query: 213 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKAL 248
            G+L K+ G  +NWK  WFVL+   +  +K   D K +
Sbjct: 6   EGYLTKQGGIVKNWKTRWFVLRKNELKYFKTRTDTKPI 43


>gnl|CDD|219987 pfam08719, DUF1768, Domain of unknown function (DUF1768).  This is
           a domain of unknown function. It is alpha helical in
           structure. The GO annotation for this protein suggests
           it is involved in nematode larval development and has a
           positive regulation on growth rate.
          Length = 146

 Score = 30.6 bits (70), Expect = 0.46
 Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 11/49 (22%)

Query: 212 HSGWLHKKSGRNWKRY------WFVLKDQVMY-----KYKASEDIKALL 249
            S    KK GR  + +      W  +K  VM      K+  +ED++ LL
Sbjct: 56  KSPAEAKKLGRKVRNFDEARKDWDKVKVDVMREALYAKFSQNEDLRELL 104


>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain.  Budding
           yeast contain two main p21-activated kinases (PAKs),
           Cla4 and Ste20. The yeast Ste20 protein kinase is
           involved in pheromone response, though the function of
           Ste20 mammalian homologs is unknown. Cla4 is involved in
           budding and cytokinesis and interacts with Cdc42, a
           GTPase required for polarized cell growth as is Pak.
           Cla4 and Ste20 kinases share a function in localizing
           cell growth with respect to the septin ring. They both
           contain a PH domain, a Cdc42/Rac interactive binding
           (CRIB) domain, and a C-terminal Protein Kinase catalytic
           (PKc) domain. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 91

 Score = 29.1 bits (66), Expect = 0.74
 Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 7/89 (7%)

Query: 212 HSGWLHKKSGRN----WKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 267
            SGW+  K        W + + VL++Q +  YK      A LSIP+   ++  ++  D  
Sbjct: 3   KSGWVSVKEDGLLSFRWSKRYLVLREQSLDFYKNESSSSASLSIPL--KDISNVSRTDLK 60

Query: 268 KYVFQLKHQGQDPLVFGA-DNEQSYERWM 295
            Y F++  +     ++ +  ++     WM
Sbjct: 61  PYCFEIVRKSSTKSIYISVKSDDELYDWM 89


>gnl|CDD|214384 CHL00174, accD, acetyl-CoA carboxylase beta subunit; Reviewed.
          Length = 296

 Score = 30.6 bits (70), Expect = 0.77
 Identities = 10/20 (50%), Positives = 12/20 (60%), Gaps = 3/20 (15%)

Query: 121 LEYKKF--RNFRVCEEC-YH 137
           L YKKF      +CE+C YH
Sbjct: 47  LNYKKFLKSKMNICEQCGYH 66


>gnl|CDD|241424 cd13270, PH1_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
           Pleckstrin homology (PH) domain, N-terminal repeat.  The
           binding of TAPP1 (also called PLEKHA1/pleckstrin
           homology domain containing, family A (phosphoinositide
           binding specific) member 1) and TAPP2 (also called
           PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
           5)P3, function as negative regulators of insulin and
           PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
           complex). TAPP1 and TAPP2 contain two sequential PH
           domains in which the C-terminal PH domain binds
           PtdIns(3,4)P2. They also contain a C-terminal
           PDZ-binding motif that interacts with several
           PDZ-binding proteins, including PTPN13 (known previously
           as PTPL1 or FAP-1) as well as the scaffolding proteins
           MUPP1 (multiple PDZ-domain-containing protein 1),
           syntrophin and utrophin. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 118

 Score = 29.7 bits (67), Expect = 0.77
 Identities = 11/32 (34%), Positives = 19/32 (59%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTAIK 46
           F + A+SR + L+A    +  EW++A+  A K
Sbjct: 81  FVINALSRRYFLQANDQQDLEEWVEALNDASK 112


>gnl|CDD|241440 cd13286, PH_OPR5_ORP8, Human Oxysterol binding protein related
           proteins 5 and 8 Pleckstrin homology (PH) domain.  Human
           ORP5 is proposed to function in efficient nonvesicular
           transfer of low-density lipoproteins-derived cholesterol
           (LDL-C) from late endosomes/lysosomes to the endoplasmic
           reticulum (ER). Human ORP8 is proposed to modulate lipid
           homeostasis and sterol regulatory element binding
           proteins (SREBP) activity. Both ORP5 and ORP8 contain a
           N-terminal PH domain, a C-terminal OSBP-related domain,
           followed by a transmembrane domain that localizes ORP5
           to the ER. Unlike all the other human OSBP/ORPs they
           lack a FFAT motif (two phenylalanines in an acidic
           tract). Oxysterol binding proteins are a multigene
           family that is conserved in yeast, flies, worms, mammals
           and plants. In general OSBPs and ORPs have been found to
           be involved in the transport and metabolism of
           cholesterol and related lipids in eukaryotes. They all
           contain a C-terminal oxysterol binding domain, and most
           contain an N-terminal PH domain. OSBP PH domains bind to
           membrane phosphoinositides and thus likely play an
           important role in intracellular targeting. They are
           members of the oxysterol binding protein (OSBP) family
           which includes OSBP, OSBP-related proteins (ORP),
           Goodpasture antigen binding protein (GPBP), and Four
           phosphate adaptor protein 1 (FAPP1). They have a wide
           range of purported functions including sterol transport,
           cell cycle control, pollen development and vessicle
           transport from Golgi recognize both PI lipids and ARF
           proteins. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 130

 Score = 29.6 bits (67), Expect = 0.83
 Identities = 26/114 (22%), Positives = 49/114 (42%), Gaps = 27/114 (23%)

Query: 213 SGWLH-KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYEL-EALNEQDNFKYV 270
           S WL  + + ++W + W VLK  V+  YK+ +  + + ++ +   E+ E  +++D F   
Sbjct: 11  SDWLKIRGTLKSWTKLWCVLKPGVLLLYKSPKHGQWVGTVLLNACEVIERPSKKDGF--C 68

Query: 271 FQLKH------------QGQ-----------DPLVFGADNEQSYERWMKAMREA 301
           F+L H            +G+             L+F A  E     WM A+  +
Sbjct: 69  FKLYHPLDQSIWATRGPKGESVGAITQPLPSSHLIFRAATESDGRCWMDALELS 122


