Diaphorina citri psyllid: psy2219


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MAKSTIAKLKSLYKKVDDIDLIVGGIAEVAQDGAIVGPTFRCILAEQFIRTRAGDRFFYDNPGQPSSFTKQLYSP
ccHHHHHHHHHHHcccccccHHHHHHcccccccccccHHHHHHHHHHHHHHHcccccEEEcccccccccHHHccc
***STIAKLKSLYKKVDDIDLIVGGIAEVAQDGAIVGPTFRCILAEQFIRTRAGDRFFYDNPGQPSSFT******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSTIAKLKSLYKKVDDIDLIVGGIAEVAQDGAIVGPTFRCILAEQFIRTRAGDRFFYDNPGQPSSFTKQLYSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxinectin A confidentQ6TMK4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042600 [CC]chorionprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0004096 [MF]catalase activityprobableGO:0016209, GO:0003824, GO:0003674, GO:0016684, GO:0004601, GO:0016491
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0042743 [BP]hydrogen peroxide metabolic processprobableGO:0008152, GO:0009987, GO:0008150, GO:0044237, GO:0072593
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q9K, chain A
Confidence level:very confident
Coverage over the Query: 2-74
View the alignment between query and template
View the model in PyMOL