RPS-BLAST 2.2.26 [Sep-21-2011]
Database: CDD.v3.10
44,354 sequences; 10,937,602 total letters
Searching..................................................done
Query= psy2209
(156 letters)
>gnl|CDD|241391 cd13237, PH2_FGD5_FGD6, FYVE, RhoGEF and PH domain
containing/faciogenital dysplasia proteins 5 and 6
pleckstrin homology (PH) domain, C-terminus. FGD5
regulates promotes angiogenesis of vascular endothelial
growth factor (VEGF) in vascular endothelial cells,
including network formation, permeability, directional
movement, and proliferation. The specific function of
FGD6 is unknown. In general, FGDs have a RhoGEF (DH)
domain, followed by a PH domain, a FYVE domain and a
C-terminal PH domain. All FGDs are guanine nucleotide
exchange factors that activate the Rho GTPase Cdc42, an
important regulator of membrane trafficking. The RhoGEF
domain is responsible for GEF catalytic activity, while
the PH domain is involved in intracellular targeting of
the DH domain. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 90
Score = 103 bits (258), Expect = 1e-29
Identities = 44/89 (49%), Positives = 62/89 (69%), Gaps = 4/89 (4%)
Query: 64 SGWLH--KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF--K 119
SG+L+ K+ ++WKR WFVLKD+V+Y YKASED+ AL SIP+LGY + E
Sbjct: 2 SGYLYRRKRKKKSWKRLWFVLKDKVLYTYKASEDVVALESIPLLGYTVVPAKEGFEGDES 61
Query: 120 YVFQLKHQGQDPLVFGADNEQSYERWMKA 148
VFQL H+GQ P +F AD+ ++ +RW++A
Sbjct: 62 LVFQLLHKGQLPYIFRADDAETAQRWIEA 90
>gnl|CDD|241402 cd13248, PH_PEPP1_2_3, Phosphoinositol 3-phosphate binding proteins
1, 2, and 3 pleckstrin homology (PH) domain. PEPP1
(also called PLEKHA4/PH domain-containing family A
member 4 and RHOXF1/Rhox homeobox family member 1), and
related homologs PEPP2 (also called PLEKHA5/PH
domain-containing family A member 5) and PEPP3 (also
called PLEKHA6/PH domain-containing family A member 6),
have PH domains that interact specifically with
PtdIns(3,4)P3. Other proteins that bind PtdIns(3,4)P3
specifically are: TAPP1 (tandem PH-domain-containing
protein-1) and TAPP2], PtdIns3P AtPH1, and Ptd-
Ins(3,5)P2 (centaurin-beta2). All of these proteins
contain at least 5 of the 6 conserved amino acids that
make up the putative phosphatidylinositol 3,4,5-
trisphosphate-binding motif (PPBM) located at their
N-terminus. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 104
Score = 96.2 bits (240), Expect = 1e-26
Identities = 41/94 (43%), Positives = 56/94 (59%), Gaps = 5/94 (5%)
Query: 64 SGWLHKKSG---RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQD--NF 118
SGWLHK+ G +NWK+ WFVLKD +Y YK E+ KAL SI + Y + + D N
Sbjct: 10 SGWLHKQGGSGLKNWKKRWFVLKDNCLYYYKDPEEEKALGSILLPSYTISPASPSDEINR 69
Query: 119 KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
K+ F+ +H G F AD ++ E+WMKA+ A
Sbjct: 70 KFAFKAEHAGMRTYYFAADTQEEMEQWMKALSLA 103
>gnl|CDD|215766 pfam00169, PH, PH domain. PH stands for pleckstrin homology.
Length = 101
Score = 71.0 bits (174), Expect = 6e-17
Identities = 27/98 (27%), Positives = 52/98 (53%), Gaps = 7/98 (7%)
Query: 63 HSGWLHKKSG---RNWKRYWFVLKDQVM--YKYKASEDIKALLSIPVLGYELEALNEQDN 117
GWL KK ++WK+ +FVL D V+ YK + SIP+ G ++ + + ++
Sbjct: 3 KEGWLLKKGSGGRKSWKKRYFVLFDGVLLYYKDSKKSSSRPKGSIPLSGCQVTKVPDSED 62
Query: 118 FK--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
K F+++ ++ + A++E+ + W+KA+R A
Sbjct: 63 GKRKNCFEIRTGDRETFLLQAESEEERKEWVKAIRSAI 100
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain. Domain commonly found
in eukaryotic signalling proteins. The domain family
possesses multiple functions including the abilities to
bind inositol phosphates, and various proteins. PH
domains have been found to possess inserted domains
(such as in PLC gamma, syntrophins) and to be inserted
within other domains. Mutations in Brutons tyrosine
kinase (Btk) within its PH domain cause X-linked
agammaglobulinaemia (XLA) in patients. Point mutations
cluster into the positively charged end of the molecule
around the predicted binding site for
phosphatidylinositol lipids.
Length = 102
Score = 69.1 bits (169), Expect = 4e-16
Identities = 29/99 (29%), Positives = 54/99 (54%), Gaps = 8/99 (8%)
Query: 63 HSGWLHKKSG---RNWKRYWFVLKDQVMYKYK---ASEDIKALLSIPVLGYELEALNEQD 116
GWL+KKSG ++WK+ +FVL + + YK + K SI + G + + D
Sbjct: 3 KEGWLYKKSGGGKKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSIDLSGCTVREAPDPD 62
Query: 117 NF--KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
+ + F++K + L+ A++E+ E+W++A+R+A
Sbjct: 63 SSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEALRKAI 101
>gnl|CDD|241291 cd01260, PH_CNK_mammalian-like, Connector enhancer of KSR (Kinase
suppressor of ras) (CNK) pleckstrin homology (PH)
domain. CNK family members function as protein
scaffolds, regulating the activity and the subcellular
localization of RAS activated RAF. There is a single CNK
protein present in Drosophila and Caenorhabditis elegans
in contrast to mammals which have 3 CNK proteins (CNK1,
CNK2, and CNK3). All of the CNK members contain a
sterile a motif (SAM), a conserved region in CNK (CRIC)
domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and, with
the exception of CNK3, a PH domain. A CNK2 splice
variant CNK2A also has a PDZ domain-binding motif at its
C terminus and Drosophila CNK (D-CNK) also has a domain
known as the Raf-interacting region (RIR) that mediates
binding of the Drosophila Raf kinase. This cd contains
CNKs from mammals, chickens, amphibians, fish, and
crustacea. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 114
Score = 68.9 bits (169), Expect = 5e-16
Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 7/97 (7%)
Query: 65 GWLHKKS------GRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 118
GWL KK G+ WKRYWFVLK +Y Y +D KA I + +++E +E
Sbjct: 17 GWLWKKKEAKGFFGQKWKRYWFVLKGSSLYWYNNPQDEKAEGFINLPDFKIERASECKK- 75
Query: 119 KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTL 155
KY F+ H F A+N +W+ + A
Sbjct: 76 KYAFKASHPKIKTFYFAAENLDDMNKWLSKLITAINK 112
>gnl|CDD|241390 cd13236, PH2_FGD1-4, FYVE, RhoGEF and PH domain
containing/faciogenital dysplasia proteins pleckstrin
homology (PH) domain, C-terminus. In general, FGDs have
a RhoGEF (DH) domain, followed by an N-terminal PH
domain, a FYVE domain and a C-terminal PH domain. All
FGDs are guanine nucleotide exchange factors that
activates the Rho GTPase Cdc42, an important regulator
of membrane trafficking. The RhoGEF domain is
responsible for GEF catalytic activity, while the
N-terminal PH domain is involved in intracellular
targeting of the DH domain. Not much is known about
FGD2. FGD1 is the best characterized member of the
group with mutations here leading to the X-linked
disorder known as faciogenital dysplasia (FGDY). Both
FGD1 and FGD3 are targeted by the ubiquitin ligase
SCF(FWD1/beta-TrCP) upon phosphorylation of two serine
residues in its DSGIDS motif and subsequently degraded
by the proteasome. However, FGD1 and FGD3 induced
significantly different morphological changes in HeLa
Tet-Off cells and while FGD1 induced long finger-like
protrusions, FGD3 induced broad sheet-like protrusions
when the level of GTP-bound Cdc42 was significantly
increased by the inducible expression of FGD3. They also
reciprocally regulated cell motility in inducibly
expressed in HeLa Tet-Off cells, FGD1 stimulated cell
migration while FGD3 inhibited it. FGD1 and FGD3
therefore play different roles to regulate cellular
functions, even though their intracellular levels are
tightly controlled by the same destruction pathway
through SCF(FWD1/beta-TrCP). FGD4 is one of the genes
associated with Charcot-Marie-Tooth neuropathy type 4
(CMT4), a group of progressive motor and sensory axonal
and demyelinating neuropathies that are distinguished
from other forms of CMT by autosomal recessive
inheritance. Those affected have distal muscle weakness
and atrophy associated with sensory loss and,
frequently, pes cavus foot deformity. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 105
Score = 68.1 bits (167), Expect = 9e-16
Identities = 29/105 (27%), Positives = 56/105 (53%), Gaps = 10/105 (9%)
Query: 57 NDSGSQHS---GWLH-KKSGRNWKRYWFVLKD---QVMYKYKASEDIKALLSIPVLGYEL 109
++S +L + G+ W++ W V+ V+Y Y A +D++A +IP+ GYE+
Sbjct: 1 ASLVPENSLLCSFLQYSEKGKTWQKVWCVIPRTEPLVLYLYGAPQDVRAPRTIPLPGYEV 60
Query: 110 EALNEQDNF--KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
++ K+VF+L Q + F A++E+ +RW++A+ A
Sbjct: 61 SVPPPEERLDGKHVFKL-SQSKQSHYFSAESEELQQRWLEALSRA 104
>gnl|CDD|241417 cd13263, PH_RhoGap25-like, Rho GTPase activating protein 25 and
related proteins Pleckstrin homology (PH) domain.
RhoGAP25 (also called ArhGap25) like other RhoGaps are
involved in cell polarity, cell morphology and
cytoskeletal organization. They act as GTPase activators
for the Rac-type GTPases by converting them to an
inactive GDP-bound state and control actin remodeling by
inactivating Rac downstream of Rho leading to suppress
leading edge protrusion and promotes cell retraction to
achieve cellular polarity and are able to suppress RAC1
and CDC42 activity in vitro. Overexpression of these
proteins induces cell rounding with partial or complete
disruption of actin stress fibers and formation of
membrane ruffles, lamellipodia, and filopodia. This
hierarchy contains RhoGAP22, RhoGAP24, and RhoGAP25.
Members here contain an N-terminal PH domain followed by
a RhoGAP domain and either a BAR or TATA Binding Protein
(TBP) Associated Factor 4 (TAF4) domain. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 114
Score = 63.5 bits (155), Expect = 7e-14
Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 12/102 (11%)
Query: 63 HSGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEAL--NEQDNF 118
SGWL K+ G +NW+R WFVL+ +Y YK ++ K IP+ G ++ L N ++
Sbjct: 5 KSGWLKKQGGIVKNWQRRWFVLRGDQLYYYKDEDESKPQGCIPLPGNTVKELPFNPEEPG 64
Query: 119 KYVFQLK--------HQGQDPLVFGADNEQSYERWMKAMREA 152
K++F++ D + A+++ E W+K +R
Sbjct: 65 KFLFEIIPGDGGTRRSANHDSYLLMANSQAEMEEWVKVIRRV 106
>gnl|CDD|241389 cd13235, PH2_FARP1-like, FERM, RhoGEF and pleckstrin
domain-containing protein 1 and related proteins
Pleckstrin Homology (PH) domain, repeat 2. Members here
include FARP1 (also called Chondrocyte-derived
ezrin-like protein; PH domain-containing family C member
2), FARP2 (also called FIR/FERM domain including RhoGEF;
FGD1-related Cdc42-GEF/FRG), and FARP6 (also called Zinc
finger FYVE domain-containing protein 24). They are
members of the Dbl family guanine nucleotide exchange
factors (GEFs) which are upstream positive regulators of
Rho GTPases. Little is known about FARP1 and FARP6,
though FARP1 has increased expression in differentiated
chondrocytes. FARP2 is thought to regulate neurite
remodeling by mediating the signaling pathways from
membrane proteins to Rac. It is found in brain, lung,
and testis, as well as embryonic hippocampal and
cortical neurons. FARP1 and FARP2 are composed of a
N-terminal FERM domain, a proline-rich (PR) domain,
Dbl-homology (DH), and two C-terminal PH domains. FARP6
is composed of Dbl-homology (DH), and two C-terminal PH
domains separated by a FYVE domain. This hierarchy
contains the second PH repeat. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 113
Score = 58.9 bits (143), Expect = 4e-12
Identities = 34/97 (35%), Positives = 57/97 (58%), Gaps = 5/97 (5%)
Query: 61 SQHSGWLHKK--SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 118
+Q SG+L +K + W++ W V + ++ YK+ +D L S+P+LGY + +E DN
Sbjct: 18 NQMSGYLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDEFPLASLPLLGYSVGLPSEADNI 77
Query: 119 K--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
YVF+L+ F A++E ++ERWM+ +R AT
Sbjct: 78 DKDYVFKLQF-KSHVYFFRAESEYTFERWMEVIRSAT 113
>gnl|CDD|241470 cd13316, PH_Boi, Boi family Pleckstrin homology domain. Yeast Boi
proteins Boi1 and Boi2 are functionally redundant and
important for cell growth with Boi mutants displaying
defects in bud formation and in the maintenance of cell
polarity.They appear to be linked to Rho-type GTPase,
Cdc42 and Rho3. Boi1 and Boi2 display two-hybrid
interactions with the GTP-bound ("active") form of
Cdc42, while Rho3 can suppress of the lethality caused
by deletion of Boi1 and Boi2. These findings suggest
that Boi1 and Boi2 are targets of Cdc42 that promote
cell growth in a manner that is regulated by Rho3. Boi
proteins contain a N-terminal SH3 domain, followed by a
SAM (sterile alpha motif) domain, a proline-rich region,
which mediates binding to the second SH3 domain of Bem1,
and C-terminal PH domain. The PH domain is essential for
its function in cell growth and is important for
localization to the bud, while the SH3 domain is needed
for localization to the neck. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 95
Score = 57.0 bits (138), Expect = 2e-11
Identities = 29/95 (30%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
Query: 63 HSGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF-K 119
HSGW+ K+ R WK +FVLK +Y K+ D K I + G+ + + +
Sbjct: 1 HSGWMKKRGERYGTWKTRYFVLKGTRLYYLKSENDSKEKGLIDLTGHRVTVDDSNSKPGR 60
Query: 120 YVFQLKH-QGQDPLVFGADNEQSYERWMKAMREAT 153
Y F+L + F D ++ WMKA+ +AT
Sbjct: 61 YGFKLVPPAVEKVHYFAVDEKEVLREWMKALMKAT 95
>gnl|CDD|241231 cd00821, PH, Pleckstrin homology (PH) domain. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 92
Score = 55.4 bits (133), Expect = 5e-11
Identities = 27/92 (29%), Positives = 42/92 (45%), Gaps = 6/92 (6%)
Query: 63 HSGWLHKKSG---RNWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGYELEALNEQDN 117
GWL K+ G ++WK+ WFVL D V+ YK+ +D K IP+ L
Sbjct: 1 KEGWLKKRGGKGLKSWKKRWFVLFDDVLLYYKSKKDSSKKPKGLIPLSDGLEVELVSSSG 60
Query: 118 FKYVFQLKHQGQD-PLVFGADNEQSYERWMKA 148
F+L + A++E+ E W++A
Sbjct: 61 KPNCFELVTPDRGRTYYLQAESEEEREEWLEA 92
>gnl|CDD|241435 cd13281, PH_PLEKHD1, Pleckstrin homology (PH) domain containing,
family D (with coiled-coil domains) member 1 PH domain.