>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain.
           Anillin (Rhotekin/RTKN; also called PLEKHK/Pleckstrin
           homology domain-containing family K) is an actin binding
           protein involved in cytokinesis. It interacts with
           GTP-bound Rho proteins and results in the inhibition of
           their GTPase activity. Dysregulation of the Rho signal
           transduction pathway has been implicated in many forms
           of cancer. Anillin proteins have a N-terminal HRI
           domain/ACC (anti-parallel coiled-coil) finger domain or
           Rho-binding domain binds small GTPases from the Rho
           family. The C-terminal PH domain helps target anillin to
           ectopic septin containing foci. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 119

 Score = 29.6 bits (67), Expect = 0.92
 Identities = 25/118 (21%), Positives = 41/118 (34%), Gaps = 33/118 (27%)

Query: 211 QHSGWL---HKKSGR-NWKRYWFVLKDQVMYKYKASEDI---KALLSIPVLGY------- 256
           +H G+L      SG   W R W VL+   +  +K  ED    K + SI  L         
Sbjct: 3   EHRGFLTVFEDVSGLGAWHRRWCVLRGGYLSFWKYPEDEEKKKPIGSID-LRKCINEKVE 61

Query: 257 -------------ELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
                        ELE L   ++           +  ++  AD ++    W+ A+ + 
Sbjct: 62  PASRELCARPNTFELETLRPAED-----SDGTNEKKRVLLSADTKEERIEWLDALNQT 114


>gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating
           protein) family pleckstrin homology (PH) domain.
           RASAL1, GAP1(m), GAP1(IP4BP), and CAPRI are all members
           of the GAP1 family of GTPase-activating proteins. They
           contain N-terminal SH2-SH3-SH2 domains, followed by two
           C2 domains, a PH domain, a RasGAP domain, and a BTK
           domain. With the notable exception of GAP1(m), they all
           possess an arginine finger-dependent GAP activity on the
           Ras-related protein Rap1. They act as a suppressor of
           RAS enhancing the weak intrinsic GTPase activity of RAS
           proteins resulting in the inactive GDP-bound form of
           RAS, allowing control of cellular proliferation and
           differentiation. PH domains share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 107

 Score = 28.8 bits (65), Expect = 1.2
 Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 16/102 (15%)

Query: 213 SGWLHKK--------SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPV---LGYELEAL 261
            G+L K+          +N+K+ +F L ++ +  Y  S+  + L SIP+   L   +E +
Sbjct: 2   EGYLIKRAQGRKGKLGRKNFKKRYFRLTNEAL-SYSKSKGSQPLCSIPLQDILA--VERV 58

Query: 262 NEQD-NFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
           +E+    K +FQ+       L   A N      W+ A+R+  
Sbjct: 59  DEKSFKMKNMFQVVQP-DRTLYLQAKNVVELNEWLSALRKVC 99



 Score = 26.5 bits (59), Expect = 9.1
 Identities = 12/41 (29%), Positives = 20/41 (48%)

Query: 12  NNEFSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQHL 52
            N F V+   R+  L+A++  E  EW+ A++     N   L
Sbjct: 66  KNMFQVVQPDRTLYLQAKNVVELNEWLSALRKVCLCNPNRL 106


>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional.
          Length = 989

 Score = 30.4 bits (68), Expect = 1.4
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 8/90 (8%)

Query: 213 SGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLS-IP---VLGYELEALNEQDNFK 268
           SG+L     R +   W +L    ++ +K+  D+   L+ IP   + G  ++ L + +   
Sbjct: 54  SGYLKPHPSRMYYNVWSILPATSVFIFKSYHDVLCTLTHIPDSGLFGLPMDTLYKPE--- 110

Query: 269 YVFQLKHQGQDPLVFGADNEQSYERWMKAM 298
            V  L+ QG++ +  GA   Q   RW   M
Sbjct: 111 -VDALRAQGRNVVEVGALATQYSRRWTNLM 139


>gnl|CDD|218944 pfam06221, zf-C2HC5, Putative zinc finger motif, C2HC5-type.  This
           zinc finger appears to be common in activating signal
           cointegrator 1/thyroid receptor interacting protein 4.
          Length = 53

 Score = 27.3 bits (61), Expect = 1.6
 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 9/32 (28%)

Query: 99  RRHH----CRACGKVVC-----GPCSDYLAPL 121
            RH     C  CGK++C     GPCS    PL
Sbjct: 10  TRHPLAPNCLNCGKIICEKEGLGPCSFCGTPL 41


>gnl|CDD|241410 cd13256, PH3_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain, repeat 3.  ARAP
           proteins (also called centaurin delta) are
           phosphatidylinositol 3,4,5-trisphosphate-dependent
           GTPase-activating proteins that modulate actin
           cytoskeleton remodeling by regulating ARF and RHO family
           members. They bind phosphatidylinositol
           3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
           phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
           binding. There are 3 mammalian ARAP proteins: ARAP1,
           ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
           SAM (sterile alpha motif) domain, 5 PH domains, an
           ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
           Ras-associating domain. This hierarchy contains the
           third PH domain in ARAP. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 28.5 bits (64), Expect = 1.6
 Identities = 20/98 (20%), Positives = 39/98 (39%), Gaps = 11/98 (11%)

Query: 208 SGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKY---KASE-----DIKALLSIPVLGYELE 259
           + S       +K    + R W VL+D  +  Y   K++      DI  ++    L     
Sbjct: 11  TASMAKPTTERKGKEEFSRRWCVLEDGFLSYYESDKSTTPNGEIDISEIVC---LAVNPP 67

Query: 260 ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKA 297
             +    F++ F+L  + +   +FG +  ++   W KA
Sbjct: 68  DTDPGHGFEFTFELYLESERLYLFGTETAEAAHEWTKA 105


>gnl|CDD|241465 cd13311, PH_Slm1, Slm1 Pleckstrin homology (PH) domain.  Slm1 is a
           component of the target of rapamycin complex 2 (TORC2)
           signaling pathway. It plays a role in the regulation of
           actin organization and is a target of sphingolipid
           signaling during the heat shock response. Slm1 contains
           a single PH domain that binds PtdIns(4,5)P2, PtdIns(4)P,
           and dihydrosphingosine 1-phosphate (DHS-1P). Slm1
           possesses two binding sites for anionic lipids. The
           non-canonical binding site of the PH domain of Slm1 is
           used for ligand binding, and it is proposed that
           beta-spectrin, Tiam1 and ArhGAP9 also have this type of
           phosphoinositide binding site. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 110

