BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy2215
         (172 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1V3W|A Chain A, Structure Of Ferripyochelin Binding Protein From
           Pyrococcus Horikoshii Ot3
 pdb|1V67|A Chain A, Structure Of Ferripyochelin Binding Protein From
           Pyrococcus Horikoshii Ot3
 pdb|2FKO|A Chain A, Structure Of Ph1591 From Pyrococcus Horikoshii Ot3
          Length = 173

 Score = 28.1 bits (61), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 72  VSRKSLVAGAQNIVLTGKVIIQCDAVLRGDLANIRTGRYCIISKGVVIR 120
           V   ++V G  ++VL  K  +   AVLRGD+  I  G+Y  +   V I 
Sbjct: 19  VDENAVVIG--DVVLEEKTSVWPSAVLRGDIEQIYVGKYSNVQDNVSIH 65


>pdb|1E6V|B Chain B, Methyl-Coenzyme M Reductase From Methanopyrus Kandleri
 pdb|1E6V|E Chain E, Methyl-Coenzyme M Reductase From Methanopyrus Kandleri
          Length = 443

 Score = 27.7 bits (60), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 6   IYYDRDSYVETVSSGQRCLLANTNRRVWVQSQP 38
           +Y D D+ VE +  G+R L+   + RV V + P
Sbjct: 96  VYQDDDTNVEPMYDGKRLLVQLPSERVKVMADP 128


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.136    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,924,082
Number of Sequences: 62578
Number of extensions: 176409
Number of successful extensions: 399
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 396
Number of HSP's gapped (non-prelim): 6
length of query: 172
length of database: 14,973,337
effective HSP length: 92
effective length of query: 80
effective length of database: 9,216,161
effective search space: 737292880
effective search space used: 737292880
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 48 (23.1 bits)