Human PLEKHD1 (also called UPF0639, pleckstrin homology
domain containing, family D (with M protein repeats)
member 1) is a single transcript and contains a single
PH domain. PLEKHD1 is conserved in human, chimpanzee, ,
dog, cow, mouse, chicken, zebrafish, and Caenorhabditis
elegans. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 139
Score = 53.1 bits (128), Expect = 1e-09
Identities = 31/107 (28%), Positives = 48/107 (44%), Gaps = 16/107 (14%)
Query: 62 QHSGWLHKK----SGRNWKRYWFVLKDQVMYKYKASE----------DIKALLSIPVLGY 107
Q SG L K+ W + +FVLK+ + Y SE +I IP+ G
Sbjct: 13 QLSGVLWKRPFGRQSAKWSKRFFVLKECFLLYYAESEKKDFEKTRRFNIHPKGVIPLGGC 72
Query: 108 ELEALNEQDNFKYVFQLKHQG-QDPLVFGADNEQSYERWMKAMREAT 153
+EA + Y F + H + ++ AD+E+ E W+ +REAT
Sbjct: 73 SIEAGRDPGR-PYCFLISHPDFKGSIILAADSEEEQESWLDMLREAT 118
>gnl|CDD|241442 cd13288, PH_Ses, Sesquipedalian family Pleckstrin homology (PH)
domain. The sesquipedalian family has 2 mammalian
members: Ses1 and Ses2, which are also callled 7 kDa
inositol polyphosphate phosphatase-interacting protein 1
and 2. They play a role in endocytic trafficking and are
required for receptor recycling from endosomes, both to
the trans-Golgi network and the plasma membrane. Members
of this family form homodimers and heterodimers.
Sesquipedalian interacts with inositol polyphosphate
5-phosphatase OCRL-1 (INPP5F) also known as Lowe
oculocerebrorenal syndrome protein, a phosphatase enzyme
that is involved in actin polymerization and is found in
the trans-Golgi network and INPP5B. Sesquipedalian
contains a single PH domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 120
Score = 50.3 bits (121), Expect = 8e-09
Identities = 29/104 (27%), Positives = 54/104 (51%), Gaps = 8/104 (7%)
Query: 55 TANDSGSQHSGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDIKALLSIPVL-GYELEA 111
+ +S G+L KK RN +++ WFVLK +++ ++ D + L + VL G +E
Sbjct: 2 ASCNSPVDKEGYLWKKGERNTSYQKRWFVLKGNLLFYFEKKGD-REPLGVIVLEGCTVEL 60
Query: 112 LNEQDNFKYVFQLKHQGQDP--LVFGADNEQSYERWMKAMREAT 153
+++ Y F ++ G V A++++ E WMKA+ A+
Sbjct: 61 SEDEEP--YAFAIRFDGPGSRSYVLAAESQEDMESWMKALSRAS 102
>gnl|CDD|241480 cd13326, PH_CNK_insect-like, Connector enhancer of KSR (Kinase
suppressor of ras) (CNK) pleckstrin homology (PH)
domain. CNK family members function as protein
scaffolds, regulating the activity and the subcellular
localization of RAS activated RAF. There is a single CNK
protein present in Drosophila and Caenorhabditis elegans
in contrast to mammals which have 3 CNK proteins (CNK1,
CNK2, and CNK3). All of the CNK members contain a
sterile a motif (SAM), a conserved region in CNK (CRIC)
domain, and a PSD-95/DLG-1/ZO-1 (PDZ) domain, and a PH
domain. A CNK2 splice variant CNK2A also has a PDZ
domain-binding motif at its C terminus and Drosophila
CNK (D-CNK) also has a domain known as the
Raf-interacting region (RIR) that mediates binding of
the Drosophila Raf kinase. This cd contains CNKs from
insects, spiders, mollusks, and nematodes. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 90
Score = 49.3 bits (118), Expect = 1e-08
Identities = 25/87 (28%), Positives = 46/87 (52%), Gaps = 6/87 (6%)
Query: 65 GWLHKKS-----GRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK 119
GWL+++ G W + WFVLK +Y +++ E KA I + G+ + E + K
Sbjct: 3 GWLYQRRRKGKGGGKWAKRWFVLKGSNLYGFRSQESTKADCVIFLPGFTVSPAPEVKSRK 62
Query: 120 YVFQLKHQGQDPLVFGADNEQSYERWM 146
Y F++ H G F A++++ ++W+
Sbjct: 63 YAFKVYHTGT-VFYFAAESQEDMKKWL 88
>gnl|CDD|241430 cd13276, PH_AtPH1, Arabidopsis thaliana Pleckstrin homolog (PH) 1
(AtPH1) PH domain. AtPH1 is expressed in all plant
tissue and is proposed to be the plant homolog of human
pleckstrin. Pleckstrin consists of two PH domains
separated by a linker region, while AtPH has a single PH
domain with a short N-terminal extension. AtPH1 binds
PtdIns3P specifically and is thought to be an adaptor
molecule since it has no obvious catalytic functions. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 117
Score = 48.1 bits (115), Expect = 6e-08
Identities = 25/94 (26%), Positives = 42/94 (44%), Gaps = 5/94 (5%)
Query: 59 SGSQHSGWLHKKSG--RNWKRYWFVLKDQVMYKYKAS-EDIKALLSIPVLGYELEALNEQ 115
S + +GWL K+ G + W+R WFVLK ++ +K D + I L L + +
Sbjct: 5 SDPEKAGWLTKQGGSIKTWRRRWFVLKQGKLFYFKDEDPDSEPRGVID-LSDCLTVKSAE 63
Query: 116 DNFKYVFQLK-HQGQDPLVFGADNEQSYERWMKA 148
+ F + + AD+E+ E W+ A
Sbjct: 64 EATNKEFAFEVSTPERTFYLIADSEKEKEEWISA 97
>gnl|CDD|241453 cd13299, PH2_PH_fungal, Fungal proteins Pleckstrin homology (PH)
domain, repeat 2. The functions of these fungal
proteins are unknown, but they all contain 2 PH domains.
This cd represents the second PH repeat. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 102
Score = 46.9 bits (112), Expect = 1e-07
Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 7/89 (7%)
Query: 66 WLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQD----NFKYV 121
L KK WK+YW VL+++ + YK + + IP+ ++ + E D + K+
Sbjct: 14 VLKKKGVNQWKKYWLVLRNRSLSFYKDQSEYSPVKIIPI--DDIIDVVELDPLSKSKKWC 71
Query: 122 FQLKHQGQDPLVFGADNEQSYERWMKAMR 150
Q+ + + F AD+E+S +W+ A++
Sbjct: 72 LQIITPEK-RIRFCADDEESLIKWLGALK 99
>gnl|CDD|241369 cd13215, PH-GRAM1_AGT26, Autophagy-related protein 26/Sterol
3-beta-glucosyltransferase Pleckstrin homology (PH)
domain, repeat 1. ATG26 (also called
UGT51/UDP-glycosyltransferase 51), a member of the
glycosyltransferase 28 family, resulting in the
biosynthesis of sterol glucoside. ATG26 in decane
metabolism and autophagy. There are 32 known
autophagy-related (ATG) proteins, 17 are components of
the core autophagic machinery essential for all
autophagy-related pathways and 15 are the additional
components required only for certain pathways or
species. The core autophagic machinery includes 1) the
ATG9 cycling system (ATG1, ATG2, ATG9, ATG13, ATG18,
and ATG27), 2) the phosphatidylinositol 3-kinase
complex (ATG6/VPS30, ATG14, VPS15, and ATG34), and 3)
the ubiquitin-like protein system (ATG3, ATG4, ATG5,
ATG7, ATG8, ATG10, ATG12, and ATG16). Less is known
about how the core machinery is adapted or modulated
with additional components to accommodate the
nonselective sequestration of bulk cytosol
(autophagosome formation) or selective sequestration of
specific cargos (Cvt vesicle, pexophagosome, or
bacteria-containing autophagosome formation). The
pexophagosome-specific additions include the
ATG30-ATG11-ATG17 receptor-adaptors complex, the
coiled-coil protein ATG25, and the sterol
glucosyltransferase ATG26. ATG26 is necessary for the
degradation of medium peroxisomes. It contains 2 GRAM
domains and a single PH domain. PH domains are only
found in eukaryotes. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. PH domains also have
diverse functions. They are often involved in targeting
proteins to the plasma membrane, but few display strong
specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 130
Score = 46.8 bits (112), Expect = 2e-07
Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 2/35 (5%)
Query: 64 SGWLHKKSGRN--WKRYWFVLKDQVMYKYKASEDI 96
SG+L K+ R + RYWFVLK V+ Y++S D+
Sbjct: 32 SGYLSKRGKRTPRYNRYWFVLKGDVLSWYRSSTDL 66
>gnl|CDD|241450 cd13296, PH2_MyoX, Myosin X Pleckstrin homology (PH) domain, repeat
2. MyoX, a MyTH-FERM myosin, is a molecular motor that
has crucial functions in the transport and/or tethering
of integrins in the actin-based extensions known as
filopodia, microtubule binding, and in netrin-mediated
axon guidance. It functions as a dimer. MyoX walks on
bundles of actin, rather than single filaments, unlike
the other unconventional myosins. MyoX is present in
organisms ranging from humans to choanoflagellates, but
not in Drosophila and Caenorhabditis elegans.MyoX
consists of a N-terminal motor/head region, a neck made
of 3 IQ motifs, and a tail consisting of a coiled-coil
domain, a PEST region, 3 PH domains, a myosin tail
homology 4 (MyTH4), and a FERM domain at its very
C-terminus. The first PH domain in the MyoX tail is a
split-PH domain, interupted by the second PH domain such
that PH 1a and PH 1b flanks PH 2. The third PH domain
(PH 3) follows the PH 1b domain. This cd contains the
second PH repeat. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 111
Score = 46.2 bits (110), Expect = 3e-07
Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 8/49 (16%)
Query: 64 SGWLHKKSG-------RNWKRYWFVLKDQV-MYKYKASEDIKALLSIPV 104
SGWL+KK G +NWK WFVL+D V Y E KAL +I +
Sbjct: 10 SGWLYKKGGGSSTLSRKNWKSRWFVLRDTVLKYYENDQEGAKALGTIDI 58
>gnl|CDD|241462 cd13308, PH_3BP2, SH3 domain-binding protein 2 Pleckstrin homology
(PH) domain. SH3BP2 (the gene that encodes the adaptor
protein 3BP2), HD, ITU, IT10C3, and ADD1 are located
near the Huntington's Disease Gene on Human Chromosome
4pl6.3. SH3BP2 lies in a region that is often missing in
individuals with Wolf-Hirschhorn syndrome (WHS). Gain of
function mutations in SH3BP2 causes enhanced B-cell
antigen receptor (BCR)-mediated activation of nuclear
factor of activated T cells (NFAT), resulting in a rare,
genetic disorder called cherubism. This results in an
increase in the signaling complex formation with Syk,
phospholipase C-gamma2 (PLC-gamma2), and Vav1. It was
recently discovered that Tankyrase regulates 3BP2
stability through ADP-ribosylation and ubiquitylation by
the E3-ubiquitin ligase. Cherubism mutations uncouple
3BP2 from Tankyrase-mediated protein destruction, which
results in its stabilization and subsequent
hyperactivation of the Src, Syk, and Vav signaling
pathways. SH3BP2 is also a potential negative regulator
of the abl oncogene. PH domains have diverse functions,
but in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 113
Score = 44.7 bits (106), Expect = 9e-07
Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 8/98 (8%)
Query: 63 HSGWLHKKSGR-----NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQ-D 116
HSG+L KK G W + ++ +Y +K S+ K + GY A E
Sbjct: 11 HSGYLTKKGGSQKQLLKWPLRYVIIHKGCVYYFKNSQSAKPKGVFSLNGYNRRAAEETTS 70
Query: 117 NFKYVFQLKHQGQD--PLVFGADNEQSYERWMKAMREA 152
K+VF++ H +D F A +E + WM+++R+
Sbjct: 71 KKKFVFKIIHLSKDHRTWYFSAKSEDEMKEWMESLRKE 108
>gnl|CDD|241530 cd13379, PH_RhoGap24, Rho GTPase activating protein 24 Pleckstrin
homology (PH) domain. RhoGap24 (also called ARHGAP24,
p73RhoGAp, and Filamin-A-associated RhoGAP) like other
RhoGAPs are involved in cell polarity, cell morphology
and cytoskeletal organization. They act as GTPase
activators for the Rac-type GTPases by converting them
to an inactive GDP-bound state and control actin
remodeling by inactivating Rac downstream of Rho leading
to suppress leading edge protrusion and promotes cell
retraction to achieve cellular polarity and are able to
suppress RAC1 and CDC42 activity in vitro.
Overexpression of these proteins induces cell rounding
with partial or complete disruption of actin stress
fibers and formation of membrane ruffles, lamellipodia,
and filopodia. Members here contain an N-terminal PH
domain followed by a RhoGAP domain and either a BAR or
TATA Binding Protein (TBP) Associated Factor 4 (TAF4)
domain. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 114
Score = 44.2 bits (104), Expect = 2e-06
Identities = 27/98 (27%), Positives = 48/98 (48%), Gaps = 12/98 (12%)
Query: 65 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYEL--EALNEQDNFKY 120
GWL K+ G + W WFVLK +Y +K ++ K L +I + G + NE++ K+
Sbjct: 7 GWLRKQGGFVKTWHTRWFVLKGDQLYYFKDEDETKPLGTIFLPGNRVTEHPCNEEEPGKF 66
Query: 121 VFQLKHQG--------QDPLVFGADNEQSYERWMKAMR 150
+F++ G + + A + E W+K++R
Sbjct: 67 LFEVVPGGDRERMTANHETYLLMASTQNDMEDWVKSIR 104
>gnl|CDD|241452 cd13298, PH1_PH_fungal, Fungal proteins Pleckstrin homology (PH)
domain, repeat 1. The functions of these fungal
proteins are unknown, but they all contain 2 PH domains.
This cd represents the first PH repeat. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 43.4 bits (103), Expect = 3e-06
Identities = 28/104 (26%), Positives = 44/104 (42%), Gaps = 25/104 (24%)
Query: 63 HSGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKY 120
SGWL K+S + WK+ WFVL+ + YK ++ K I + EL A+ + K
Sbjct: 8 KSGWLLKRSRKTKTWKKRWFVLRPCQLSYYKDEKEYKLRRVINL--SELTAVAPLKDKKR 65
Query: 121 VFQLKHQGQDPLVFG-----------ADNEQSYERWMKAMREAT 153
VF A +E+ W++A+RE +
Sbjct: 66 KN----------VFAIYTPSKNYHFQASSEKDANEWVEAIREES 99
>gnl|CDD|241290 cd01259, PH_APBB1IP, Amyloid beta (A4) Precursor protein-Binding,
family B, member 1 Interacting Protein pleckstrin
homology (PH) domain. APBB1IP consists of a
Ras-associated (RA) domain, a PH domain, a
family-specific BPS region, and a C-terminal SH2 domain.
Grb7, Grb10 and Grb14 are paralogs that are also present
in this hierarchy. These adapter proteins bind a variety
of receptor tyrosine kinases, including the insulin and
insulin-like growth factor-1 (IGF1) receptors. Grb10 and
Grb14 are important tissue-specific negative regulators
of insulin and IGF1 signaling based and may contribute
to type 2 (non-insulin-dependent) diabetes in humans.