 Score = 28.5 bits (64), Expect = 1.6
 Identities = 23/107 (21%), Positives = 52/107 (48%), Gaps = 16/107 (14%)

Query: 212 HSGWLHKKSG--RNWKRYWFVLK-DQVMYKYKASEDIKA---LLSIPVLGYELEALNEQD 265
            SG+L +KS   +++ + ++VL     ++++K+S+  K     +S+ +    L A +++ 
Sbjct: 5   ISGFLERKSKFLKSYSKGYYVLTPAGYLHEFKSSDRKKDPAPEMSLYLPECVLGAPSDEG 64

Query: 266 NFKYVFQLK---------HQGQDPLVFGADNEQSYERWMKAMREATT 303
              + F LK         H+G +  VF A++ +    W + ++  T 
Sbjct: 65  GKSHKFILKGKDVGSGKFHRGHE-WVFKAESHEEMMAWWEDIKTLTK 110



 Score = 28.1 bits (63), Expect = 2.5
 Identities = 7/24 (29%), Positives = 12/24 (50%)

Query: 23  SFTLRARSANERLEWIDAIQTAIK 46
            +  +A S  E + W + I+T  K
Sbjct: 87  EWVFKAESHEEMMAWWEDIKTLTK 110


>gnl|CDD|241461 cd13307, PH2_AFAP, Actin filament associated protein family
           Pleckstrin homology (PH) domain, repeat 2.  There are 3
           members of the AFAP family of adaptor proteins: AFAP1,
           AFAP1L1, and AFAP1L2/XB130. AFAP1 is a cSrc binding
           partner and actin cross-linking protein. AFAP1L1 is
           thought to play a similar role to AFAP1 in terms of
           being an actin cross-linking protein, but it
           preferentially binds to cortactin and not cSrc, thereby
           playing a role in invadosome formation. AFAP1L2 is a
           cSrc binding protein, but does not bind to actin
           filaments. AFAP1L2 acts as an intermediary between the
           RET/PTC kinase and PI-3kinase pathway in the thyroid.
           The AFAPs share a similar structure of a SH3 binding
           motif, 3 SH2 binding motifs, 2 PH domains, a coiled-coil
           region corresponding to the AFAP1 leucine zipper, and an
           actin binding domain. This cd is the second PH domain of
           AFAP. PH domains have diverse functions, but in general
           are involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 101

 Score = 28.5 bits (64), Expect = 1.7
 Identities = 19/91 (20%), Positives = 40/91 (43%), Gaps = 2/91 (2%)

Query: 213 SGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIK-ALLSIPVLGYELEALNEQDNFKYVF 271
            G+L+      W+  W  +KD  ++ Y+    +K     +P+ G E+    +  +  Y F
Sbjct: 5   CGYLNVLVNCQWRSRWCCVKDGQLHFYQDRNKLKSPQQPLPLRGCEVIPGPDPKH-PYSF 63

Query: 272 QLKHQGQDPLVFGADNEQSYERWMKAMREAT 302
           ++   G++  V  A + +   RW+  +   T
Sbjct: 64  RILRNGEEVAVLEASSSEDMGRWLGLLLAET 94


>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like. 
          Coniferyl aldehyde dehydrogenase (CALDH, EC=1.2.1.68)
          of Pseudomonas sp. strain HR199 (CalB) which catalyzes
          the NAD+-dependent oxidation of coniferyl aldehyde to
          ferulic acid, and similar sequences, are present in
          this CD.
          Length = 434

 Score = 29.8 bits (68), Expect = 1.9
 Identities = 9/44 (20%), Positives = 22/44 (50%), Gaps = 4/44 (9%)

Query: 30 SANERLEWIDAIQTAIKENEQHLLSFLNR----RSLTQSSIPEL 69
          S  ER + +D ++  + +N+  L   ++     RS  ++ + E+
Sbjct: 18 SLEERRDRLDRLKALLLDNQDALAEAISADFGHRSRHETLLAEI 61


>gnl|CDD|241408 cd13254, PH2_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and
          PH domain Pleckstrin homology (PH) domain, repeat 2.
          ARAP proteins (also called centaurin delta) are
          phosphatidylinositol 3,4,5-trisphosphate-dependent
          GTPase-activating proteins that modulate actin
          cytoskeleton remodeling by regulating ARF and RHO
          family members. They bind phosphatidylinositol
          3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
          phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
          binding. There are 3 mammalian ARAP proteins: ARAP1,
          ARAP2, and ARAP3. All ARAP proteins contain a
          N-terminal SAM (sterile alpha motif) domain, 5 PH
          domains, an ArfGAP domain, 2 ankyrin domain, A RhoGap
          domain, and a Ras-associating domain. This hierarchy
          contains the second PH domain in ARAP. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 90

 Score = 28.0 bits (63), Expect = 2.1
 Identities = 10/28 (35%), Positives = 16/28 (57%)

Query: 15 FSVIAISRSFTLRARSANERLEWIDAIQ 42
          F +    R F+  A S  E+ EW++A+Q
Sbjct: 63 FDLTTPYRIFSFTAESEREKQEWVEALQ 90


>gnl|CDD|241445 cd13291, PH_ORP10_ORP11, Human Oxysterol binding protein (OSBP)
          related proteins 10 and 11 (ORP10 and ORP11) Pleckstrin
          homology (PH) domain.  Human ORP10 is involvedt in
          intracellular transport or organelle positioning and is
          proposed to function as a regulator of cellular lipid
          metabolism. Human ORP11 localizes at the Golgi-late
          endosome interface and is thought to form a dimer with
          ORP9 functioning as an intracellular lipid sensor or
          transporter. Both ORP10 and ORP11 contain a N-terminal
          PH domain, a FFAT motif (two phenylalanines in an
          acidic tract), and a C-terminal OSBP-related domain.
          Oxysterol binding proteins are a multigene family that
          is conserved in yeast, flies, worms, mammals and
          plants. In general OSBPs and ORPs have been found to be
          involved in the transport and metabolism of cholesterol
          and related lipids in eukaryotes. They all contain a
          C-terminal oxysterol binding domain, and most contain
          an N-terminal PH domain. OSBP PH domains bind to
          membrane phosphoinositides and thus likely play an
          important role in intracellular targeting. They are
          members of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP),
          Goodpasture antigen binding protein (GPBP), and Four
          phosphate adaptor protein 1 (FAPP1). They have a wide
          range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 107

