RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2231
         (201 letters)



>gnl|CDD|188785 cd09401, LIM_TLP_like, The  LIM domains of thymus LIM protein
          (TLP).  The LIM domain of thymus LIM protein (TLP) like
          proteins:  This family includes the LIM domains of TLP
          and CRIP (Cysteine-Rich Intestinal Protein). TLP is the
          distant member of the CRP family of proteins. TLP has
          two isomers (TLP-A and TLP-B) and sharing approximately
          30% with each of the three other CRPs.  Like CRP1, CRP2
          and CRP3/MLP, TLP has two LIM domains, connected by a
          flexible linker region. Unlike the CRPs, TLP lacks the
          nuclear targeting signal (K/R-K/R-Y-G-P-K) and is
          localized solely in the cytoplasm. TLP is specifically
          expressed in the thymus in a subset of cortical
          epithelial cells.  TLP has a role in development of
          normal thymus and in controlling the development and
          differentiation of thymic epithelial cells. CRIP is a
          short LIM protein with only one LIM domain. CRIP gene
          is developmentally regulated and can be induced by
          glucocorticoid hormones during the first three
          postnatal weeks. The domain shows close sequence
          homology to LIM domain of thymus LIM protein. However,
          unlike the TLP proteins which have two LIM domains, the
          members of this family have only one LIM domain. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 89.3 bits (222), Expect = 6e-24
 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 1/46 (2%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          Y AE+KTSLG+DWH  CLRCE C KTL PG HSEH+GKPYCN  CY
Sbjct: 9  YFAEKKTSLGRDWHKPCLRCEKCKKTLTPGQHSEHEGKPYCN-KCY 53


>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal
          Protein (CRIP).  The LIM domain of Cysteine-Rich
          Intestinal Protein (CRIP): CRIP is a short protein with
          only one LIM domain. CRIP gene is developmentally
          regulated and can be induced by glucocorticoid hormones
          during the first three postnatal weeks. The domain
          shows close sequence homology to LIM domain of thymus
          LIM protein. However, unlike the TLP proteins which
          have two LIM domains, the members of this family have
          only one LIM domain. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 89.2 bits (221), Expect = 6e-24
 Identities = 36/47 (76%), Positives = 40/47 (85%)

Query: 51 MYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +Y AER TSLGKDWH  CL+CE C KTL PGSH+EHDGKPYCN+PCY
Sbjct: 8  VYFAERVTSLGKDWHRPCLKCEKCGKTLTPGSHAEHDGKPYCNHPCY 54


>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein
          (TLP).  The first LIM domain of thymus LIM protein
          (TLP):  TLP is the distant member of the CRP family of
          proteins. TLP has two isomers (TLP-A and TLP-B) and
          sharing approximately 30% with each of the three other
          CRPs.  Like CRP1, CRP2 and CRP3/MLP, TLP has two LIM
          domains, connected by a flexible linker region. Unlike
          the CRPs, TLP lacks the nuclear targeting signal
          (K/R-K/R-Y-G-P-K) and is localized solely in the
          cytoplasm. TLP is specifically expressed in the thymus
          in a subset of cortical epithelial cells.  TLP has a
          role in development of normal thymus and in controlling
          the development and differentiation of thymic
          epithelial cells. LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 77.7 bits (191), Expect = 2e-19
 Identities = 30/48 (62%), Positives = 39/48 (81%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++Y AE+ +SLGK+WH  CL+CE C+K L PG H+EHDGKPYC+ PCY
Sbjct: 7  TVYFAEKVSSLGKNWHRFCLKCERCSKILSPGGHAEHDGKPYCHKPCY 54


>gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein
          (TLP).  The second LIM domain of thymus LIM protein
          (TLP):  TLP is the distant member of the CRP family of
          proteins. TLP has two isomers (TLP-A and TLP-B) and
          sharing approximately 30% with each of the three other
          CRPs.  Like CRP1, CRP2 and CRP3/MLP, TLP has two LIM
          domains, connected by a flexible linker region. Unlike
          the CRPs, TLP lacks the nuclear targeting signal
          (K/R-K/R-Y-G-P-K) and is localized solely in the
          cytoplasm. TLP is specifically expressed in the thymus
          in a subset of cortical epithelial cells. TLP has a
          role in development of normal thymus and in controlling
          the development and differentiation of thymic
          epithelial cells. LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 54

 Score = 75.0 bits (184), Expect = 2e-18
 Identities = 28/47 (59%), Positives = 35/47 (74%)

Query: 51 MYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +Y AE+  SLG++WH  CLRC+ C KTL  G H+EHDG PYC+ PCY
Sbjct: 8  VYFAEKVMSLGRNWHRPCLRCQRCKKTLTAGGHAEHDGSPYCHVPCY 54


>gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein
          (CRP) family.  The LIM domains of Cysteine Rich Protein
          (CRP) family: Cysteine-rich proteins (CRPs) are
          characterized by the presence of two LIM domains linked
          to a short glycine-rich repeats (GRRs). The known CRP
          family members include CRP1, CRP2, and CRP3/MLP. CRP1,
          CRP2 and CRP3 share a conserved nuclear targeting
          signal (K/R-K/R-Y-G-P-K), which supports the fact that
          these proteins function not only in the cytoplasm but
          also in the nucleus. CRPs control regulatory pathways
          during cellular differentiation, and involve in complex
          transcription control, and the organization as well as
          the arrangement of the myofibrillar/cytoskeletal
          network. CRP1, CRP2, and CRP3/MLP are involved in
          promoting protein assembly along the actin-based
          cytoskeleton. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 56.8 bits (138), Expect = 2e-11
 Identities = 23/48 (47%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          S+Y AE   + GK WH SC  C  CNK L   + +EHDG+ YC   CY
Sbjct: 7  SVYAAEEVIAAGKSWHKSCFTCAVCNKRLDSTTLAEHDGEIYCK-SCY 53


>gnl|CDD|215907 pfam00412, LIM, LIM domain.  This family represents two copies of
           the LIM structural domain.
          Length = 58

 Score = 52.3 bits (126), Expect = 8e-10
 Identities = 22/45 (48%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 57  KTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALF 101
           + +LGK WH  C RC  C K L PG   E DGK YC +  Y  LF
Sbjct: 15  RRALGKVWHPECFRCAVCGKPLGPGDFFEKDGKLYCKH-DYFKLF 58


>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1,
          Mec-3.  Zinc-binding domain family. Some LIM domains
          bind protein partners via tyrosine-containing motifs.
          LIM domains are found in many key regulators of
          developmental pathways.
          Length = 54

 Score = 47.8 bits (114), Expect = 4e-08
 Identities = 16/35 (45%), Positives = 19/35 (54%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
           +LGK WH  C +C  C K L   +  E DGK YC
Sbjct: 17 RALGKVWHPECFKCATCGKPLSGDTFFEKDGKLYC 51


>gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule
          interacting with CasL) like family.  The LIM domain of
          Mical (molecule interacting with CasL) like family:
          Known members of this family includes  LIM domain
          containing proteins; Mical (molecule interacting with
          CasL), pollen specific protein SF3, Eplin, xin
          actin-binding repeat-containing protein 2 (XIRP2) and
          Ltd-1. The members of this family function mainly at
          the cytoskeleton and focal adhesions. They interact
          with transcription factors or other signaling molecules
          to play roles in muscle development, neuronal
          differentiation, cell growth and mobility.  Eplin has
          also found to be tumor suppressor. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs..
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 47.6 bits (114), Expect = 5e-08
 Identities = 20/41 (48%), Positives = 27/41 (65%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          Y  ER  + GK +H SC RC +CNKTL  G+++  +GK YC
Sbjct: 9  YPMERLVADGKLFHKSCFRCSHCNKTLRLGNYASLEGKLYC 49