RA-PH function as a single structural unit and is
dimerized via a helical extension of the PH domain. The
PH domain here are proposed to bind phosphoinositides
non-cannonically ahd are unlikely to bind an activated
GTPase. The tandem RA-PH domains are present in a second
adapter-protein family, MRL proteins, Caenorhabditis
elegans protein MIG-1012, the mammalian proteins RIAM
and lamellipodin and the Drosophila melanogaster protein
Pico12, all of which are Ena/VASP-binding proteins
involved in actin-cytoskeleton rearrangement. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 124
Score = 43.4 bits (103), Expect = 4e-06
Identities = 29/107 (27%), Positives = 48/107 (44%), Gaps = 20/107 (18%)
Query: 62 QHSGWLH-KKSGRN-WKRYWFVLKDQVMY-----KYKASEDIKALLSIPVLGYEL-EALN 113
+ G+L+ K+ G+ WK+ +FVL+ +Y K K S D++ L Y + LN
Sbjct: 7 EIEGFLYLKEDGKKSWKKRYFVLRASGLYYSPKGKSKESRDLQCLAQFD--DYNVYTGLN 64
Query: 114 EQDNFK----YVFQLKHQGQDPL------VFGADNEQSYERWMKAMR 150
+ +K + F LK A++EQS W+ A+R
Sbjct: 65 GKKKYKAPTDFGFCLKPNKVQEKGSKDIKYLCAEDEQSRTCWLTAIR 111
>gnl|CDD|241283 cd01252, PH_GRP1-like, General Receptor for
Phosphoinositides-1-like Pleckstrin homology (PH)
domain. GRP1/cytohesin3 and the related proteins ARNO
(ARF nucleotide-binding site opener)/cytohesin-2 and
cytohesin-1 are ARF exchange factors that contain a
pleckstrin homology (PH) domain thought to target these
proteins to cell membranes through binding
polyphosphoinositides. The PH domains of all three
proteins exhibit relatively high affinity for
PtdIns(3,4,5)P3. Within the Grp1 family, diglycine (2G)
and triglycine (3G) splice variants, differing only in
the number of glycine residues in the PH domain,
strongly influence the affinity and specificity for
phosphoinositides. The 2G variants selectively bind
PtdIns(3,4,5)P3 with high affinity,the 3G variants bind
PtdIns(3,4,5)P3 with about 30-fold lower affinity and
require the polybasic region for plasma membrane
targeting. These ARF-GEFs share a common, tripartite
structure consisting of an N-terminal coiled-coil
domain, a central domain with homology to the yeast
protein Sec7, a PH domain, and a C-terminal polybasic
region. The Sec7 domain is autoinhibited by conserved
elements proximal to the PH domain. GRP1 binds to the
DNA binding domain of certain nuclear receptors
(TRalpha, TRbeta, AR, ER, but not RXR), and can repress
thyroid hormone receptor (TR)-mediated transactivation
by decreasing TR-complex formation on thyroid hormone
response elements. ARNO promotes sequential activation
of Arf6, Cdc42 and Rac1 and insulin secretion. Cytohesin
acts as a PI 3-kinase effector mediating biological
responses including cell spreading and adhesion,
chemotaxis, protein trafficking, and cytoskeletal
rearrangements, only some of which appear to depend on
their ability to activate ARFs. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 118
Score = 42.7 bits (101), Expect = 7e-06
Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 7/53 (13%)
Query: 63 HSGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALN 113
GWL K GR +WKR WF+L D +Y ++ + D + IP LE L+
Sbjct: 5 REGWLLKLGGRVKSWKRRWFILTDNCLYYFEYTTDKEPRGIIP-----LENLS 52
>gnl|CDD|241529 cd13378, PH_RhoGAP2, Rho GTPase activating protein 2 Pleckstrin
homology (PH) domain. RhoGAP2 (also called RhoGap22 or
ArhGap22) are involved in cell polarity, cell morphology
and cytoskeletal organization. They activate a GTPase
belonging to the RAS superfamily of small GTP-binding
proteins. The encoded protein is insulin-responsive, is
dependent on the kinase Akt, and requires the
Akt-dependent 14-3-3 binding protein which binds
sequentially to two serine residues resulting in
regulation of cell motility. Members here contain an
N-terminal PH domain followed by a RhoGAP domain and
either a BAR or TATA Binding Protein (TBP) Associated
Factor 4 (TAF4) domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 116
Score = 42.2 bits (99), Expect = 8e-06
Identities = 27/101 (26%), Positives = 52/101 (51%), Gaps = 14/101 (13%)
Query: 64 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEAL--NEQDNFK 119
+GWL K+ +NW++ WFVL+ ++ YK E+ K I + G ++ L N ++ K
Sbjct: 6 AGWLKKQRSIMKNWQQRWFVLRGDQLFYYKDEEETKPQGCISLQGSQVNELPPNPEEPGK 65
Query: 120 YVFQLKHQGQ----------DPLVFGADNEQSYERWMKAMR 150
++F++ G + + A+++ E W+KA+R
Sbjct: 66 HLFEILPGGAGDREKVPMNHEAFLLMANSQSDMEDWVKAIR 106
>gnl|CDD|241296 cd01265, PH_TBC1D2A, TBC1 domain family member 2A pleckstrin
homology (PH) domain. TBC1D2A (also called
PARIS-1/Prostate antigen recognized and identified by
SEREX 1 and ARMUS) contains a PH domain and a TBC-type
GTPase catalytic domain. TBC1D2A integrates signaling
between Arf6, Rac1, and Rab7 during junction
disassembly. Activated Rac1 recruits TBC1D2A to locally
inactivate Rab7 via its C-terminal TBC/RabGAP domain and
facilitate E-cadherin degradation in lysosomes. The
TBC1D2A PH domain mediates localization at cell-cell
contacts and coprecipitates with cadherin complexes. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 101
Score = 41.5 bits (98), Expect = 1e-05
Identities = 25/99 (25%), Positives = 45/99 (45%), Gaps = 19/99 (19%)
Query: 62 QHSGWLHKKSG----RNWKRYWFVLKD---QVMYKYKASEDIKALLSIPVLG----YELE 110
+ G+L+K + WK WFV + Q+ Y Y++ +DI L SI + G Y+ E
Sbjct: 1 RLCGYLNKLETKGLLKTWKSRWFVFDERKCQLYY-YRSPQDITPLGSIDLSGAAFSYDPE 59
Query: 111 ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAM 149
A F++ G+ + A + Q+ W++ +
Sbjct: 60 AEKGT------FEIHTPGRV-YILKASDRQAMLYWLQEL 91
>gnl|CDD|241460 cd13306, PH1_AFAP, Actin filament associated protein family
Pleckstrin homology (PH) domain, repeat 1. There are 3
members of the AFAP family of adaptor proteins: AFAP1,
AFAP1L1, and AFAP1L2/XB130. AFAP1 is a cSrc binding
partner and actin cross-linking protein. AFAP1L1 is
thought to play a similar role to AFAP1 in terms of
being an actin cross-linking protein, but it
preferentially binds to cortactin and not cSrc, thereby
playing a role in invadosome formation. AFAP1L2 is a
cSrc binding protein, but does not bind to actin
filaments. AFAP1L2 acts as an intermediary between the
RET/PTC kinase and PI-3kinase pathway in the thyroid.
The AFAPs share a similar structure of a SH3 binding
motif, 3 SH2 binding motifs, 2 PH domains, a coiled-coil
region corresponding to the AFAP1 leucine zipper, and an
actin binding domain. The amino terminal PH1 domain of
AFAP1 has been known to function in intra-molecular
regulation of AFAP1. In addition, the PH1 domain is a
binding partner for PKCa and phospholipids. This cd is
the first PH domain of AFAP. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 107
Score = 40.9 bits (96), Expect = 3e-05
Identities = 22/88 (25%), Positives = 43/88 (48%), Gaps = 1/88 (1%)
Query: 67 LHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK-YVFQLK 125
KK W + V+KD + YK+S+D + L + +LG + + + K + ++
Sbjct: 19 WRKKWLGQWAKQLCVIKDNRLLCYKSSKDQQPQLDLNLLGCNVIYVPKDGRRKKHELKIT 78
Query: 126 HQGQDPLVFGADNEQSYERWMKAMREAT 153
G + LV +++ E W+K +RE +
Sbjct: 79 PPGAEALVLAVQSKEQAEEWLKVIREVS 106
>gnl|CDD|241284 cd01253, PH_ARHGAP21-like, ARHGAP21 and related proteins pleckstrin
homology (PH) domain. ARHGAP family genes encode
Rho/Rac/Cdc42-like GTPase activating proteins with a
RhoGAP domain. These proteins functions as a
GTPase-activating protein (GAP) for RHOA and CDC42.
ARHGAP21 controls the Arp2/3 complex and F-actin
dynamics at the Golgi complex by regulating the activity
of the small GTPase Cdc42. It is recruited to the Golgi
by to GTPase, ARF1, through its PH domain and its
helical motif. It is also required for CTNNA1
recruitment to adherens junctions. ARHGAP21 and it
related proteins all contains a PH domain and a RhoGAP
domain. Some of the members have additional N-terminal
domains including PDZ, SH3, and SPEC. The ARHGAP21 PH
domain interacts with the GTPbound forms of both ARF1
and ARF6 ARF-binding domain/ArfBD. The members here
include: ARHGAP15, ARHGAP21, and ARHGAP23. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 113
Score = 40.0 bits (94), Expect = 6e-05
Identities = 28/114 (24%), Positives = 42/114 (36%), Gaps = 34/114 (29%)
Query: 65 GWLHKK----------SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNE 114
GWLH K S R+WK+ W VL+ +Y YK + LS A +
Sbjct: 4 GWLHFKQSVLEKGKRASDRSWKQVWAVLRGHSLYLYKDKRETSPALSA--------AEDS 55
Query: 115 QDNF----------------KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
+ K VF+L +F A++ W+KA++E
Sbjct: 56 EQRIDIRSCIVDIAYSYTKRKNVFRLTTSDGSEYLFQAEDRDDMLGWIKAIQEN 109
>gnl|CDD|241426 cd13272, PH_INPP4A_INPP4B, Type I inositol 3,4-bisphosphate
4-phosphatase and Type II inositol 3,4-bisphosphate
4-phosphatase Pleckstrin homology (PH) domain. INPP4A
(also called Inositol polyphosphate 4-phosphatase type
I) and INPP4B (also called Inositol polyphosphate
4-phosphatase type II) both catalyze the hydrolysis of
the 4-position phosphate of phosphatidylinositol
3,4-bisphosphate and inositol 1,3,4-trisphosphate. They
differ in that INPP4A additionally catalyzes the
hydrolysis of the 4-position phosphate of inositol
3,4-bisphosphate, while INPP4B catalyzes the hydrolysis
of the 4-position phosphate of inositol
1,4-bisphosphate. They both have a single PH domain
followed by a C2 domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 116
Score = 39.1 bits (92), Expect = 1e-04
Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 3/92 (3%)
Query: 62 QHSGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFKYV 121
Q + +KS +R WF L+ +++ +K++E + VL E D +
Sbjct: 5 QMGFF--RKSEVFKER-WFKLRGNLLFYFKSNEPGSEPAGVIVLENCRVQREEPDPGGFA 61
Query: 122 FQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
F L + + F +E+ + W++A+++A+
Sbjct: 62 FSLVFKDEKKYRFSCRSEEERDEWIEAIKQAS 93
>gnl|CDD|241271 cd01238, PH_Btk, Bruton's tyrosine kinase pleckstrin homology (PH)
domain. Btk is a member of the Tec family of
cytoplasmic protein tyrosine kinases that includes BMX,
IL2-inducible T-cell kinase (Itk) and Tec. Btk plays a
role in the maturation of B cells. Tec proteins general
have an N-terminal PH domain, followed by a Tek homology
(TH) domain, a SH3 domain, a SH2 domain and a kinase
domain. The Btk PH domain binds phosphatidylinositol
3,4,5-trisphosphate and responds to signalling via
phosphatidylinositol 3-kinase. The PH domain is also
involved in membrane anchoring which is confirmed by the
discovery of a mutation of a critical arginine residue
in the BTK PH domain. This results in severe human
immunodeficiency known as X-linked agammaglobulinemia
(XLA) in humans and a related disorder is mice.PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 140
Score = 39.5 bits (93), Expect = 1e-04
Identities = 26/100 (26%), Positives = 42/100 (42%), Gaps = 13/100 (13%)
Query: 64 SGWLHKKS-GR------NWKRYWFVLKDQVM--YKYKASEDIKALLSIP---VLGYELEA 111
G L K+S G+ N+K WFVL + Y+ + K SI + E
Sbjct: 2 EGLLVKRSQGKKRFGPVNYKERWFVLTKSSLSYYEGDGGKRGKEKGSIDLSKIKCVEEVK 61
Query: 112 LNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMRE 151
+ KY FQ+ + L A +E+ + W+ A+R+
Sbjct: 62 DDASFERKYPFQVVY-DDYTLYVFAPSEEDRDEWILALRK 100
>gnl|CDD|241270 cd01237, PH_fermitin, Fermitin family pleckstrin homology (PH)
domain. Fermitin functions as a mediator of integrin
inside-out signalling. The recruitment of Fermitin
proteins and Talin to the membrane mediates the terminal
event of integrin signalling, via interaction with
integrin beta subunits. Fermatin has FERM domain
interrupted with a pleckstrin homology (PH) domain.
Fermitin family homologs (Fermt1, 2, and 3, also known
as Kindlins) are each encoded by a different gene. In
mammalian studies, Fermt1 is generally expressed in
epithelial cells, Fermt2 is expressed inmuscle tissues,
and Fermt3 is expressed in hematopoietic lineages.
Specifically Fermt2 is expressed in smooth and striated
muscle tissues in mice and in the somites (a trunk
muscle precursor) and neural crest in Xenopus embryos.
As such it has been proposed that Fermt2 plays a role in
cardiomyocyte and neural crest differentiation.
Expression of mammalian Fermt3 is associated with
hematopoietic lineages: the anterior ventral blood
islands, vitelline veins, and early myeloid cells. In
Xenopus embryos this expression, also include the
notochord and cement gland. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 38.5 bits (90), Expect = 2e-04
Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
Query: 69 KKSGRNWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGYELEALNEQDNFKYVFQLK- 125
K + + +KRYWFV KD + YK+ E+ + I + G E+ K+ +L
Sbjct: 14 KFTLKGFKRYWFVFKDTHLSYYKSKEESNGAPIQQINLKGCEVTPDVNVSQGKFGIKLLI 73
Query: 126 --HQGQDPLVFGADNEQSYERWMKAMREA 152
+G + + D+E+ Y +WM A R A
Sbjct: 74 PSPEGMNEVWLRCDSEEQYAKWMAACRLA 102
>gnl|CDD|241436 cd13282, PH1_PLEKHH1_PLEKHH2, Pleckstrin homology (PH) domain
containing, family H (with MyTH4 domain) members 1 and 2
(PLEKHH1) PH domain, repeat 1. PLEKHH1 and PLEKHH2
(also called PLEKHH1L) are thought to function in
phospholipid binding and signal transduction. There are
3 Human PLEKHH genes: PLEKHH1, PLEKHH2, and PLEKHH3.
There are many isoforms, the longest of which contain a
FERM domain, a MyTH4 domain, two PH domains, a peroximal
domain, a vacuolar domain, and a coiled coil stretch.
The FERM domain has a cloverleaf tripart structure
(FERM_N, FERM_M, FERM_C/N, alpha-, and C-lobe/A-lobe,
B-lobe, C-lobe/F1, F2, F3). The C-lobe/F3 within the
FERM domain is part of the PH domain family. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 37.7 bits (88), Expect = 2e-04
Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 4/48 (8%)
Query: 64 SGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDI--KALLSIPVLGY 107
+G+L K G+ WKR WFVLK+ ++ YK+ D+ K I + G
Sbjct: 2 AGYLTKLGGKVKTWKRRWFVLKNGELFYYKSPNDVIRKPQGQIALDGS 49
>gnl|CDD|241414 cd13260, PH_RASA1, RAS p21 protein activator (GTPase activating
protein) 1 Pleckstrin homology (PH) domain. RASA1 (also
called RasGap1 or p120) is a member of the RasGAP family
of GTPase-activating proteins. RASA1 contains N-terminal
SH2-SH3-SH2 domains, followed by two C2 domains, a PH
domain, a RasGAP domain, and a BTK domain. Splice
variants lack the N-terminal domains. It is a cytosolic
vertebrate protein that acts as a suppressor of RAS via
its C-terminal GAP domain function, enhancing the weak
intrinsic GTPase activity of RAS proteins resulting in
the inactive GDP-bound form of RAS, allowing control of
cellular proliferation and differentiation.