 Score = 28.0 bits (63), Expect = 2.1
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 2/42 (4%)

Query: 6  PQTEDYNNEFSVIAIS-RSFTLRARSANERLEWIDAIQTAIK 46
          P  ED ++ F+V A +   + LRA  A ER EW++ ++   +
Sbjct: 55 PSDED-SHTFTVNAANGEMYKLRAADAKERQEWVNRLRAVAE 95


>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
          OSBP-related protein 4 Pleckstrin homology (PH) domain.
           Human OSBP is proposed to function is sterol-dependent
          regulation of ERK dephosphorylation and sphingomyelin
          synthesis as well as modulation of insulin signaling
          and hepatic lipogenesis. It contains a N-terminal PH
          domain, a FFAT motif (two phenylalanines in an acidic
          tract), and a C-terminal OSBP-related domain. OSBPs and
          Osh1p PH domains specifically localize to the Golgi
          apparatus in a PtdIns4P-dependent manner. ORP4 is
          proposed to function in Vimentin-dependent sterol
          transport and/or signaling. Human ORP4 has 2 forms, a
          long (ORP4L) and a short (ORP4S). ORP4L contains a
          N-terminal PH domain, a FFAT motif (two phenylalanines
          in an acidic tract), and a C-terminal OSBP-related
          domain. ORP4S is truncated and contains only an
          OSBP-related domain. Oxysterol binding proteins are a
          multigene family that is conserved in yeast, flies,
          worms, mammals and plants. They all contain a
          C-terminal oxysterol binding domain, and most contain
          an N-terminal PH domain. OSBP PH domains bind to
          membrane phosphoinositides and thus likely play an
          important role in intracellular targeting. They are
          members of the oxysterol binding protein (OSBP) family
          which includes OSBP, OSBP-related proteins (ORP),
          Goodpasture antigen binding protein (GPBP), and Four
          phosphate adaptor protein 1 (FAPP1). They have a wide
          range of purported functions including sterol
          transport, cell cycle control, pollen development and
          vessicle transport from Golgi recognize both PI lipids
          and ARF proteins. PH domains have diverse functions,
          but in general are involved in targeting proteins to
          the appropriate cellular location or in the interaction
          with a binding partner. They share little sequence
          conservation, but all have a common fold, which is
          electrostatically polarized. Less than 10% of PH
          domains bind phosphoinositide phosphates (PIPs) with
          high affinity and specificity. PH domains are
          distinguished from other PIP-binding domains by their
          specific high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 99

 Score = 27.7 bits (62), Expect = 2.6
 Identities = 13/37 (35%), Positives = 20/37 (54%)

Query: 8  TEDYNNEFSVIAISRSFTLRARSANERLEWIDAIQTA 44
          TED  N       +++F L+A S  ER  W+ A++ A
Sbjct: 53 TEDSCNFVISNGGTQTFHLKASSEVERQRWVTALELA 89


>gnl|CDD|232953 TIGR00392, ileS, isoleucyl-tRNA synthetase.  The isoleucyl tRNA
           synthetase (IleS) is a class I amino acyl-tRNA ligase
           and is particularly closely related to the valyl tRNA
           synthetase. This model may recognize IleS from every
           species, including eukaryotic cytosolic and
           mitochondrial forms [Protein synthesis, tRNA
           aminoacylation].
          Length = 861

 Score = 29.6 bits (67), Expect = 2.7
 Identities = 17/77 (22%), Positives = 29/77 (37%), Gaps = 4/77 (5%)

Query: 131 VCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRSNFKEMGTAGRRKPSK 190
             EE Y  L    ++E  ++    +      D     N M I+R    E   A R   +K
Sbjct: 781 TAEEIYQNLPGGEEEESVHLNLWPEVDEEFIDEALEAN-MAIVREIV-EAFLALRDAANK 838

Query: 191 KYRKYVPQRLIEVTAND 207
           K R+  P + + +  + 
Sbjct: 839 KLRQ--PLKELVIGKSL 853


>gnl|CDD|224119 COG1198, PriA, Primosomal protein N' (replication factor Y) -
           superfamily II helicase [DNA replication, recombination,
           and repair].
          Length = 730

 Score = 29.6 bits (67), Expect = 2.7
 Identities = 22/101 (21%), Positives = 31/101 (30%), Gaps = 41/101 (40%)

Query: 38  IDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVT 97
           ++AI+  ++  EQ LL FLNRR                                    + 
Sbjct: 410 LEAIRKTLERGEQVLL-FLNRRGY--------------------------------APLL 436

Query: 98  FRRHHCRACGKVVCGP-CSDYLAPLEYKKFRNFRVCEECYH 137
                CR CG +   P C    +PL   K      C  C +
Sbjct: 437 L----CRDCGYIAECPNCD---SPLTLHKATGQLRCHYCGY 470


>gnl|CDD|221224 pfam11790, Glyco_hydro_cc, Glycosyl hydrolase catalytic core.
          This family is probably a glycosyl hydrolase, and is
          conserved in fungi and some Proteobacteria. The pombe
          member is annotated as being from IPR013781.
          Length = 186

 Score = 28.4 bits (64), Expect = 3.2
 Identities = 8/19 (42%), Positives = 13/19 (68%)

Query: 37 WIDAIQTAIKENEQHLLSF 55
          W+ A+Q+AI    ++LL F
Sbjct: 3  WLAAVQSAIGSGSKYLLGF 21


>gnl|CDD|188547 TIGR04032, toxin_SdpC, antimicrobial peptide, SdpC family.  This
           protein family contains the antimicrobial peptide SdpC,
           used in cannibalistic killing by Bacillus subtilis, and
           related sequences in species as distant as Myxococcus
           xanthus from the Deltaproteobacteria. A conserved gene
           neighborhood includes proteins associated with immunity.
          Length = 172