>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain,
          containing two zinc fingers.  LIM domains are
          identified in a diverse group of proteins with wide
          variety of biological functions, including gene
          expression regulation, cell fate determination,
          cytoskeleton organization, tumor formation and
          development. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes. They perform their functions through
          interactions with other protein partners. LIM domains
          are 50-60 amino acids in size and share two
          characteristic highly conserved zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. The consensus sequence of LIM
          domain has been defined as
          C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
          21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 53

 Score = 46.9 bits (112), Expect = 7e-08
 Identities = 21/43 (48%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 55 ERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          E   +LGK WH  C +C  C K L   S  E DGKPYC   CY
Sbjct: 12 ELLRALGKKWHPECFKCSVCGKPLGGDSFYEKDGKPYCE-KCY 53


>gnl|CDD|188871 cd09840, LIM2_CRP2, The second LIM domain of Cysteine Rich
          Protein 2 (CRP2).  The second LIM domain of Cysteine
          Rich Protein 2 (CRP2):  Cysteine-rich proteins (CRPs)
          are characterized by the presence of two LIM domains
          linked to short glycine-rich repeats (GRRs). The CRP
          family members include CRP1, CRP2, CRP3/MLP and
          TLPCRP1, CRP2 and CRP3 share a conserved nuclear
          targeting signal (K/R-K/R-Y-G-P-K), which supports the
          fact that these proteins function not only in the
          cytoplasm but also in the nucleus. CRPs control
          regulatory pathways during cellular differentiation,
          and involve in complex transcription circuits, and the
          organization as well as the arrangement of the
          myofibrillar/cytoskeletal network.CRP3 also called
          Muscle LIM Protein (MLP), which is a striated
          muscle-specific factor that enhances myogenic
          differentiation. The second LIM domain of CRP3/MLP
          interacts with cytoskeletal protein beta-spectrin.
          CRP3/MLP also interacts with the basic helix-loop-helix
          myogenic transcription factors MyoD, myogenin, and MRF4
          thereby increasing their affinity for specific DNA
          regulatory elements. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 46.3 bits (109), Expect = 1e-07
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 49 NSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYS 98
          +S+Y AE+    GK WH +C RC  C K+L   + +E +G+ YC   CY+
Sbjct: 6  DSVYAAEKIMGAGKPWHKNCFRCAKCGKSLESTTLTEKEGEIYCK-GCYA 54


>gnl|CDD|188788 cd09404, LIM1_MLP84B_like, The LIM domain of Mlp84B and Mlp60A.
          The LIM domain of Mlp84B and Mlp60A: Mlp84B and Mlp60A
          belong to the CRP LIM domain protein family. The Mlp84B
          protein contains five copies of the LIM domains, each
          followed by a Glycin Rich Region (GRR). However, only
          the first LIM domain of Mlp84B is in this family.
          Mlp60A exhibits only one LIM domain linked to a
          glycin-rich region. Mlp84B and Mlp60A are muscle
          specific proteins and have been implicated in muscle
          differentiation. While Mlp84B transcripts are enriched
          at the terminal ends of muscle fibers, Mlp60A
          transcripts are found throughout the muscle fibers. All
          LIM domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 45.9 bits (109), Expect = 2e-07
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          S+Y AE + + G  WH  C +C  CNK L   + +EH+G+ YC   C+
Sbjct: 8  SVYAAEERLAGGYKWHKMCFKCGMCNKLLDSTNCAEHEGELYCK-QCH 54


>gnl|CDD|188787 cd09403, LIM2_CRP, The second LIM domain of Cysteine Rich Protein
          (CRP).  The second LIM domain of Cysteine Rich Protein
          (CRP): Cysteine-rich proteins (CRPs) are characterized
          by the presence of two LIM domains linked to a short
          glycine-rich repeats (GRRs). The CRP family members
          include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
          a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
          which supports the fact that these proteins function
          not only in the cytoplasm but also in the nucleus. CRPs
          control regulatory pathways during cellular
          differentiation, and involve in complex transcription
          control, and the organization as well as the
          arrangement of the myofibrillar/cytoskeletal network.
          It is evident that CRP1, CRP2, and CRP3/MLP are
          involved in promoting protein assembly along the
          actin-based cytoskeleton. Although members of the CRP
          family share common binding partners, they are also
          capable of recognizing different and specific targets.
          LIM domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residu es, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 44.9 bits (106), Expect = 4e-07
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYS 98
          S+Y AE+    GK WH +C RC  C K+L   + ++ DG+ YC   CY+
Sbjct: 7  SVYAAEKIIGAGKPWHKNCFRCAKCGKSLESTTLADKDGEIYCK-GCYA 54