Additionally, it is involved in mitogenic signal
transmission towards downstream interacting partners
through its N-terminal SH2-SH3-SH2 domains. RASA1
interacts with a number of proteins including: G3BP1,
SOCS3, ANXA6, Huntingtin, KHDRBS1, Src, EPHB3, EPH
receptor B2, Insulin-like growth factor 1 receptor,
PTK2B, DOK1, PDGFRB, HCK, Caveolin 2, DNAJA3, HRAS,
GNB2L1 and NCK1. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 103
Score = 37.3 bits (87), Expect = 5e-04
Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 14/100 (14%)
Query: 63 HSGWLHKKSGRN--WKRYWFVL--KDQVMYKYKASEDIKAL----LSIPVLGYELEALNE 114
G+L KKSG+N WK +FVL +Q +Y ++ + K LS + ++L
Sbjct: 5 KKGYLLKKSGKNKKWKNLYFVLEGAEQHLYFFENEKRTKPKGLIDLSYSSVYPVHDSLFG 64
Query: 115 QDNFKYVFQLKHQGQDPLV---FGADNEQSYERWMKAMRE 151
+ N FQ+ + + AD + + WMKA+R
Sbjct: 65 RPN---CFQIVVRALNESTIYYLCADTAELAQDWMKALRA 101
>gnl|CDD|241268 cd01235, PH_Sbf1_hMTMR5, Set binding factor 1 (also called Human
MTMR5) Pleckstrin Homology (PH) domain. Sbf1 is a
myotubularin-related pseudo-phosphatase. Both Sbf1 and
myotubularin interact with the SET domains of Hrx and
other epigenetic regulatory proteins, but Sbf1 lacks
phosphatase activity due to several amino acid changes
in its structurally preserved catalytic pocket. It
contains pleckstrin (PH), GEF, and myotubularin
homology domains that are thought to be responsible for
signaling and growth control. Sbf1 functions as an
inhibitor of cellular growth. The N-terminal GEF
homology domain serves to inhibit the transforming
effects of Sbf1. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 106
Score = 36.5 bits (85), Expect = 0.001
Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 6/40 (15%)
Query: 63 HSGWLHKKSG--RNWKRYWFVL---KDQVMYKYKASEDIK 97
G+L+K+ + WK+ WFVL K Q+ Y Y++ ED K
Sbjct: 5 CEGYLYKRGALLKGWKQRWFVLDLTKHQLRY-YESKEDTK 43
>gnl|CDD|241451 cd13297, PH3_MyoX-like, Myosin X-like Pleckstrin homology (PH)
domain, repeat 3. MyoX, a MyTH-FERM myosin, is a
molecular motor that has crucial functions in the
transport and/or tethering of integrins in the
actin-based extensions known as filopodia, microtubule
binding, and in netrin-mediated axon guidance. It
functions as a dimer. MyoX walks on bundles of actin,
rather than single filaments, unlike the other
unconventional myosins. MyoX is present in organisms
ranging from humans to choanoflagellates, but not in
Drosophila and Caenorhabditis elegans.MyoX consists of
a N-terminal motor/head region, a neck made of 3 IQ
motifs, and a tail consisting of a coiled-coil domain,
a PEST region, 3 PH domains, a myosin tail homology 4
(MyTH4), and a FERM domain at its very C-terminus. The
first PH domain in the MyoX tail is a split-PH domain,
interupted by the second PH domain such that PH 1a and
PH 1b flanks PH 2. The third PH domain (PH 3) follows
the PH 1b domain. This cd contains the third MyoX PH
repeat. PLEKHH3/Pleckstrin homology (PH) domain
containing, family H (with MyTH4 domain) member 3 is
also part of this CD and like MyoX contains a FERM
domain, a MyTH4 domain, and a single PH domain. Not
much is known about the function of PLEKHH3. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They
share little sequence conservation, but all have a
common fold, which is electrostatically polarized. Less
than 10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 123
Score = 36.5 bits (85), Expect = 0.001
Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%)
Query: 53 EVTANDSGSQHSGWLHKKSG-RNW---KRYWFVLKDQVMYKYKASED 95
+ D GWL K+ G K+ WFVL + YK+SE
Sbjct: 5 QTDEGDQEVIEKGWLLKEGGKGGNLTKKKRWFVLTPNSLDYYKSSER 51
>gnl|CDD|241392 cd13238, PH2_FGD4_insect-like, FYVE, RhoGEF and PH domain
containing/faciogenital dysplasia protein 4 pleckstrin
homology (PH) domain, C-terminus, in insect and related
arthropods. In general, FGDs have a RhoGEF (DH) domain,
followed by an N-terminal PH domain, a FYVE domain and a
C-terminal PH domain. All FGDs are guanine nucleotide
exchange factors that activates the Rho GTPase Cdc42, an
important regulator of membrane trafficking. The RhoGEF
domain is responsible for GEF catalytic activity, while
the N-terminal PH domain is involved in intracellular
targeting of the DH domain. FGD4 is one of the genes
associated with Charcot-Marie-Tooth neuropathy type 4
(CMT4), a group of progressive motor and sensory axonal
and demyelinating neuropathies that are distinguished
from other forms of CMT by autosomal recessive
inheritance. Those affected have distal muscle weakness
and atrophy associated with sensory loss and,
frequently, pes cavus foot deformity. This cd contains
insects, crustaceans, and chelicerates. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 36.1 bits (83), Expect = 0.001
Identities = 29/96 (30%), Positives = 46/96 (47%), Gaps = 12/96 (12%)
Query: 64 SGWLHKKS--GRNWKRYWFVLK-DQVMYKYKASEDIKALLSIPVLGY---ELEALNEQDN 117
SG+L K+ + W R WF L D V+Y YK+ ED AL + PV G+ E + +D
Sbjct: 2 SGYLKLKTNGRKTWIRRWFALHPDFVLYSYKSEEDKLALTATPVPGFLVTLGEKGSAEDP 61
Query: 118 FK-----YVFQLKHQGQDPLVFGADNEQSYERWMKA 148
F++ H + F A++ ++W+ A
Sbjct: 62 LNDKDRIRAFKMFHV-KKSYYFQANDGDEKDKWVHA 96
>gnl|CDD|241409 cd13255, PH_TAAP2-like, Tandem PH-domain-containing protein 2
Pleckstrin homology (PH) domain. The binding of TAPP2
(also called PLEKHA2) adaptors to PtdIns(3,4)P(2), but
not PI(3,4, 5)P3, function as negative regulators of
insulin and PI3K signalling pathways (i.e.
TAPP/utrophin/syntrophin complex). TAPP2 contains two
sequential PH domains in which the C-terminal PH domain
specifically binds PtdIns(3,4)P2 with high affinity. The
N-terminal PH domain does not interact with any
phosphoinositide tested. They also contain a C-terminal
PDZ-binding motif that interacts with several
PDZ-binding proteins, including PTPN13 (known previously
as PTPL1 or FAP-1) as well as the scaffolding proteins
MUPP1 (multiple PDZ-domain-containing protein 1),
syntrophin and utrophin. The members here are most
sequence similar to TAPP2 proteins, but may not be
actual TAPP2 proteins. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 36.2 bits (84), Expect = 0.001
Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 2/44 (4%)
Query: 63 HSGWLHKKSGR--NWKRYWFVLKDQVMYKYKASEDIKALLSIPV 104
+G+L KK R WK+ WFVL+ + YK ++ + L I +
Sbjct: 8 KAGYLEKKGERRKTWKKRWFVLRPTKLAYYKNDKEYRLLRLIDL 51
>gnl|CDD|241455 cd13301, PH1_Pleckstrin_2, Pleckstrin 2 Pleckstrin homology (PH)
domain, repeat 1. Pleckstrin is a protein found in
platelets. This name is derived from platelet and
leukocyte C kinase substrate and the KSTR string of
amino acids. Pleckstrin 2 contains two PH domains and a
DEP (dishvelled, egl-10, and pleckstrin) domain. Unlike
pleckstrin 1, pleckstrin 2 does not contain obvious
sites of PKC phosphorylation. Pleckstrin 2 plays a role
in actin rearrangement, large lamellipodia and
peripheral ruffle formation, and may help orchestrate
cytoskeletal arrangement. The PH domains of pleckstrin 2
are thought to contribute to lamellipodia formation.
This cd contains the first PH domain repeat. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 108
Score = 36.2 bits (84), Expect = 0.001
Identities = 25/93 (26%), Positives = 38/93 (40%), Gaps = 3/93 (3%)
Query: 65 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEA-LNEQDNFKYV 121
G+L KK NWK WFVL + + YK D I + G + + E + V
Sbjct: 7 GFLVKKGHVVNNWKARWFVLLEDKLEYYKKKTDSSPKGMILLKGCTITSPCLEYEKRPLV 66
Query: 122 FQLKHQGQDPLVFGADNEQSYERWMKAMREATT 154
F+L A + + + W K + +A T
Sbjct: 67 FKLTTAKGQDHFLQACSREERDAWAKDITKAIT 99
>gnl|CDD|241421 cd13267, PH_DOCK-D, Dedicator of cytokinesis-D subfamily Pleckstrin
homology (PH) domain. DOCK-D subfamily (also called
Zizimin subfamily) consists of Dock9/Zizimin1,
Dock10/Zizimin3, and Dock11/Zizimin2. DOCK-D has a
N-terminal DUF3398 domain, a PH-like domain, a Dock
Homology Region 1, DHR1 (also called CZH1), a C2 domain,
and a C-terminal DHR2 domain (also called CZH2).
Zizimin1 is enriched in the brain, lung, and kidney;
zizimin2 is found in B and T lymphocytes, and zizimin3
is enriched in brain, lung, spleen and thymus. Zizimin1
functions in autoinhibition and membrane targeting.
Zizimin2 is an immune-related and age-regulated guanine
nucleotide exchange factor, which facilitates filopodial
formation through activation of Cdc42, which results in
activation of cell migration. No function has been
determined for Zizimin3 to date. The N-terminal half of
zizimin1 binds to the GEF domain through three distinct
areas, including CZH1, to inhibit the interaction with
Cdc42. In addition its PH domain binds phosphoinositides
and mediates zizimin1 membrane targeting. DOCK is a
family of proteins involved in intracellular signalling
networks. They act as guanine nucleotide exchange
factors for small G proteins of the Rho family, such as
Rac and Cdc42. There are 4 subfamilies of DOCK family
proteins based on their sequence homology: A-D. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 125
Score = 36.1 bits (84), Expect = 0.001
Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 28/122 (22%)
Query: 56 ANDSGSQHSGWLHKK----------SGRNWKRYWFVLKDQV-------MYKYKASEDIKA 98
+ +SG G+L+K + +++KR +F LK V YK + S++ K
Sbjct: 1 SGESGITKEGYLYKGPENSSMFISLAMKSFKRRFFHLKQLVDGSYILEFYKDEKSKEAKG 60
Query: 99 LLSIPVLGYELEALNE-QDNFK---YVFQLKHQGQDPLVFGADNEQSYERWMKAMREATT 154
+ L++ N K + F+L+ Q V A++E + W+ + +
Sbjct: 61 TIY-------LDSCTGVVQNSKRRKFCFELRMQDGKSYVLAAESESEMDDWISKLNKILQ 113
Query: 155 LS 156
++
Sbjct: 114 IN 115
>gnl|CDD|241425 cd13271, PH2_TAPP1_2, Tandem PH-domain-containing proteins 1 and 2
Pleckstrin homology (PH) domain, C-terminal repeat. The
binding of TAPP1 (also called PLEKHA1/pleckstrin
homology domain containing, family A (phosphoinositide
binding specific) member 1) and TAPP2 (also called
PLEKHA2) adaptors to PtdIns(3,4)P(2), but not PI(3,4,
5)P3, function as negative regulators of insulin and
PI3K signalling pathways (i.e. TAPP/utrophin/syntrophin
complex). TAPP1 and TAPP2 contain two sequential PH
domains in which the C-terminal PH domain specifically
binds PtdIns(3,4)P2 with high affinity. The N-terminal
PH domain does not interact with any phosphoinositide
tested. They also contain a C-terminal PDZ-binding motif
that interacts with several PDZ-binding proteins,
including PTPN13 (known previously as PTPL1 or FAP-1) as
well as the scaffolding proteins MUPP1 (multiple
PDZ-domain-containing protein 1), syntrophin and
utrophin. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 114
Score = 35.4 bits (82), Expect = 0.002
Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
Query: 64 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKALLSIP 103
SG+ K+ +NWKR +F+L D + YK+ D + L +IP
Sbjct: 11 SGYCVKQGAVRKNWKRRYFILDDNTISYYKSETDKEPLRTIP 52
>gnl|CDD|241274 cd01241, PH_PKB, Protein Kinase B-like pleckstrin homology (PH)
domain. PKB (also called Akt), a member of the AGC
kinase family, is a phosphatidylinositol 3'-kinase
(PI3K)-dependent Ser/Thr kinase which alters the
activity of the targeted protein. The name AGC is based
on the three proteins that it is most similar to
cAMP-dependent protein kinase 1 (PKA; also known as
PKAC), cGMP-dependent protein kinase (PKG; also known
as CGK1) and protein kinase C (PKC). Human Akt has
three isoforms derived for distinct genes:
Akt1/PKBalpha, Akt2/PKBbeta, and Akt3/PKBgamma. All
Akts have an N-terminal PH domain with an activating
Thr phosphorylation site, a kinase domain, and a short
C-terminal regulatory tail with an activating Ser
phosphorylation site. The PH domain recruits Akt to the
plasma membrane by binding to phosphoinositides
(PtdIns-3,4-P2) and is required for activation. The
phosphorylation of Akt at its Thr and Ser
phosphorylation sites leads to increased Akt activity
toward forkhead transcription factors, the mammalian
target of rapamycin (mTOR), and the
Bcl-xL/Bcl-2-associated death promoter (BAD), all of
which possess a consensus motif R-X-R-XX-ST-B (X =
amino acid, B = bulky hydrophobic residue) for Akt
phosphorylation. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 121
Score = 34.7 bits (80), Expect = 0.005
Identities = 10/23 (43%), Positives = 13/23 (56%), Gaps = 2/23 (8%)
Query: 63 HSGWLHKKSG--RNWKRYWFVLK 83
GWL K+ + W+ WFVLK
Sbjct: 5 KEGWLTKRGEYIKTWRPRWFVLK 27
>gnl|CDD|241427 cd13273, PH_SWAP-70, Switch-associated protein-70 Pleckstrin
homology (PH) domain. SWAP-70 (also called
Differentially expressed in FDCP 6/DEF-6 or
IRF4-binding protein) functions in cellular signal
transduction pathways (in conjunction with Rac),
regulates cell motility through actin rearrangement,
and contributes to the transformation and invasion
activity of mouse embryo fibroblasts. Metazoan SWAP-70
is found in B lymphocytes, mast cells, and in a variety
of organs. Metazoan SWAP-70 contains an N-terminal
EF-hand motif, a centrally located PH domain, and a
C-terminal coiled-coil domain. The PH domain of
Metazoan SWAP-70 contains a phosphoinositide-binding
site and a nuclear localization signal (NLS), which
localize SWAP-70 to the plasma membrane and nucleus,
respectively. The NLS is a sequence of four Lys
residues located at the N-terminus of the C-terminal
a-helix; this is a unique characteristic of the
Metazoan SWAP-70 PH domain. The SWAP-70 PH domain binds
PtdIns(3,4,5)P3 and PtdIns(4,5)P2 embedded in lipid
bilayer vesicles. There are additional plant SWAP70
proteins, but these are not included in this hierarchy.