 Score = 28.5 bits (64), Expect = 3.4
 Identities = 16/80 (20%), Positives = 32/80 (40%), Gaps = 8/80 (10%)

Query: 112 GPCSDYLAPL----EYKKFRNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNHQVT 167
           GP +  L  L      K + N    +E  + L+ +   +D   F+R+K      D  +V 
Sbjct: 21  GPAAKKLPELWQKNLIKAYNNSPEAKELANDLIAKIKKKDPAYFDRLKEAVYSGDPLKVD 80

Query: 168 NMM----DIIRSNFKEMGTA 183
            ++    ++++    E   A
Sbjct: 81  ELLTKGGELLQEAAAESTAA 100


>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB
           domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167
           (BAR)-Pleckstrin homology (PH) domain.  APPL (also
           called DCC-interacting protein (DIP)-13alpha) interacts
           with oncoprotein serine/threonine kinase AKT2, tumor
           suppressor protein DCC (deleted in colorectal cancer),
           Rab5, GIPC (GAIP-interacting protein, C terminus), human
           follicle-stimulating hormone receptor (FSHR), and the
           adiponectin receptors AdipoR1 and AdipoR2. There are two
           isoforms of human APPL: APPL1 and APPL2, which share
           about 50% sequence identity. APPL has a BAR and a PH
           domain near its N terminus, and the two domains are
           thought to function as a unit (BAR-PH domain).
           C-terminal to this is a PTB domain. Lipid binding assays
           show that the BAR, PH, and PTB domains can bind
           phospholipids. PH domains have diverse functions, but in
           general are involved in targeting proteins to the
           appropriate cellular location or in the interaction with
           a binding partner. They share little sequence
           conservation, but all have a common fold, which is
           electrostatically polarized. Less than 10% of PH domains
           bind phosphoinositide phosphates (PIPs) with high
           affinity and specificity. PH domains are distinguished
           from other PIP-binding domains by their specific
           high-affinity binding to PIPs with two vicinal phosphate
           groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
           which results in targeting some PH domain proteins to
           the plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 125

 Score = 27.7 bits (62), Expect = 3.5
 Identities = 22/100 (22%), Positives = 48/100 (48%), Gaps = 10/100 (10%)

Query: 205 ANDSGSQHSGWLHKKS-----GRNWKRYWF-VLKDQVMYKYKASEDIKALLSIPVLGYEL 258
            N S +Q +G+L  +S        W R +F      +M + +  +++   L + +    +
Sbjct: 22  PNRSLTQKAGYLFLRSKTGLVTNRWDRVYFFTQGGNLMSQPR--DEVAGSLVLDLDNTSV 79

Query: 259 EALNEQDNFKYVFQLKH-QGQDPLVFGADNEQSYERWMKA 297
           +A + +D  ++VFQ+    G+  +V  A++E+  E W+  
Sbjct: 80  QAADCEDR-RFVFQITSPDGKKAIVLQAESEKDREEWIAT 118


>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase;
           Reviewed.
          Length = 307

 Score = 28.9 bits (66), Expect = 3.6
 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 11/32 (34%)

Query: 170 MDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLI 201
           MDI        GTA   KP+ + R  VP  LI
Sbjct: 44  MDI--------GTA---KPTAEERAGVPHHLI 64


>gnl|CDD|241526 cd13375, PH_SynGAP, Synaptic Ras-GTPase activating protein
           Pleckstrin homology (PH) domain.  SynGAP is a member of
           the RasSynGAP family along with DOC-2/DAB2-interacting
           protein (DAB2IP) and neuronal growth-associated protein
           (nGAP/RASAL2). SynGAP, a neuronal Ras-GAP, has been
           shown display both Ras-GAP activity and Ras-related
           protein (Rap)-GAP activity. Saccharomyces cerevisiae
           Bud2 and GAP1 members CAPRI (Ca2+-promoted Ras
           inactivator) and RASAL (Ras-GTPase-activating-like
           protein) also possess this dual activity. Human
           DOC-2/DAB2-interacting protein (DAB2IP) is encoded by a
           tumor suppressor gene and a newly recognized member of
           the Ras-GTPase-activating family. Members here include
           mammals, amphibians, and bony fish. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 189

 Score = 28.5 bits (63), Expect = 3.6
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTAIKENEQH 51
           F V   S +     RSA ER +WI+ +Q A+K N+ +
Sbjct: 99  FEVTTSSGTKCFACRSAAERDKWIENLQRAVKPNKDN 135


>gnl|CDD|223848 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid
           metabolism].
          Length = 294

 Score = 28.8 bits (65), Expect = 3.8
 Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 3/48 (6%)

Query: 258 LEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS 305
           LEAL ++ +F+ +       +DPL F   + + Y+  ++A R+ T L 
Sbjct: 65  LEALLDEGSFEELDSPLEP-KDPLKFP--DSKKYKDRLEAARKKTGLD 109


>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific
           [General function prediction only].
          Length = 830

 Score = 29.0 bits (65), Expect = 4.1
 Identities = 17/95 (17%), Positives = 38/95 (40%), Gaps = 4/95 (4%)

Query: 83  RVSMCQRC--TSVFTVTFRRHHCRACGKVVCGPCSDYLAPLEYKKFRNFRVCEECYHYLV 140
              +C+ C     +TV    +  +  G+ +C  C++     E +   N     E    L+
Sbjct: 94  VARLCRHCLLEGRYTVLTEGNRIKYGGEEICERCAEEELKRELRFRGNSIGMLEQLERLL 153

Query: 141 QEFDDEDSNMFERVKAVANVEDNHQVTNMMDIIRS 175
            +F D D  + E +    +  ++ ++T   D + +
Sbjct: 154 HKFRDLD-KVLEMLDPRFDPLEDPELTR-YDEVTA 186