Rice SWAP70 (OsSWAP70) exhibits GEF activity toward the
its Rho GTPase, OsRac1, and regulates chitin-induced
production of reactive oxygen species and defense gene
expression in rice. Arabidopsis SWAP70 (AtSWAP70) plays
a role in both PAMP- and effector-triggered immunity.
Plant SWAP70 contains both DH and PH domains, but their
arrangement is the reverse of that in typical
DH-PH-type Rho GEFs, wherein the DH domain is flanked
by a C-terminal PH domain. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold,
which is electrostatically polarized. Less than 10% of
PH domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 34.6 bits (80), Expect = 0.005
Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 3/35 (8%)
Query: 65 GWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIK 97
G+L KK W+ WFVLK + YK SED+K
Sbjct: 12 GYLWKKGHLLPTWRERWFVLKPNSLSYYK-SEDLK 45
>gnl|CDD|241404 cd13250, PH_ACAP, ArfGAP with coiled-coil, ankyrin repeat and PH
domains Pleckstrin homology (PH) domain. ACAP (also
called centaurin beta) functions both as a Rab35
effector and as an Arf6-GTPase-activating protein (GAP)
by which it controls actin remodeling and membrane
trafficking. ACAP contain an NH2-terminal
bin/amphiphysin/Rvs (BAR) domain, a
phospholipid-binding domain, a PH domain, a GAP domain,
and four ankyrin repeats. The AZAPs constitute a family
of Arf GAPs that are characterized by an NH2-terminal
pleckstrin homology (PH) domain and a central Arf GAP
domain followed by two or more ankyrin repeats. On the
basis of sequence and domain organization, the AZAP
family is further subdivided into four subfamilies: 1)
the ACAPs contain an NH2-terminal bin/amphiphysin/Rvs
(BAR) domain (a phospholipid-binding domain that is
thought to sense membrane curvature), a single PH
domain followed by the GAP domain, and four ankyrin
repeats; 2) the ASAPs also contain an NH2-terminal BAR
domain, the tandem PH domain/GAP domain, three ankyrin
repeats, two proline-rich regions, and a COOH-terminal
Src homology 3 domain; 3) the AGAPs contain an
NH2-terminal GTPase-like domain (GLD), a split PH
domain, and the GAP domain followed by four ankyrin
repeats; and 4) the ARAPs contain both an Arf GAP
domain and a Rho GAP domain, as well as an NH2-terminal
sterile-a motif (SAM), a proline-rich region, a
GTPase-binding domain, and five PH domains. PMID
18003747 and 19055940 Centaurin can bind to
phosphatidlyinositol (3,4,5)P3. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold,
which is electrostatically polarized. Less than 10% of
PH domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 98
Score = 34.1 bits (79), Expect = 0.007
Identities = 10/32 (31%), Positives = 17/32 (53%), Gaps = 3/32 (9%)
Query: 63 HSGWLHKKS---GRNWKRYWFVLKDQVMYKYK 91
G+L K+S + WKR WF +++ + K
Sbjct: 1 KEGYLFKRSSNAFKTWKRRWFSIQNGQLVYQK 32
>gnl|CDD|241419 cd13265, PH_evt, Evectin Pleckstrin homology (PH) domain. There
are 2 members of the evectin family (also called
pleckstrin homology domain containing, family B): evt-1
(also called PLEKHB1) and evt-2 (also called PLEKHB2).
evt-1 is specific to the nervous system, where it is
expressed in photoreceptors and myelinating glia. evt-2
is widely expressed in both neural and nonneural
tissues. Evectins possess a single N-terminal PH domain
and a C-terminal hydrophobic region. evt-1 is thought
to function as a mediator of post-Golgi trafficking in
cells that produce large membrane-rich organelles. It
is a candidate gene for the inherited human retinopathy
autosomal dominant familial exudative vitreoretinopathy
and a susceptibility gene for multiple sclerosis. evt-2
is essential for retrograde endosomal membrane
transport from the plasma membrane (PM) to the Golgi.
Two membrane trafficking pathways pass through
recycling endosomes: a recycling pathway and a
retrograde pathway that links the PM to the Golgi/ER.
Its PH domain that is unique in that it specifically
recognizes phosphatidylserine (PS), but not
polyphosphoinositides. PS is an anionic phospholipid
class in eukaryotic biomembranes, is highly enriched in
the PM, and plays key roles in various physiological
processes such as the coagulation cascade, recruitment
and activation of signaling molecules, and clearance of
apoptotic cells. PH domains are only found in
eukaryotes. They share little sequence conservation,
but all have a common fold, which is electrostatically
polarized. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 108
Score = 34.2 bits (79), Expect = 0.007
Identities = 11/22 (50%), Positives = 15/22 (68%), Gaps = 2/22 (9%)
Query: 64 SGWLHKKSG--RNWKRYWFVLK 83
SGWL ++S + WK+ WFVL
Sbjct: 6 SGWLLRQSTILKRWKKNWFVLY 27
>gnl|CDD|241429 cd13275, PH_M-RIP, Myosin phosphatase-RhoA Interacting Protein
Pleckstrin homology (PH) domain. M-RIP is proposed to
play a role in myosin phosphatase regulation by RhoA.
M-RIP contains 2 PH domains followed by a Rho binding
domain (Rho-BD), and a C-terminal myosin binding
subunit (MBS) binding domain (MBS-BD). The amino
terminus of M-RIP with its adjacent PH domains and
polyproline motifs mediates binding to both actin and
Galpha. M-RIP brings RhoA and MBS into close proximity
where M-RIP can target RhoA to the myosin phosphatase
complex to regulate the myosin phosphorylation state.
M-RIP does this via its C-terminal coiled-coil domain
which interacts with the MBS leucine zipper domain of
myosin phosphatase, while its Rho-BD, directly binds
RhoA in a nucleotide-independent manner. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They
share little sequence conservation, but all have a
common fold, which is electrostatically polarized. Less
than 10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 103
Score = 33.5 bits (77), Expect = 0.013
Identities = 13/32 (40%), Positives = 19/32 (59%), Gaps = 1/32 (3%)
Query: 65 GWLHKKSGRN-WKRYWFVLKDQVMYKYKASED 95
GWL K+ WK++WFVL+D + Y+ S
Sbjct: 3 GWLMKQDEDGEWKKHWFVLRDASLRYYRDSVA 34
>gnl|CDD|241463 cd13309, PH_SKIP, SifA and kinesin-interacting protein Pleckstrin
homology (PH) domain. SKIP (also called
PLEKHM2/Pleckstrin homology domain-containing family M
member 2) is a soluble cytosolic protein that contains a
RUN domain and a PH domain separated by a unstructured
linker region. SKIP is a target of the Salmonella
effector protein SifA and the SifA-SKIP complex
regulates kinesin-1 on the bacterial vacuole. The PH
domain of SKIP binds to the N-terminal region of SifA
while the N-terminus of SKIP is proposed to bind the TPR
domain of the kinesin light chain. The opposite side of
the SKIP PH domain is proposed to bind
phosphoinositides. TSifA, SKIP, SseJ, and RhoA family
GTPases are also thought to promote host membrane
tubulation. Recently, it was shown that the lysosomal
GTPase Arl8 binds to the kinesin-1 linker SKIP and that
both are required for the normal intracellular
distribution of lysosomes. Interestingly, two kinesin
light chain binding motifs (WD) in SKIP have now been
identified to match a consensus sequence for a kinesin
light chain binding site found in several proteins
including calsyntenin-1/alcadein, caytaxin, and vaccinia
virus A36. SKIP has also been shown to interact with
Rab1A. PH domains have diverse functions, but in general
are involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 103
Score = 33.1 bits (76), Expect = 0.015
Identities = 25/97 (25%), Positives = 44/97 (45%), Gaps = 8/97 (8%)
Query: 64 SGWLHKKSGR------NWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDN 117
G L K+G WK +F+LK+ V+Y+Y D LLSI + G + +N
Sbjct: 3 EGPLMYKTGTSYLGGETWKPGYFLLKNGVLYQYPDRSDRLPLLSISLGGEQCGGCRRINN 62
Query: 118 FK--YVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
+ F+L + L A +E W++++ ++
Sbjct: 63 TDRPHSFELILTDRPSLELAAPDEYEASEWLQSLCQS 99
>gnl|CDD|241307 cd10571, PH_beta_spectrin, Beta-spectrin pleckstrin homology (PH)
domain. Beta spectrin binds actin and functions as a
major component of the cytoskeleton underlying cellular
membranes. Beta spectrin consists of multiple spectrin
repeats followed by a PH domain, which binds to
inositol-1,4,5-trisphosphate. The PH domain of
beta-spectrin is thought to play a role in the
association of spectrin with the plasma membrane of
cells. PH domains have diverse functions, but in general
are involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 105
Score = 33.0 bits (76), Expect = 0.016
Identities = 25/89 (28%), Positives = 43/89 (48%), Gaps = 5/89 (5%)
Query: 69 KKSGRNWKRYWFVLKDQVMYKYK-----ASEDIKALLSIPVLGYELEALNEQDNFKYVFQ 123
K S R+WK+ + VLK Q + YK ASE + + G E ++ K+VF+
Sbjct: 17 KASNRSWKKVYCVLKGQELSFYKDQKAAASESYAGEPPLNLSGAVCEVASDYKKKKHVFR 76
Query: 124 LKHQGQDPLVFGADNEQSYERWMKAMREA 152
L+ +F A +E+ W++ ++ A
Sbjct: 77 LRLSDGSEYLFQAKDEEEMNDWVQKLQAA 105
>gnl|CDD|241255 cd01220, PH1_FARP1-like, FERM, RhoGEF and pleckstrin
domain-containing protein 1 and related proteins
Pleckstrin Homology (PH) domain, repeat 1. Members here
include FARP1 (also called Chondrocyte-derived
ezrin-like protein; PH domain-containing family C member
2), FARP2 (also called FIR/FERM domain including RhoGEF;
FGD1-related Cdc42-GEF/FRG), and FARP6 (also called Zinc
finger FYVE domain-containing protein 24). They are
members of the Dbl family guanine nucleotide exchange
factors (GEFs) which are upstream positive regulators of
Rho GTPases. Little is known about FARP1 and FARP6,
though FARP1 has increased expression in differentiated
chondrocytes. FARP2 is thought to regulate neurite
remodeling by mediating the signaling pathways from
membrane proteins to Rac. It is found in brain, lung,
and testis, as well as embryonic hippocampal and
cortical neurons. FARP1 and FARP2 are composed of a
N-terminal FERM domain, a proline-rich (PR) domain,
Dbl-homology (DH), and two C-terminal PH domains. FARP6
is composed of Dbl-homology (DH), and two C-terminal PH
domains separated by a FYVE domain. This hierarchy
contains the first PH repeat. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 123
Score = 33.1 bits (76), Expect = 0.019
Identities = 21/92 (22%), Positives = 42/92 (45%), Gaps = 5/92 (5%)
Query: 65 GWLHKKSGRNWK-RYWFVLKDQVMYKYK---ASEDIKALLSIPVLGYELEALNEQDNFKY 120
G L K S + + R +F+ D ++Y + ++ K +P+ G +E + +
Sbjct: 26 GCLLKLSKKGLQQRMFFLFSDVLIYTSRGPTSTLQFKVHGQLPLRGLMVEESEPEMGVPH 85
Query: 121 VFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
F + + G L A +E+ ERW++ + A
Sbjct: 86 CFTI-YGGNRALTVAASSEEEKERWLEDLSRA 116
>gnl|CDD|241403 cd13249, PH_anillin_2, Anillin Pleckstrin homology (PH) domain.
Anillin is an actin binding protein involved in
cytokinesis. It has a C-terminal PH domain, which has
been shown to be necessary, but not sufficient for
targetting of anillin to ectopic septin containing foci.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 111
Score = 32.3 bits (74), Expect = 0.027
Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 13/98 (13%)
Query: 64 SGWLHKKSG----RNWKRYWFVLKDQVMYKYKASEDIKA----LLSIPVLGYELEALNEQ 115
SG+L ++ ++W R + VLK + Y + E+I+A LL+IP+ ++
Sbjct: 5 SGYLSQQQSVEGLQSWTRLYCVLKGGNLLCYYSPEEIEAKVEPLLTIPINKDTRIRAVDK 64
Query: 116 DNFKYVFQLKHQGQDP-----LVFGADNEQSYERWMKA 148
D F L P VF AD+ + + WM+A
Sbjct: 65 DAQGRSFNLSIINPYPGDEVTHVFSADSREDLQLWMEA 102
>gnl|CDD|241264 cd01230, PH1_Tiam1_2, T-lymphoma invasion and metastasis 1 and 2
Pleckstrin Homology (PH) domain, N-terminal domain.
Tiam1 activates Rac GTPases to induce membrane ruffling
and cell motility while Tiam2 (also called STEF (SIF
(still life) and Tiam1 like-exchange factor) contributes
to neurite growth. Tiam1/2 are Dbl-family of GEFs that
possess a Dbl(DH) domain with a PH domain in tandem.
DH-PH domain catalyzes the GDP/GTP exchange reaction in
the GTPase cycle and facillitating the switch between
inactive GDP-bound and active GTP-bound states. Tiam1/2
possess two PH domains, which are often referred to as
PHn and PHc domains. The DH-PH tandem domain is made up
of the PHc domain while the PHn is part of a novel
N-terminal PHCCEx domain which is made up of the PHn
domain, a coiled coil region(CC), and an extra region
(Ex). PHCCEx mediates binding to plasma membranes and
signalling proteins in the activation of Rac GTPases.
The PH domain resembles the beta-spectrin PH domain,
suggesting non-canonical phosphatidylinositol binding.
CC and Ex form a positively charged surface for protein
binding. There are 2 motifs in Tiam1/2-interacting
proteins that bind to the PHCCEx domain: Motif-I in
CD44, ephrinBs, and the NMDA receptor and Motif-II in
Par3 and JIP2.Neither of these fall in the PHn domain.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 127
Score = 31.6 bits (72), Expect = 0.061
Identities = 29/109 (26%), Positives = 41/109 (37%), Gaps = 20/109 (18%)
Query: 64 SGWLHKK--------------SGRNWKRYWFVLKDQVMYKYKASE-DIKALLSIPVLGYE 108
+GWL K S R WK+YW LK + Y+ E S P
Sbjct: 6 AGWLSVKNFLTHKKKKKLELASRRKWKKYWVTLKGCTLLFYECDERTGIDDNSTPKHALF 65
Query: 109 LE-----ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
+E A+ E VF L + D +F A ++ E W+ A+ A
Sbjct: 66 VEGSIAQAVPEHPKKDNVFCLSNSFGDAYLFQATSQTELENWITAIHSA 114
>gnl|CDD|241448 cd13294, PH_ORP_plant, Plant Oxysterol binding protein related
protein Pleckstrin homology (PH) domain. Plant ORPs
contain a N-terminal PH domain and a C-terminal
OSBP-related domain. Not much is known about its
specific function in plants to date. Members here
include: Arabidopsis, spruce, and petunia. Oxysterol
binding proteins are a multigene family that is
conserved in yeast, flies, worms, mammals and plants. In
general OSBPs and ORPs have been found to be involved in
the transport and metabolism of cholesterol and related
lipids in eukaryotes. They all contain a C-terminal
oxysterol binding domain, and most contain an N-terminal
PH domain. OSBP PH domains bind to membrane
phosphoinositides and thus likely play an important role
in intracellular targeting. They are members of the
oxysterol binding protein (OSBP) family which includes
OSBP, OSBP-related proteins (ORP), Goodpasture antigen
binding protein (GPBP), and Four phosphate adaptor
protein 1 (FAPP1). They have a wide range of purported
functions including sterol transport, cell cycle
control, pollen development and vessicle transport from
Golgi recognize both PI lipids and ARF proteins. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 100
Score = 30.9 bits (70), Expect = 0.078
Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 8/92 (8%)
Query: 65 GWLHK--KSGRNWKRYWFVLKDQVM--YKYKASEDIKALLSIPVLGYELEALNEQDNFKY 120
G L+K G+ W+ WFVL+D V+ YK + +K + + + D Y
Sbjct: 3 GILYKWVNYGKGWRSRWFVLQDGVLSYYKVHGPDKVKPSGEVHLKVSSIRESRSDDKKFY 62
Query: 121 VFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
+F G L A++ + W++A++ A
Sbjct: 63 IF----TGTKTLHLRAESREDRAAWLEALQAA 90
>gnl|CDD|241282 cd01251, PH2_ADAP, ArfGAP with dual PH domains Pleckstrin homology
(PH) domain, repeat 2. ADAP (also called centaurin
alpha) is a phophatidlyinositide binding protein
consisting of an N-terminal ArfGAP domain and two PH
domains. In response to growth factor activation, PI3K
phosphorylates phosphatidylinositol 4,5-bisphosphate to
phosphatidylinositol 3,4,5-trisphosphate. Centaurin
alpha 1 is recruited to the plasma membrane following
growth factor stimulation by specific binding of its PH
domain to phosphatidylinositol 3,4,5-trisphosphate.
Centaurin alpha 2 is constitutively bound to the plasma
membrane since it binds phosphatidylinositol
4,5-bisphosphate and phosphatidylinositol
3,4,5-trisphosphate with equal affinity. This cd
contains the second PH domain repeat. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 105
Score = 31.0 bits (71), Expect = 0.097
Identities = 22/100 (22%), Positives = 41/100 (41%), Gaps = 15/100 (15%)
Query: 65 GWLHK---KSGRNWKRYWFVLKDQ-VMYKYKASEDIKALLSIPVLGYELE--------AL 112
G+L K K +++ WF L D+ +MY +K D I +G + E
Sbjct: 6 GYLEKTGPKQTDGFRKRWFTLDDRRLMY-FKDPLDAFPKGEIF-IGSKEEGYSVREGLPA 63
Query: 113 NEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
+ ++ + F L V A+ E+ W+ A+++
Sbjct: 64 GIKGHWGFGFTL-VTPDRTFVLSAETEEERREWITAIQKV 102
>gnl|CDD|241388 cd13234, PHsplit_PLC_gamma, Phospholipase C-gamma Split pleckstrin
homology (PH) domain. PLC-gamma (PLCgamma) is activated
by receptor and non-receptor tyrosine kinases due to the
presence of its SH2 and SH3 domains. There are two main
isoforms of PLC-gamma expressed in human specimens,
PLC-gamma1 and PLC-gamma2. PLC-gamma consists of an
N-terminal PH domain, a EF hand domain, a catalytic
domain split into X and Y halves internal to which is a
PH domain split by two SH2 domains and a single SH3
domain, and a C-terminal C2 domain. The split PH domain
is present in this hierarchy. PLCs (EC 3.1.4.3) play a
role in the initiation of cellular activation,
proliferation, differentiation and apoptosis. They are
central to inositol lipid signalling pathways,
facilitating intracellular Ca2+ release and protein
kinase C (PKC) activation. Specificaly, PLCs catalyze
the cleavage of phosphatidylinositol-4,5-bisphosphate
(PIP2) and result in the release of 1,2-diacylglycerol
(DAG) and inositol 1,4,5-triphosphate (IP3). These
products trigger the activation of protein kinase C
(PKC) and the release of Ca2+ from intracellular stores.
There are fourteen kinds of mammalian phospholipase C
proteins which are are classified into six isotypes
(beta, gamma, delta, epsilon, zeta, eta). PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 105
Score = 30.9 bits (70), Expect = 0.10
Identities = 22/86 (25%), Positives = 39/86 (45%), Gaps = 7/86 (8%)
Query: 75 WKRYWFVLKDQVMYKYKASED--IKALL--SIPVLGYELEALNEQDNFK-YVFQL--KHQ 127
W ++FVL +Y + +E+ + +LL + V + E N + +VF L K
Sbjct: 17 WTPHYFVLTSNKIYYSEETENSPLGSLLRGILDVPSCHVVIRPEGKNSRPFVFILSPKQL 76
Query: 128 GQDPLVFGADNEQSYERWMKAMREAT 153
L AD ++ W++ +RE T
Sbjct: 77 SDPSLDVAADTQEELFDWVQKIREIT 102
>gnl|CDD|241294 cd01263, PH_anillin, Anillin Pleckstrin homology (PH) domain.
Anillin (Rhotekin/RTKN; also called PLEKHK/Pleckstrin
homology domain-containing family K) is an actin binding
protein involved in cytokinesis. It interacts with
GTP-bound Rho proteins and results in the inhibition of
their GTPase activity. Dysregulation of the Rho signal
transduction pathway has been implicated in many forms
of cancer. Anillin proteins have a N-terminal HRI
domain/ACC (anti-parallel coiled-coil) finger domain or
Rho-binding domain binds small GTPases from the Rho
family. The C-terminal PH domain helps target anillin to
ectopic septin containing foci. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 119
Score = 30.7 bits (70), Expect = 0.11
Identities = 25/118 (21%), Positives = 41/118 (34%), Gaps = 33/118 (27%)
Query: 62 QHSGWL---HKKSGR-NWKRYWFVLKDQVMYKYKASEDI---KALLSIPVLGY------- 107
+H G+L SG W R W VL+ + +K ED K + SI L
Sbjct: 3 EHRGFLTVFEDVSGLGAWHRRWCVLRGGYLSFWKYPEDEEKKKPIGSID-LRKCINEKVE 61
Query: 108 -------------ELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
ELE L ++ + ++ AD ++ W+ A+ +
Sbjct: 62 PASRELCARPNTFELETLRPAED-----SDGTNEKKRVLLSADTKEERIEWLDALNQT 114
>gnl|CDD|241407 cd13253, PH1_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
domain Pleckstrin homology (PH) domain, repeat 1. ARAP
proteins (also called centaurin delta) are
phosphatidylinositol 3,4,5-trisphosphate-dependent
GTPase-activating proteins that modulate actin
cytoskeleton remodeling by regulating ARF and RHO family
members. They bind phosphatidylinositol
3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
binding. There are 3 mammalian ARAP proteins: ARAP1,
ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
SAM (sterile alpha motif) domain, 5 PH domains, an
ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
Ras-associating domain. This hierarchy contains the
first PH domain in ARAP. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 93
Score = 30.0 bits (68), Expect = 0.16
Identities = 21/93 (22%), Positives = 43/93 (46%), Gaps = 10/93 (10%)
Query: 64 SGWLHKKSGRN---WKRYWFVLK-DQVMYKYKASEDIKALLSIPVLGYELEALNEQDNFK 119
SGWL K S + +++ W V D + Y + + +++ + IP+ ++ + + K
Sbjct: 3 SGWLDKLSPQGNYVFQKRWVVFDGDSLRY-FNSEKEMYSKGIIPL--SSIKTVRSVGDNK 59
Query: 120 YVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
F++ G VF A++E W+ + A
Sbjct: 60 --FEV-VTGNRTFVFRAESEDERNLWVSTLMAA 89
>gnl|CDD|241309 cd10573, PH_DAPP1, Dual Adaptor for Phosphotyrosine and
3-Phosphoinositides Pleckstrin homology (PH) domain.
DAPP1 (also known as PHISH/3'
phosphoinositide-interacting SH2 domain-containing
protein or Bam32) plays a role in B-cell activation and
has potential roles in T-cell and mast cell function.
DAPP1 promotes B cell receptor (BCR) induced activation
of Rho GTPases Rac1 and Cdc42, which feed into
mitogen-activated protein kinases (MAPK) activation
pathways and affect cytoskeletal rearrangement.
DAPP1can also regulate BCR-induced activation of
extracellular signal-regulated kinase (ERK), and c-jun
NH2-terminal kinase (JNK). DAPP1 contains an N-terminal
SH2 domain and a C-terminal pleckstrin homology (PH)
domain with a single tyrosine phosphorylation site
located centrally. DAPP1 binds strongly to both
PtdIns(3,4,5)P3 and PtdIns(3,4)P2. The PH domain is
essential for plasma membrane recruitment of PI3K upon
cell activation. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 96
Score = 30.0 bits (68), Expect = 0.19
Identities = 14/38 (36%), Positives = 21/38 (55%), Gaps = 2/38 (5%)
Query: 64 SGWLHKKSG--RNWKRYWFVLKDQVMYKYKASEDIKAL 99
G+L K+ G +NWK WFVL+ + +K D K +
Sbjct: 6 EGYLTKQGGIVKNWKTRWFVLRKNELKYFKTRTDTKPI 43
>gnl|CDD|241278 cd01247, PH_FAPP1_FAPP2, Four phosphate adaptor protein 1 and 2
Pleckstrin homology (PH) domain. Human FAPP1 (also
called PLEKHA3/Pleckstrin homology domain-containing,
family A member 3) regulates secretory transport from
the trans-Golgi network to the plasma membrane. It is
recruited through binding of PH domain to
phosphatidylinositol 4-phosphate (PtdIns(4)P) and a
small GTPase ADP-ribosylation factor 1 (ARF1). These
two binding sites have little overlap the FAPP1 PH
domain to associate with both ligands simultaneously
and independently. FAPP1 has a N-terminal PH domain
followed by a short proline-rich region. FAPP1 is a
member of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP), and
Goodpasture antigen binding protein (GPBP). They have a
wide range of purported functions including sterol
transport, cell cycle control, pollen development and
vessicle transport from Golgi recognize both PI lipids
and ARF proteins. FAPP2 (also called PLEKHA8/Pleckstrin
homology domain-containing, family A member 8), a
member of the Glycolipid lipid transfer protein(GLTP)
family has an N-terminal PH domain that targets the TGN
and C-terminal GLTP domain. FAPP2 functions to traffic
glucosylceramide (GlcCer) which is made in the Golgi.
It's interaction with vesicle-associated membrane
protein-associated protein (VAP) could be a means of
regulation. Some FAPP2s share the FFAT-like motifs
found in GLTP. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 100
Score = 30.0 bits (68), Expect = 0.20
Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 2/31 (6%)
Query: 66 WLHKKSGRNWKRYWFVLKDQVMYKYKASEDI 96
W + SG W+ WFVL D V+ YK+ E++
Sbjct: 8 WTNYLSG--WQPRWFVLDDGVLSYYKSQEEV 36
>gnl|CDD|241266 cd01233, PH_KIFIA_KIFIB, KIFIA and KIFIB protein pleckstrin
homology (PH) domain. The kinesin-3 family motors KIFIA
(Caenorhabditis elegans homolog unc-104) and KIFIB
transport synaptic vesicle precursors that contain
synaptic vesicle proteins, such as synaptophysin,
synaptotagmin and the small GTPase RAB3A, but they do
not transport organelles that contain plasma membrane
proteins. They have a N-terminal motor domain, followed
by a coiled-coil domain, and a C-terminal PH domain.
KIF1A adopts a monomeric form in vitro, but acts as a
processive dimer in vivo. KIF1B has alternatively
spliced isoforms distinguished by the presence or
absence of insertion sequences in the conserved
amino-terminal region of the protein; this results in
their different motor activities. KIF1A and KIF1B bind
to RAB3 proteins through the adaptor protein
mitogen-activated protein kinase (MAPK) -activating
death domain (MADD; also calledDENN), which was first
identified as a RAB3 guanine nucleotide exchange factor
(GEF). PH domains have diverse functions, but in general
are involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 111
Score = 29.9 bits (68), Expect = 0.25
Identities = 21/101 (20%), Positives = 35/101 (34%), Gaps = 33/101 (32%)
Query: 46 YVPQ-RLIEVTANDSGSQHSGWLH--KKSGRNWKRYWFVLKDQVMYKYK----------- 91
V + LI + G+L + + W R W VL+ ++ Y
Sbjct: 1 LVAEVELIPKSPV---VSKKGYLLFLEDATDGWVRRWVVLRRPYLHIYSSEKDGDERGVI 57
Query: 92 --------ASEDIKALLSIPVL--------GYELEALNEQD 116
S D +ALL P + Y L+A +E++
Sbjct: 58 NLSTARVEYSPDQEALLGRPNVFAVYTPTNSYLLQARSEKE 98
>gnl|CDD|241267 cd01234, PH_CADPS, Ca2+-dependent activator protein (also called
CAPS) Pleckstrin homology (PH) domain. CADPS/CAPS
consists of two members, CAPS1 which regulates
catecholamine release from neuroendocrine cells and
CAPS2 which is involved in the release of two
neurotrophins, brain-derived neurotrophic factor (BDNF)
and neurotrophin-3 (NT-3) from cerebellar granule cells.
CADPS plays an important role in vesicle exocytosis in
neurons and endocrine cells where it functions to prime
the exocytic machinery for Ca2+-triggered fusion.
Priming involves the assembly of trans SNARE complexes.
The initial interaction of vesicles with target
membranes is mediated by diverse stage-specific
tethering factors or multi-subunit tethering complexes.
CADPS and Munc13 proteins are proposed to be the
functional homologs of the stage-specific tethering
factors that prime membrane fusion. Interestingly,
regions in the C-terminal half of CADPS are similar to
the C-terminal region of Munc13-1 that was reported to
bind syntaxin-1. CADPS has independent interactions with
each of the SNARE proteins (Q-SNARE and R-SNARE)
required for vesicle fusion. CADPS interacts with
Q-SNARE proteins syntaxin-1 (H3 SNARE) and SNAP-25 (SN1)
and might promote Q-SNARE heterodimer formation. Through
its N-terminal R-SNARE VAMP-2 interactions, CADPS bound
to heterodimeric Q-SNARE complexes could be involved in
catalyzing the zippering of VAMP-2 into recipient
complexes. It also contains a central PH domain that
binds to phosphoinositide 4,5 bisphosphate containing
liposomes. Membrane association may also be mediated by
binding to phosphatidlyserine via general electrostatic
interactions. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 122
Score = 29.6 bits (67), Expect = 0.31
Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 21/107 (19%)
Query: 63 HSGWLH---KKSGRNWKRYWFVLKDQVM--------YKYKASEDIKALLSIPVLGYELEA 111
H G+L+ K + WK+ +FVL QV Y+ K SE + + + GY ++
Sbjct: 10 HCGYLYALGKSVWKKWKKRYFVLV-QVSQYTFAMCSYREKKSEPQE---MMQLDGYTVDY 65
Query: 112 LNEQDNF-----KYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
Q + ++ F +G D ++F +D+E + W++A+ AT
Sbjct: 66 TEPQPDLGLEGGRFFFNAVKEG-DSVLFASDDENDRQLWVQALYRAT 111
>gnl|CDD|241440 cd13286, PH_OPR5_ORP8, Human Oxysterol binding protein related
proteins 5 and 8 Pleckstrin homology (PH) domain. Human
ORP5 is proposed to function in efficient nonvesicular
transfer of low-density lipoproteins-derived cholesterol
(LDL-C) from late endosomes/lysosomes to the endoplasmic
reticulum (ER). Human ORP8 is proposed to modulate lipid
homeostasis and sterol regulatory element binding
proteins (SREBP) activity. Both ORP5 and ORP8 contain a
N-terminal PH domain, a C-terminal OSBP-related domain,
followed by a transmembrane domain that localizes ORP5
to the ER. Unlike all the other human OSBP/ORPs they
lack a FFAT motif (two phenylalanines in an acidic
tract). Oxysterol binding proteins are a multigene
family that is conserved in yeast, flies, worms, mammals
and plants. In general OSBPs and ORPs have been found to
be involved in the transport and metabolism of
cholesterol and related lipids in eukaryotes. They all
contain a C-terminal oxysterol binding domain, and most
contain an N-terminal PH domain. OSBP PH domains bind to
membrane phosphoinositides and thus likely play an
important role in intracellular targeting. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol transport,
cell cycle control, pollen development and vessicle
transport from Golgi recognize both PI lipids and ARF
proteins. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 130
Score = 29.6 bits (67), Expect = 0.34
Identities = 26/114 (22%), Positives = 49/114 (42%), Gaps = 27/114 (23%)
Query: 64 SGWLH-KKSGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYEL-EALNEQDNFKYV 121
S WL + + ++W + W VLK V+ YK+ + + + ++ + E+ E +++D F
Sbjct: 11 SDWLKIRGTLKSWTKLWCVLKPGVLLLYKSPKHGQWVGTVLLNACEVIERPSKKDGF--C 68
Query: 122 FQLKH------------QGQ-----------DPLVFGADNEQSYERWMKAMREA 152
F+L H +G+ L+F A E WM A+ +
Sbjct: 69 FKLYHPLDQSIWATRGPKGESVGAITQPLPSSHLIFRAATESDGRCWMDALELS 122
>gnl|CDD|241461 cd13307, PH2_AFAP, Actin filament associated protein family
Pleckstrin homology (PH) domain, repeat 2. There are 3
members of the AFAP family of adaptor proteins: AFAP1,
AFAP1L1, and AFAP1L2/XB130. AFAP1 is a cSrc binding
partner and actin cross-linking protein. AFAP1L1 is
thought to play a similar role to AFAP1 in terms of
being an actin cross-linking protein, but it
preferentially binds to cortactin and not cSrc, thereby
playing a role in invadosome formation. AFAP1L2 is a
cSrc binding protein, but does not bind to actin
filaments. AFAP1L2 acts as an intermediary between the
RET/PTC kinase and PI-3kinase pathway in the thyroid.