>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family
           Pleckstrin homology (PH) domain.  Gab proteins are
           scaffolding adaptor proteins, which possess N-terminal
           PH domains and a C-terminus with proline-rich regions
           and multiple phosphorylation sites. Following activation
           of growth factor receptors, Gab proteins are tyrosine
           phosphorylated and activate PI3K, which generates
           3-phosphoinositide lipids. By binding to these lipids
           via the PH domain, Gab proteins remain in proximity to
           the receptor, leading to further signaling. While not
           all Gab proteins depend on the PH domain for
           recruitment, it is required for Gab activity. There are
           3 families: Gab1, Gab2, and Gab3. PH domains have
           diverse functions, but in general are involved in
           targeting proteins to the appropriate cellular location
           or in the interaction with a binding partner. They share
           little sequence conservation, but all have a common
           fold, which is electrostatically polarized. Less than
           10% of PH domains bind phosphoinositide phosphates
           (PIPs) with high affinity and specificity. PH domains
           are distinguished from other PIP-binding domains by
           their specific high-affinity binding to PIPs with two
           vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
           or PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 103

 Score = 27.0 bits (60), Expect = 4.8
 Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 6/27 (22%)

Query: 212 HSGWL------HKKSGRNWKRYWFVLK 232
           + GWL       K     WK+ WFVL+
Sbjct: 1   YEGWLRKSPPEKKIKRAAWKKRWFVLR 27


>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH
           domain Pleckstrin homology (PH) domain.  ASAPs (ASAP1,
           ASAP2, and ASAP3) function as an Arf-specific GAPs,
           participates in rhodopsin trafficking, is associated
           with tumor cell metastasis, modulates phagocytosis,
           promotes cell proliferation, facilitates vesicle
           budding, Golgi exocytosis, and regulates vesicle coat
           assembly via a Bin/Amphiphysin/Rvs domain. ASAPs contain
           an NH2-terminal BAR domain, a tandem PH domain/GAP
           domain, three ankyrin repeats, two proline-rich regions,
           and a COOH-terminal Src homology 3 (SH3) domain. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 108

 Score = 27.3 bits (61), Expect = 4.8
 Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 17/101 (16%)

Query: 209 GSQHSGWLHKKS----GRNWKRYWFVLKDQVMYKYKASEDIKA----LLSIPVLGYELEA 260
           G++ SG+L KKS     + W++    +++  +    + E+       LL+  V       
Sbjct: 9   GTEKSGYLLKKSEGKLRKVWQKRRCSIRNGFLTISHSDENKPPVKLNLLTCQV------K 62

Query: 261 LNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 301
            N +D  K  F L    +    F A++EQ  E W+  ++ +
Sbjct: 63  PNPED--KKCFDLISHNR-TYHFQAEDEQEAEAWISVLQNS 100


>gnl|CDD|237190 PRK12755, PRK12755, phospho-2-dehydro-3-deoxyheptonate aldolase;
           Provisional.
          Length = 353

 Score = 28.3 bits (64), Expect = 5.4
 Identities = 11/17 (64%), Positives = 11/17 (64%), Gaps = 2/17 (11%)

Query: 109 VVCGPCS--DYLAPLEY 123
           VV GPCS  D  A LEY
Sbjct: 57  VVVGPCSIHDPEAALEY 73


>gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH
           domain-containing protein Pleckstrin homology (PH)
           domain.  AGAP (also called centaurin gamma;
           PIKE/Phosphatidylinositol-3-kinase enhancer) reside
           mainly in the nucleus and are known to activate
           phosphoinositide 3-kinase, a key regulator of cell
           proliferation, motility and vesicular trafficking. There
           are 3 isoforms of AGAP (PIKE-A, PIKE-L, and PIKE-S) the
           longest of which PIKE-L consists of N-terminal proline
           rich domains (PRDs), followed by a GTPase domain, a
           split PH domain (PHN and PHC), an ArfGAP domain and two
           ankyrin repeats. PIKE-S terminates after the PHN domain
           and PIKE-A is missing the PRD region. Centaurin binds
           phosphatidlyinositol (3,4,5)P3. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 114

 Score = 26.9 bits (60), Expect = 5.7
 Identities = 11/35 (31%), Positives = 20/35 (57%), Gaps = 1/35 (2%)

Query: 12  NNEFSVIAI-SRSFTLRARSANERLEWIDAIQTAI 45
             EF ++++  + +   A S+ ER EW+ AI+  I
Sbjct: 75  AFEFIIVSLDGKQWHFEAASSEERDEWVQAIEQQI 109


>gnl|CDD|215023 smart01098, CPSF73-100_C, This is the C-terminal conserved region
           of the pre-mRNA 3'-end-processing of the polyadenylation
           factor CPSF-73/CPSF-100 proteins.  The exact function of
           this domain is not known.
          Length = 212

 Score = 27.8 bits (62), Expect = 5.9
 Identities = 8/38 (21%), Positives = 12/38 (31%), Gaps = 1/38 (2%)

Query: 127 RNFRVCEECYHYLVQEFDDEDSNMFERVKAVANVEDNH 164
             FR        L ++F D   N+ E       V+   
Sbjct: 140 EEFREKL-IEILLKEQFGDGVVNVEEGEDLKVTVDGKT 176


>gnl|CDD|241259 cd01225, PH_Cool_Pix, Cloned out of library/PAK-interactive
          exchange factor pleckstrin homology (PH) domain.  There
          are two forms of Pix proteins: alpha Pix (also called
          Rho guanine nucleotide exchange factor (GEF)
          6/90Cool-2) and beta Pix (GEF7/p85Cool-1). betaPix
          contains  an N-terminal SH3 domain, a RhoGEF/DH domain,
          a PH domain, a GIT1 binding domain (GBD), and a
          C-terminal coiled-coil (CC) domain. alphaPix differs in
          that it contains a calponin homology (CH) domain, which
          interacts with beta-parvin, N-terminal to the SH3
          domain. alphaPix is an exchange factor for Rac1 and
          Cdc42 and mediates Pak activation on cell adhesion to
          fibronectin. Mutations in alphaPix can cause X-linked
          mental retardation. alphaPix also interacts with
          Huntington's disease protein (htt), and enhances the
          aggregation of mutant htt (muthtt) by facilitating
          SDS-soluble muthtt-muthtt interactions. The DH-PH
          domain of a Pix was required for its binding to htt. In
          the majority of Rho GEF proteins, the DH-PH domain is
          responsible for the exchange activity. PH domains have
          diverse functions, but in general are involved in
          targeting proteins to the appropriate cellular location
          or in the interaction with a binding partner. They
          share little sequence conservation, but all have a
          common fold, which is electrostatically polarized. Less
          than 10% of PH domains bind phosphoinositide phosphates
          (PIPs) with high affinity and specificity. PH domains
          are distinguished from other PIP-binding domains by
          their specific high-affinity binding to PIPs with two
          vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
          or PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 100