The AFAPs share a similar structure of a SH3 binding
motif, 3 SH2 binding motifs, 2 PH domains, a coiled-coil
region corresponding to the AFAP1 leucine zipper, and an
actin binding domain. This cd is the second PH domain of
AFAP. PH domains have diverse functions, but in general
are involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 101
Score = 28.9 bits (65), Expect = 0.42
Identities = 19/91 (20%), Positives = 40/91 (43%), Gaps = 2/91 (2%)
Query: 64 SGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIK-ALLSIPVLGYELEALNEQDNFKYVF 122
G+L+ W+ W +KD ++ Y+ +K +P+ G E+ + + Y F
Sbjct: 5 CGYLNVLVNCQWRSRWCCVKDGQLHFYQDRNKLKSPQQPLPLRGCEVIPGPDPKH-PYSF 63
Query: 123 QLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
++ G++ V A + + RW+ + T
Sbjct: 64 RILRNGEEVAVLEASSSEDMGRWLGLLLAET 94
>gnl|CDD|219987 pfam08719, DUF1768, Domain of unknown function (DUF1768). This is
a domain of unknown function. It is alpha helical in
structure. The GO annotation for this protein suggests
it is involved in nematode larval development and has a
positive regulation on growth rate.
Length = 146
Score = 29.5 bits (67), Expect = 0.42
Identities = 14/49 (28%), Positives = 21/49 (42%), Gaps = 11/49 (22%)
Query: 63 HSGWLHKKSGRNWKRY------WFVLKDQVMY-----KYKASEDIKALL 100
S KK GR + + W +K VM K+ +ED++ LL
Sbjct: 56 KSPAEAKKLGRKVRNFDEARKDWDKVKVDVMREALYAKFSQNEDLRELL 104
>gnl|CDD|241410 cd13256, PH3_ARAP, ArfGAP with RhoGAP domain, ankyrin repeat and PH
domain Pleckstrin homology (PH) domain, repeat 3. ARAP
proteins (also called centaurin delta) are
phosphatidylinositol 3,4,5-trisphosphate-dependent
GTPase-activating proteins that modulate actin
cytoskeleton remodeling by regulating ARF and RHO family
members. They bind phosphatidylinositol
3,4,5-trisphosphate (PtdIns(3,4,5)P3) and
phosphatidylinositol 3,4-bisphosphate (PtdIns(3,4,5)P2)
binding. There are 3 mammalian ARAP proteins: ARAP1,
ARAP2, and ARAP3. All ARAP proteins contain a N-terminal
SAM (sterile alpha motif) domain, 5 PH domains, an
ArfGAP domain, 2 ankyrin domain, A RhoGap domain, and a
Ras-associating domain. This hierarchy contains the
third PH domain in ARAP. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 28.9 bits (65), Expect = 0.46
Identities = 20/98 (20%), Positives = 39/98 (39%), Gaps = 11/98 (11%)
Query: 59 SGSQHSGWLHKKSGRNWKRYWFVLKDQVMYKY---KASE-----DIKALLSIPVLGYELE 110
+ S +K + R W VL+D + Y K++ DI ++ L
Sbjct: 11 TASMAKPTTERKGKEEFSRRWCVLEDGFLSYYESDKSTTPNGEIDISEIVC---LAVNPP 67
Query: 111 ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKA 148
+ F++ F+L + + +FG + ++ W KA
Sbjct: 68 DTDPGHGFEFTFELYLESERLYLFGTETAEAAHEWTKA 105
>gnl|CDD|184854 PRK14852, PRK14852, hypothetical protein; Provisional.
Length = 989
Score = 30.0 bits (67), Expect = 0.51
Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 8/90 (8%)
Query: 64 SGWLHKKSGRNWKRYWFVLKDQVMYKYKASEDIKALLS-IP---VLGYELEALNEQDNFK 119
SG+L R + W +L ++ +K+ D+ L+ IP + G ++ L + +
Sbjct: 54 SGYLKPHPSRMYYNVWSILPATSVFIFKSYHDVLCTLTHIPDSGLFGLPMDTLYKPE--- 110
Query: 120 YVFQLKHQGQDPLVFGADNEQSYERWMKAM 149
V L+ QG++ + GA Q RW M
Sbjct: 111 -VDALRAQGRNVVEVGALATQYSRRWTNLM 139
>gnl|CDD|241433 cd13279, PH_Cla4_Ste20, Pleckstrin homology (PH) domain. Budding
yeast contain two main p21-activated kinases (PAKs),
Cla4 and Ste20. The yeast Ste20 protein kinase is
involved in pheromone response, though the function of
Ste20 mammalian homologs is unknown. Cla4 is involved in
budding and cytokinesis and interacts with Cdc42, a
GTPase required for polarized cell growth as is Pak.
Cla4 and Ste20 kinases share a function in localizing
cell growth with respect to the septin ring. They both
contain a PH domain, a Cdc42/Rac interactive binding
(CRIB) domain, and a C-terminal Protein Kinase catalytic
(PKc) domain. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 91
Score = 28.4 bits (64), Expect = 0.54
Identities = 20/89 (22%), Positives = 39/89 (43%), Gaps = 7/89 (7%)
Query: 63 HSGWLHKKSGRN----WKRYWFVLKDQVMYKYKASEDIKALLSIPVLGYELEALNEQDNF 118
SGW+ K W + + VL++Q + YK A LSIP+ ++ ++ D
Sbjct: 3 KSGWVSVKEDGLLSFRWSKRYLVLREQSLDFYKNESSSSASLSIPL--KDISNVSRTDLK 60
Query: 119 KYVFQLKHQGQDPLVFGA-DNEQSYERWM 146
Y F++ + ++ + ++ WM
Sbjct: 61 PYCFEIVRKSSTKSIYISVKSDDELYDWM 89
>gnl|CDD|241277 cd01244, PH_GAP1-like, RAS p21 protein activator (GTPase activating
protein) family pleckstrin homology (PH) domain.
RASAL1, GAP1(m), GAP1(IP4BP), and CAPRI are all members
of the GAP1 family of GTPase-activating proteins. They
contain N-terminal SH2-SH3-SH2 domains, followed by two
C2 domains, a PH domain, a RasGAP domain, and a BTK
domain. With the notable exception of GAP1(m), they all
possess an arginine finger-dependent GAP activity on the
Ras-related protein Rap1. They act as a suppressor of
RAS enhancing the weak intrinsic GTPase activity of RAS
proteins resulting in the inactive GDP-bound form of
RAS, allowing control of cellular proliferation and
differentiation. PH domains share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 107
Score = 28.8 bits (65), Expect = 0.61
Identities = 25/102 (24%), Positives = 46/102 (45%), Gaps = 16/102 (15%)
Query: 64 SGWLHKK--------SGRNWKRYWFVLKDQVMYKYKASEDIKALLSIPV---LGYELEAL 112
G+L K+ +N+K+ +F L ++ + Y S+ + L SIP+ L +E +
Sbjct: 2 EGYLIKRAQGRKGKLGRKNFKKRYFRLTNEAL-SYSKSKGSQPLCSIPLQDILA--VERV 58
Query: 113 NEQD-NFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREAT 153
+E+ K +FQ+ L A N W+ A+R+
Sbjct: 59 DEKSFKMKNMFQVVQP-DRTLYLQAKNVVELNEWLSALRKVC 99
>gnl|CDD|223848 COG0777, AccD, Acetyl-CoA carboxylase beta subunit [Lipid
metabolism].
Length = 294
Score = 28.4 bits (64), Expect = 1.6
Identities = 14/48 (29%), Positives = 26/48 (54%), Gaps = 3/48 (6%)
Query: 109 LEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREATTLS 156
LEAL ++ +F+ + +DPL F + + Y+ ++A R+ T L
Sbjct: 65 LEALLDEGSFEELDSPLEP-KDPLKFP--DSKKYKDRLEAARKKTGLD 109
>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate
transferase; Reviewed.
Length = 307
Score = 28.2 bits (64), Expect = 1.8
Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 11/32 (34%)
Query: 21 MDIIRSNFKEMGTAGRRKPSKKYRKYVPQRLI 52
MDI GTA KP+ + R VP LI
Sbjct: 44 MDI--------GTA---KPTAEERAGVPHHLI 64
>gnl|CDD|241401 cd13247, BAR-PH_APPL, Adaptor protein containing PH domain, PTB
domain, and Leucine zipper motif Bin1/amphiphysin/Rvs167
(BAR)-Pleckstrin homology (PH) domain. APPL (also
called DCC-interacting protein (DIP)-13alpha) interacts
with oncoprotein serine/threonine kinase AKT2, tumor
suppressor protein DCC (deleted in colorectal cancer),
Rab5, GIPC (GAIP-interacting protein, C terminus), human
follicle-stimulating hormone receptor (FSHR), and the
adiponectin receptors AdipoR1 and AdipoR2. There are two
isoforms of human APPL: APPL1 and APPL2, which share
about 50% sequence identity. APPL has a BAR and a PH
domain near its N terminus, and the two domains are
thought to function as a unit (BAR-PH domain).
C-terminal to this is a PTB domain. Lipid binding assays
show that the BAR, PH, and PTB domains can bind
phospholipids. PH domains have diverse functions, but in
general are involved in targeting proteins to the
appropriate cellular location or in the interaction with
a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH domains
bind phosphoinositide phosphates (PIPs) with high
affinity and specificity. PH domains are distinguished
from other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal phosphate
groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3
which results in targeting some PH domain proteins to
the plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 125
Score = 27.3 bits (61), Expect = 2.2
Identities = 22/100 (22%), Positives = 48/100 (48%), Gaps = 10/100 (10%)
Query: 56 ANDSGSQHSGWLHKKS-----GRNWKRYWF-VLKDQVMYKYKASEDIKALLSIPVLGYEL 109
N S +Q +G+L +S W R +F +M + + +++ L + + +
Sbjct: 22 PNRSLTQKAGYLFLRSKTGLVTNRWDRVYFFTQGGNLMSQPR--DEVAGSLVLDLDNTSV 79
Query: 110 EALNEQDNFKYVFQLKH-QGQDPLVFGADNEQSYERWMKA 148
+A + +D ++VFQ+ G+ +V A++E+ E W+
Sbjct: 80 QAADCEDR-RFVFQITSPDGKKAIVLQAESEKDREEWIAT 118
>gnl|CDD|241465 cd13311, PH_Slm1, Slm1 Pleckstrin homology (PH) domain. Slm1 is a
component of the target of rapamycin complex 2 (TORC2)
signaling pathway. It plays a role in the regulation of
actin organization and is a target of sphingolipid
signaling during the heat shock response. Slm1 contains
a single PH domain that binds PtdIns(4,5)P2, PtdIns(4)P,
and dihydrosphingosine 1-phosphate (DHS-1P). Slm1
possesses two binding sites for anionic lipids. The
non-canonical binding site of the PH domain of Slm1 is
used for ligand binding, and it is proposed that
beta-spectrin, Tiam1 and ArhGAP9 also have this type of
phosphoinositide binding site. PH domains have diverse
functions, but in general are involved in targeting
proteins to the appropriate cellular location or in the
interaction with a binding partner. They share little
sequence conservation, but all have a common fold, which
is electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 110
Score = 27.0 bits (60), Expect = 2.2
Identities = 23/107 (21%), Positives = 52/107 (48%), Gaps = 16/107 (14%)
Query: 63 HSGWLHKKSG--RNWKRYWFVLK-DQVMYKYKASEDIKA---LLSIPVLGYELEALNEQD 116
SG+L +KS +++ + ++VL ++++K+S+ K +S+ + L A +++
Sbjct: 5 ISGFLERKSKFLKSYSKGYYVLTPAGYLHEFKSSDRKKDPAPEMSLYLPECVLGAPSDEG 64
Query: 117 NFKYVFQLK---------HQGQDPLVFGADNEQSYERWMKAMREATT 154
+ F LK H+G + VF A++ + W + ++ T
Sbjct: 65 GKSHKFILKGKDVGSGKFHRGHE-WVFKAESHEEMMAWWEDIKTLTK 110
>gnl|CDD|241459 cd13305, PH_SHARPIN, SHANK-associated RH domain interacting protein
Pleckstrin homology (PH) domain. SHARPIN has a variety
of roles including: a role as a scaffolding partner of
anchoring/scaffold proteins Shank1, a role in
carcinogenesis through the interaction with FYN binding
protein (FYB), which binds to oncogene FYN, a role in
apoptosis by interacting with AIFM1, a mitochondrial
regulator of cell death, CAPN13, and NSD1, as well as a
role in immune disease and inflammation. SHARPIN has at
its N-terminus a PH domain, followed by a E3 ubiquitin
ligase domain, and a C-terminal RanBP-type and
C3HC4-type zinc finger containing 1 domain (RBCK1, also
known as HOIP which functions as a protein kinase C
(PKC) binding protein as well as a transcriptional
activator. SHARPIN's PH domain functions as a
dimerization module, rather than a ligand recognition
domain. Instead it acts as a dimerization module
extending the functional applications of this superfold.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 113
Score = 26.8 bits (59), Expect = 2.7
Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 4/34 (11%)
Query: 123 QLKHQGQDPLVFGADNEQSYERW----MKAMREA 152
Q D L F +EQ +RW M A+REA
Sbjct: 76 QPPKPPPDALSFHFRDEQEAQRWATVVMSALREA 109
>gnl|CDD|241478 cd13324, PH_Gab-like, Grb2-associated binding protein family
Pleckstrin homology (PH) domain. Gab proteins are
scaffolding adaptor proteins, which possess N-terminal
PH domains and a C-terminus with proline-rich regions
and multiple phosphorylation sites. Following
activation of growth factor receptors, Gab proteins are
tyrosine phosphorylated and activate PI3K, which
generates 3-phosphoinositide lipids. By binding to
these lipids via the PH domain, Gab proteins remain in
proximity to the receptor, leading to further
signaling. While not all Gab proteins depend on the PH
domain for recruitment, it is required for Gab
activity. There are 3 families: Gab1, Gab2, and Gab3.
PH domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from
other PIP-binding domains by their specific
high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 103
Score = 26.6 bits (59), Expect = 2.9
Identities = 10/27 (37%), Positives = 13/27 (48%), Gaps = 6/27 (22%)
Query: 63 HSGWL------HKKSGRNWKRYWFVLK 83
+ GWL K WK+ WFVL+
Sbjct: 1 YEGWLRKSPPEKKIKRAAWKKRWFVLR 27
>gnl|CDD|241405 cd13251, PH_ASAP, ArfGAP with SH3 domain, ankyrin repeat and PH
domain Pleckstrin homology (PH) domain. ASAPs (ASAP1,
ASAP2, and ASAP3) function as an Arf-specific GAPs,
participates in rhodopsin trafficking, is associated
with tumor cell metastasis, modulates phagocytosis,
promotes cell proliferation, facilitates vesicle
budding, Golgi exocytosis, and regulates vesicle coat
assembly via a Bin/Amphiphysin/Rvs domain. ASAPs contain
an NH2-terminal BAR domain, a tandem PH domain/GAP
domain, three ankyrin repeats, two proline-rich regions,
and a COOH-terminal Src homology 3 (SH3) domain. PH
domains have diverse functions, but in general are
involved in targeting proteins to the appropriate
cellular location or in the interaction with a binding
partner. They share little sequence conservation, but
all have a common fold, which is electrostatically
polarized. Less than 10% of PH domains bind
phosphoinositide phosphates (PIPs) with high affinity
and specificity. PH domains are distinguished from other
PIP-binding domains by their specific high-affinity
binding to PIPs with two vicinal phosphate groups:
PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which
results in targeting some PH domain proteins to the
plasma membrane. A few display strong specificity in
lipid binding. Any specificity is usually determined by
loop regions or insertions in the N-terminus of the
domain, which are not conserved across all PH domains.
PH domains are found in cellular signaling proteins such
as serine/threonine kinase, tyrosine kinases, regulators
of G-proteins, endocytotic GTPases, adaptors, as well as
cytoskeletal associated molecules and in lipid
associated enzymes.
Length = 108
Score = 26.6 bits (59), Expect = 3.4
Identities = 23/101 (22%), Positives = 44/101 (43%), Gaps = 17/101 (16%)
Query: 60 GSQHSGWLHKKS----GRNWKRYWFVLKDQVMYKYKASEDIKA----LLSIPVLGYELEA 111
G++ SG+L KKS + W++ +++ + + E+ LL+ V
Sbjct: 9 GTEKSGYLLKKSEGKLRKVWQKRRCSIRNGFLTISHSDENKPPVKLNLLTCQV------K 62
Query: 112 LNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
N +D K F L + F A++EQ E W+ ++ +
Sbjct: 63 PNPED--KKCFDLISHNR-TYHFQAEDEQEAEAWISVLQNS 100
>gnl|CDD|241285 cd01254, PH_PLD, Phospholipase D pleckstrin homology (PH) domain.
PLD hydrolyzes phosphatidylcholine to phosphatidic
acid (PtdOH), which can bind target proteins. PLD
contains a PH domain, a PX domain and four conserved
PLD signature domains. The PLD PH domain is specific
for bisphosphorylated inositides. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They
share little sequence conservation, but all have a
common fold, which is electrostatically polarized. Less
than 10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 134
Score = 26.5 bits (59), Expect = 4.5
Identities = 12/49 (24%), Positives = 19/49 (38%), Gaps = 20/49 (40%)
Query: 56 ANDSGSQH-SGWLHKKSGR-------------------NWKRYWFVLKD 84
A + G + G+L K+SG W + WF++KD
Sbjct: 18 APELGPKGKEGYLKKRSGGHRQGWRVCHFCCCCKSMCSRWSKRWFIVKD 66
>gnl|CDD|212511 cd09015, Ureohydrolase, Ureohydrolase superfamily includes
arginase, formiminoglutamase, agmatinase and
proclavaminate amidinohydrolase (PAH). This family,
also known as arginase-like amidino hydrolase family,
includes Mn-dependent enzymes: arginase (Arg, EC
3.5.3.1), formimidoylglutamase (HutG, EC 3.5.3.8 ),
agmatinase (SpeB, EC 3.5.3.11), guanidinobutyrase (Gbh,
EC=3.5.3.7), proclavaminate amidinohydrolase (PAH, EC
3.5.3.22) and related proteins. These enzymes catalyze
hydrolysis of amide bond. They are involved in control
of cellular levels of arginine and ornithine (both
involved in protein biosynthesis, and production of
creatine, polyamines, proline and nitric acid), in
histidine and arginine degradation, and in clavulanic
acid biosynthesis.
Length = 270
Score = 26.6 bits (59), Expect = 5.7
Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 1/41 (2%)
Query: 102 IPVLGYELEALNEQDNFKYVFQLKHQGQDPLVFGADNEQSY 142
I + G ELE +E+ V Q+ +G P+V G D+ +
Sbjct: 54 IRLEGDELEEAHEKLASV-VQQVLKRGAFPVVLGGDHSIAI 93
>gnl|CDD|241434 cd13280, PH_SIP3, Snf1p-interacting protein 3 Pleckstrin homology
(PH) domain. SIP3 interacts with SNF1 protein kinase
and activates transcription when anchored to DNA. It may
function in the SNF1 pathway. SIP3 contain an N-terminal
Bin/Amphiphysin/Rvs (BAR) domain followed by a PH
domain. BAR domains form dimers that bind to membranes,
induce membrane bending and curvature, and may also be
involved in protein-protein interactions. PH domains
have diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 105
Score = 25.7 bits (57), Expect = 6.9
Identities = 24/102 (23%), Positives = 40/102 (39%), Gaps = 18/102 (17%)
Query: 64 SGWLHKK--SGR----NWKRYWFVLKDQV--MYKYKAS-----EDIKALLSIPVLGYELE 110
SGWL+ K G+ W R W +K+ V M S E K VL +
Sbjct: 3 SGWLYMKTSVGKPNRTIWVRRWCFVKNGVFGMLSLSPSKTYVEETDK----FGVLLCNVR 58
Query: 111 ALNEQDNFKYVFQLKHQGQDPLVFGADNEQSYERWMKAMREA 152
E+D ++ F++K ++ A+ + + W+ A
Sbjct: 59 YAPEEDR-RFCFEVKIFKDISIILQAETLKELKSWLTVFENA 99
>gnl|CDD|241438 cd13284, PH_OSBP_ORP4, Human Oxysterol binding protein and
OSBP-related protein 4 Pleckstrin homology (PH) domain.
Human OSBP is proposed to function is sterol-dependent
regulation of ERK dephosphorylation and sphingomyelin
synthesis as well as modulation of insulin signaling
and hepatic lipogenesis. It contains a N-terminal PH
domain, a FFAT motif (two phenylalanines in an acidic
tract), and a C-terminal OSBP-related domain. OSBPs and
Osh1p PH domains specifically localize to the Golgi
apparatus in a PtdIns4P-dependent manner. ORP4 is
proposed to function in Vimentin-dependent sterol
transport and/or signaling. Human ORP4 has 2 forms, a
long (ORP4L) and a short (ORP4S). ORP4L contains a
N-terminal PH domain, a FFAT motif (two phenylalanines
in an acidic tract), and a C-terminal OSBP-related
domain. ORP4S is truncated and contains only an
OSBP-related domain. Oxysterol binding proteins are a
multigene family that is conserved in yeast, flies,
worms, mammals and plants. They all contain a
C-terminal oxysterol binding domain, and most contain
an N-terminal PH domain. OSBP PH domains bind to
membrane phosphoinositides and thus likely play an
important role in intracellular targeting. They are
members of the oxysterol binding protein (OSBP) family
which includes OSBP, OSBP-related proteins (ORP),
Goodpasture antigen binding protein (GPBP), and Four
phosphate adaptor protein 1 (FAPP1). They have a wide
range of purported functions including sterol
transport, cell cycle control, pollen development and
vessicle transport from Golgi recognize both PI lipids
and ARF proteins. PH domains have diverse functions,
but in general are involved in targeting proteins to
the appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 99
Score = 25.4 bits (56), Expect = 7.4
Identities = 10/30 (33%), Positives = 18/30 (60%), Gaps = 2/30 (6%)
Query: 64 SGWLHKKSG--RNWKRYWFVLKDQVMYKYK 91
GWL K + + ++R WFVL + ++ Y+
Sbjct: 2 KGWLLKWTNYLKGYQRRWFVLSNGLLSYYR 31
>gnl|CDD|183285 PRK11712, PRK11712, ribonuclease G; Provisional.
Length = 489
Score = 26.1 bits (58), Expect = 8.3
Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 2/28 (7%)
Query: 108 ELEALNEQDNF--KYVFQLKHQGQDPLV 133
E A EQ F + + +L QGQD +V
Sbjct: 78 ECVAGEEQKQFVVRDISELVRQGQDIMV 105
>gnl|CDD|241297 cd01266, PH_Gab1_Gab2, Grb2-associated binding proteins 1 and 2
pleckstrin homology (PH) domain. The Gab subfamily
includes several Gab proteins, Drosophila DOS and C.
elegans SOC-1. They are scaffolding adaptor proteins,
which possess N-terminal PH domains and a C-terminus
with proline-rich regions and multiple phosphorylation
sites. Following activation of growth factor receptors,
Gab proteins are tyrosine phosphorylated and activate
PI3K, which generates 3-phosphoinositide lipids. By
binding to these lipids via the PH domain, Gab proteins
remain in proximity to the receptor, leading to further
signaling. While not all Gab proteins depend on the PH
domain for recruitment, it is required for Gab
activity. The members in this cd include the Gab1 and
Gab2 proteins. PH domains have diverse functions, but
in general are involved in targeting proteins to the
appropriate cellular location or in the interaction
with a binding partner. They share little sequence
conservation, but all have a common fold, which is
electrostatically polarized. Less than 10% of PH
domains bind phosphoinositide phosphates (PIPs) with
high affinity and specificity. PH domains are
distinguished from other PIP-binding domains by their
specific high-affinity binding to PIPs with two vicinal
phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or
PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved
across all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 123
Score = 25.7 bits (56), Expect = 8.3
Identities = 11/26 (42%), Positives = 13/26 (50%), Gaps = 6/26 (23%)
Query: 64 SGWLHKKSGRN------WKRYWFVLK 83
SGWL K WK+ WFVL+
Sbjct: 7 SGWLRKSPPEKKLRRYAWKKRWFVLR 32
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional.
Length = 607
Score = 26.2 bits (58), Expect = 8.5
Identities = 14/48 (29%), Positives = 27/48 (56%), Gaps = 5/48 (10%)
Query: 105 LGYELEALNEQDNFKYVFQLKHQGQDPL-VFGADNEQSYERWMKAMRE 151
+GY +E L +N + ++ G D L V+G ++S+E W+ +R+
Sbjct: 432 MGYVVEVLRGANNQR----IRDYGHDKLKVYGIGRDKSHEHWVSVIRQ 475
>gnl|CDD|199870 cd06250, M14_PaAOTO_like, Peptidase M14 Succinylglutamate
desuccinylase (ASTE)/aspartoacylase (ASPA)-like
subfamily; subgroup includes Pseudomonas aeruginosa
AotO. An uncharacterized subgroup of the
Succinylglutamate desuccinylase (ASTE)/aspartoacylase
(ASPA) subfamily which is part of the the M14 family of
metallocarboxypeptidases. This subgroup includes
Pseudomonas aeruginosa AotO and related proteins. ASTE
catalyzes the fifth and last step in arginine catabolism
by the arginine succinyltransferase pathway, and
aspartoacylase (ASPA, also known as aminoacylase 2, and
ACY-2; EC:3.5.1.15) cleaves N-acetyl L-aspartic acid
(NAA) into aspartate and acetate. NAA is abundant in the
brain, and hydrolysis of NAA by ASPA may help maintain
white matter. ASPA is an NAA scavenger in other tissues.
Mutations in the gene encoding ASPA cause Canavan
disease (CD), a fatal progressive neurodegenerative
disorder involving dysmyelination and spongiform
degeneration of white matter in children. This enzyme
binds zinc which is necessary for activity. Measurement
of elevated NAA levels in urine is used in the diagnosis
of CD. The gene encoding P. aeruginosa AotO was
characterized as part of an operon encoding an arginine
and ornithine transport system, however it is not
essential for arginine and ornithine uptake.
Length = 359
Score = 26.1 bits (58), Expect = 9.2
Identities = 9/28 (32%), Positives = 12/28 (42%)
Query: 59 SGSQHSGWLHKKSGRNWKRYWFVLKDQV 86
G H G +G N+ R + L D V
Sbjct: 82 LGGFHLGRFDLATGTNFNRNFPDLADAV 109
>gnl|CDD|241256 cd01221, PH_ephexin, Ephexin Pleckstrin homology (PH) domain.
Ephexin-1 (also called NGEF/ neuronal guanine nucleotide
exchange factor) plays a role in the homeostatic
modulation of presynaptic neurotransmitter release.
Specific functions are still unknown for Ephexin-2 (also
called RhoGEF19) and Ephexin-3 (also called Rho guanine
nucleotide exchange factor 5/RhoGEF5, Transforming
immortalized mammary oncogene/p60 TIM, and
NGEF/neuronalGEF). Ephexin-4 (also called RhoGEF16) acts
downstream of EphA2 to promote ligand-independent breast
cancer cell migration and invasion toward epidermal
growth factor through activation of RhoG. This in turn
results in the activation of RhoG which recruits ELMO2
and Dock4 to form a complex with EphA2 at the tips of
cortactin-rich protrusions in migrating breast cancer
cells. Ephexin-5 is the specific GEF for RhoA activation
and the regulation of vascular smooth muscle
contractility. It interacts with EPHA4 PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. The
members of the Ephexin family contains a RhoGEF (DH)
followed by a PH domain and an SH3 domain. The ephexin
PH domain is believed to act with the DH domain in
mediating protein-protein interactions. PH domains have
diverse functions, but in general are involved in
targeting proteins to the appropriate cellular location
or in the interaction with a binding partner. They share
little sequence conservation, but all have a common
fold, which is electrostatically polarized. Less than
10% of PH domains bind phosphoinositide phosphates
(PIPs) with high affinity and specificity. PH domains
are distinguished from other PIP-binding domains by
their specific high-affinity binding to PIPs with two
vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2
or PtdIns(3,4,5)P3 which results in targeting some PH
domain proteins to the plasma membrane. A few display
strong specificity in lipid binding. Any specificity is
usually determined by loop regions or insertions in the
N-terminus of the domain, which are not conserved across
all PH domains. PH domains are found in cellular
signaling proteins such as serine/threonine kinase,
tyrosine kinases, regulators of G-proteins, endocytotic
GTPases, adaptors, as well as cytoskeletal associated
molecules and in lipid associated enzymes.
Length = 130
Score = 25.3 bits (56), Expect = 10.0
Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 5/46 (10%)
Query: 110 EALNEQDNFKYVFQLK----HQG-QDPLVFGADNEQSYERWMKAMR 150
+ L Q + K +F L H+G L+ A++E ERW+ A+
Sbjct: 79 DPLPLQGSGKNLFLLTLLENHEGKTVELLLSAESESDRERWISALS 124
Database: CDD.v3.10
Posted date: Mar 20, 2013 7:55 AM
Number of letters in database: 10,937,602
Number of sequences in database: 44,354
Lambda K H
0.317 0.131 0.390
Gapped
Lambda K H
0.267 0.0618 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 7,874,539
Number of extensions: 691102
Number of successful extensions: 791
Number of sequences better than 10.0: 1
Number of HSP's gapped: 745
Number of HSP's successfully gapped: 104
Length of query: 156
Length of database: 10,937,602
Length adjustment: 89
Effective length of query: 67
Effective length of database: 6,990,096
Effective search space: 468336432
Effective search space used: 468336432
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.2 bits)