 Score = 26.9 bits (60), Expect = 6.2
 Identities = 17/51 (33%), Positives = 24/51 (47%), Gaps = 8/51 (15%)

Query: 1  MKV-CLPQTEDYNNEFSVIAISRSFTLR----ARSANERLEWIDAIQTAIK 46
          M+V  L  TE   + F    IS     R      S+N++ EWI+ +Q  IK
Sbjct: 52 MRVNRLEDTEGIKHAFE---ISGPMIERIVVICNSSNDQQEWIEHLQQQIK 99


>gnl|CDD|233040 TIGR00595, priA, primosomal protein N'.  All proteins in this
           family for which functions are known are components of
           the primosome which is involved in replication, repair,
           and recombination.This family is based on the
           phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis,
           Stanford University) [DNA metabolism, DNA replication,
           recombination, and repair].
          Length = 505

 Score = 28.1 bits (63), Expect = 6.6
 Identities = 23/101 (22%), Positives = 32/101 (31%), Gaps = 41/101 (40%)

Query: 38  IDAIQTAIKENEQHLLSFLNRRSLTQSSIPELNLGKVAPLWIPDSRVSMCQRCTSVFTVT 97
           I AI+  +   EQ +L FLNRR                                  ++  
Sbjct: 188 ITAIEQTLAAGEQSIL-FLNRRG---------------------------------YSKN 213

Query: 98  FRRHHCRACGKVVCGP-CSDYLAPLEYKKFRNFRVCEECYH 137
                CR+CG ++C P C      L Y K      C  C +
Sbjct: 214 LL---CRSCGYILCCPNCD---VSLTYHKKEGKLRCHYCGY 248


>gnl|CDD|241262 cd01228, PH_BCR-related, Breakpoint Cluster Region-related
           pleckstrin homology (PH) domain.  The BCR gene is one of
           the two genes in the BCR-ABL complex, which is
           associated with the Philadelphia chromosome, a product
           of a reciprocal translocation between chromosomes 22 and
           9. BCR is a GTPase-activating protein (GAP) for RAC1
           (primarily) and CDC42. The Dbl region of BCR has the
           most RhoGEF activity for Cdc42, and less activity
           towards Rac and Rho. Since BCR possesses both GAP and
           GEF activities, it may function to temporally regulate
           the activity of these GTPases. It also displays
           serine/threonine kinase activity. The BCR protein
           contains multiple domains including an N-terminal kinase
           domain, a RhoGEF domain, a PH domain, a C1 domain, a C2
           domain, and a C-terminal RhoGAP domain. ABR, a related
           smaller protein, is structurally similar to BCR, but
           lacks the N-terminal kinase domain and has GAP activity
           for both Rac and Cdc42. PH domains have diverse
           functions, but in general are involved in targeting
           proteins to the appropriate cellular location or in the
           interaction with a binding partner. They share little
           sequence conservation, but all have a common fold, which
           is electrostatically polarized. Less than 10% of PH
           domains bind phosphoinositide phosphates (PIPs) with
           high affinity and specificity. PH domains are
           distinguished from other PIP-binding domains by their
           specific high-affinity binding to PIPs with two vicinal
           phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
           PtdIns(3,4,5)P3 which results in targeting some PH
           domain proteins to the plasma membrane. A few display
           strong specificity in lipid binding. Any specificity is
           usually determined by loop regions or insertions in the
           N-terminus of the domain, which are not conserved across
           all PH domains. PH domains are found in cellular
           signaling proteins such as serine/threonine kinase,
           tyrosine kinases, regulators of G-proteins, endocytotic
           GTPases, adaptors, as well as cytoskeletal associated
           molecules and in lipid associated enzymes.
          Length = 179

 Score = 27.7 bits (62), Expect = 6.7
 Identities = 9/27 (33%), Positives = 14/27 (51%)

Query: 21  SRSFTLRARSANERLEWIDAIQTAIKE 47
            +++T    S  ER EW +AI    K+
Sbjct: 153 GKTYTFLLSSDYERSEWKEAILKLQKK 179


>gnl|CDD|215467 PLN02866, PLN02866, phospholipase D.
          Length = 1068

 Score = 28.2 bits (63), Expect = 7.6
 Identities = 11/30 (36%), Positives = 17/30 (56%)

Query: 15  FSVIAISRSFTLRARSANERLEWIDAIQTA 44
           F V   +RS  LR +S+ +  +W+ AI  A
Sbjct: 277 FKVTCGNRSIRLRTKSSAKVKDWVAAINDA 306


>gnl|CDD|227598 COG5273, COG5273, Uncharacterized protein containing DHHC-type Zn
           finger [General function prediction only].
          Length = 309

 Score = 27.8 bits (62), Expect = 7.6
 Identities = 8/31 (25%), Positives = 10/31 (32%), Gaps = 2/31 (6%)

Query: 80  PDSRVSMCQRCTSVFTVTFRRHHCRACGKVV 110
                + C  C        R HHC  C + V
Sbjct: 105 KFGTENFCSTCNIY--KPPRSHHCSICNRCV 133


>gnl|CDD|241446 cd13292, PH_Osh1p_Osh2p_yeast, Yeast oxysterol binding protein
           homologs 1 and 2 Pleckstrin homology (PH) domain.  Yeast
           Osh1p is proposed to function in postsynthetic sterol
           regulation, piecemeal microautophagy of the nucleus, and
           cell polarity establishment. Yeast Osh2p is proposed to
           function in sterol metabolism and cell polarity
           establishment. Both Osh1p and Osh2p contain 3 N-terminal
           ankyrin repeats, a PH domain, a FFAT motif (two
           phenylalanines in an acidic tract), and a C-terminal
           OSBP-related domain. OSBP andOsh1p PH domains
           specifically localize to the Golgi apparatus in a
           PtdIns4P-dependent manner. Oxysterol binding proteins
           are a multigene family that is conserved in yeast,
           flies, worms, mammals and plants. In general OSBPs and
           ORPs have been found to be involved in the transport and
           metabolism of cholesterol and related lipids in
           eukaryotes. They all contain a C-terminal oxysterol
           binding domain, and most contain an N-terminal PH
           domain. OSBP PH domains bind to membrane
           phosphoinositides and thus likely play an important role
           in intracellular targeting. They are members of the
           oxysterol binding protein (OSBP) family which includes
           OSBP, OSBP-related proteins (ORP), Goodpasture antigen
           binding protein (GPBP), and Four phosphate adaptor
           protein 1 (FAPP1). They have a wide range of purported
           functions including sterol transport, cell cycle
           control, pollen development and vessicle transport from
           Golgi recognize both PI lipids and ARF proteins. PH
           domains have diverse functions, but in general are
           involved in targeting proteins to the appropriate
           cellular location or in the interaction with a binding
           partner. They share little sequence conservation, but
           all have a common fold, which is electrostatically
           polarized. Less than 10% of PH domains bind
           phosphoinositide phosphates (PIPs) with high affinity
           and specificity. PH domains are distinguished from other
           PIP-binding domains by their specific high-affinity
           binding to PIPs with two vicinal phosphate groups:
           PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
           results in targeting some PH domain proteins to the
           plasma membrane. A few display strong specificity in
           lipid binding. Any specificity is usually determined by
           loop regions or insertions in the N-terminus of the
           domain, which are not conserved across all PH domains.
           PH domains are found in cellular signaling proteins such
           as serine/threonine kinase, tyrosine kinases, regulators
           of G-proteins, endocytotic GTPases, adaptors, as well as
           cytoskeletal associated molecules and in lipid
           associated enzymes.
          Length = 103

 Score = 26.5 bits (59), Expect = 7.9
 Identities = 13/38 (34%), Positives = 19/38 (50%), Gaps = 6/38 (15%)

Query: 211 QHSGWLHK----KSGRNWKRYWFVLKDQVMYKYKASED 244
              G+L K      G  +K  WFVL+D V+  Y+  +D
Sbjct: 3   TMKGYLKKWTNYAKG--YKTRWFVLEDGVLSYYRHQDD 38


>gnl|CDD|237842 PRK14868, PRK14868, DNA topoisomerase VI subunit B; Provisional.
          Length = 795

 Score = 27.8 bits (62), Expect = 8.2
 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 39  DAIQTAIKENEQHLLSFLN-RRSLTQSSIPELNLGKVAP 76
           D I+ AI+E  + L S+LN RRS+ +    +  LG + P
Sbjct: 636 DEIELAIREAARELKSYLNKRRSMQKRREKQDVLGTILP 674


>gnl|CDD|182710 PRK10765, PRK10765, nitroreductase A; Provisional.
          Length = 240

 Score = 27.6 bits (62), Expect = 8.3
 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 2/38 (5%)

Query: 27  RARSANERLE-WIDAIQ-TAIKENEQHLLSFLNRRSLT 62
             RS+N R + W D I+ T IKE+   +L +L+++   
Sbjct: 201 LTRSSNNRQDTWSDHIRRTLIKESRPFILDYLHKQGWA 238


>gnl|CDD|241280 cd01249, BAR-PH_GRAF_family, GTPase Regulator Associated with
          Focal adhesion and related proteins Pleckstrin homology
          (PH) domain.  This hierarchy contains GRAF family
          members: OPHN1/oligophrenin1, GRAF1 (also called
          ARHGAP26/Rho GTPase activating protein 26), GRAF2 (also
          called ARHGAP10/ARHGAP42), AK057372, and LOC129897, all
          of which are members of the APPL family. OPHN1 is a
          RhoGAP involved in X-linked mental retardation,
          epilepsy, rostral ventricular enlargement, and
          cerebellar hypoplasia. Affected individuals have
          morphological abnormalities of their brain with
          enlargement of the cerebral ventricles and cerebellar
          hypoplasia. OPHN1 negatively regulates RhoA, Cdc42, and
          Rac1 in neuronal and non-neuronal cells. GRAF1 sculpts
          the endocytic membranes of the CLIC/GEEC
          (clathrin-independent carriers/GPI-enriched early
          endosomal compartments) endocytic pathway. It strongly
          interacts with dynamin and inhibition of dynamin
          abolishes CLIC/GEEC endocytosis. GRAF2, GRAF3 and
          oligophrenin are likely to play similar roles during
          clathrin-independent endocytic events. GRAF1 mutations
          are linked to leukaemia. All members are composed of a
          N-terminal BAR-PH domain, followed by a RhoGAP domain,
          a proline rich region, and a C-terminal SH3 domain. PH
          domains have diverse functions, but in general are
          involved in targeting proteins to the appropriate
          cellular location or in the interaction with a binding
          partner. They share little sequence conservation, but
          all have a common fold, which is electrostatically
          polarized. Less than 10% of PH domains bind
          phosphoinositide phosphates (PIPs) with high affinity
          and specificity. PH domains are distinguished from
          other PIP-binding domains by their specific
          high-affinity binding to PIPs with two vicinal
          phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
          PtdIns(3,4,5)P3 which results in targeting some PH
          domain proteins to the plasma membrane. A few display
          strong specificity in lipid binding. Any specificity is
          usually determined by loop regions or insertions in the
          N-terminus of the domain, which are not conserved
          across all PH domains. PH domains are found in cellular
          signaling proteins such as serine/threonine kinase,
          tyrosine kinases, regulators of G-proteins, endocytotic
          GTPases, adaptors, as well as cytoskeletal associated
          molecules and in lipid associated enzymes.
          Length = 105

 Score = 26.1 bits (58), Expect = 9.5
 Identities = 9/30 (30%), Positives = 16/30 (53%), Gaps = 2/30 (6%)

Query: 15 FSVIAISRS--FTLRARSANERLEWIDAIQ 42
          F +  + R    TL+A S  +R  W++A+ 
Sbjct: 70 FDIEVVDRPTVLTLQALSEEDRKLWLEAMD 99


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.133    0.408 

Gapped
Lambda     K      H
   0.267   0.0679    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 15,261,995
Number of extensions: 1408769
Number of successful extensions: 1679
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1629
Number of HSP's successfully gapped: 166
Length of query: 305
Length of database: 10,937,602
Length adjustment: 97
Effective length of query: 208
Effective length of database: 6,635,264
Effective search space: 1380134912
Effective search space used: 1380134912
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (26.6 bits)