>gnl|CDD|188866 cd09482, LIM2_CRP3, The second LIM domain of Cysteine Rich
          Protein 3 (CRP3/MLP).  The second LIM domain of
          Cysteine Rich Protein 3 (CRP3/MLP):  Cysteine-rich
          proteins (CRPs) are characterized by the presence of
          two LIM domains linked to short glycine-rich repeats
          (GRRs). The CRP family members include CRP1, CRP2,
          CRP3/MLP and TLPCRP1, CRP2 and CRP3 share a conserved
          nuclear targeting signal (K/R-K/R-Y-G-P-K), which
          supports the fact that these proteins function not only
          in the cytoplasm but also in the nucleus. CRPs control
          regulatory pathways during cellular differentiation,
          and involve in complex transcription circuits, and the
          organization as well as the arrangement of the
          myofibrillar/cytoskeletal network.CRP3 also called
          Muscle LIM Protein (MLP), which is a striated
          muscle-specific factor that enhances myogenic
          differentiation. The second LIM domain of CRP3/MLP
          interacts with cytoskeletal protein beta-spectrin.
          CRP3/MLP also interacts with the basic helix-loop-helix
          myogenic transcription factors MyoD, myogenin, and MRF4
          thereby increasing their affinity for specific DNA
          regulatory elements. LIM domains are 50-60 amino acids
          in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 43.1 bits (101), Expect = 2e-06
 Identities = 20/49 (40%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYS 98
          S+Y AE+    GK WH +C RC  C K+L   + ++ DG+ YC   CY+
Sbjct: 7  SVYAAEKVMGGGKPWHKTCFRCAICGKSLESTTVTDKDGELYCKV-CYA 54


>gnl|CDD|188829 cd09445, LIM_Mical_like_2, This domain belongs to the LIM domain
          family which are found on Mical (molecule interacting
          with CasL) like proteins.  The LIM domain on proteins
          of unknown function: This domain belongs to the LIM
          domain family which are found on Mical (molecule
          interacting with CasL)-like proteins. Known members of
          the Mical-like family includes single LIM domain
          containing proteins, Mical (molecule interacting with
          CasL), pollen specific protein SF3, Eplin, xin
          actin-binding repeat-containing protein 2 (XIRP2), and
          Ltd-1. The members of this family function mainly at
          the cytoskeleton and focal adhesions. They interact
          with transcription factors or other signaling molecules
          to play roles in muscle development, neuronal
          differentiation, cell growth, and mobility.  As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 53

 Score = 41.3 bits (97), Expect = 1e-05
 Identities = 12/30 (40%), Positives = 19/30 (63%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYCN 93
          +H +C RC++CNK L   ++  H+G  YC 
Sbjct: 21 YHKNCFRCKDCNKQLKVDNYQSHEGNLYCK 50


>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein
          (LASP)-like proteins.  The LIM domain of LIM and SH3
          Protein (LASP) like proteins:  This family contains two
          types of LIM containing proteins; LASP and N-RAP. LASP
          family contains two highly homologous members, LASP-1
          and LASP-2. LASP contains a LIM motif at its amino
          terminus, a src homology 3 (SH3) domains at its
          C-terminal part, and a nebulin-like region in the
          middle. LASP-1 and -2 are highly conserved in their
          LIM, nebulin-like, and SH3 domains, but differ
          significantly at their linker regions. Both proteins
          are ubiquitously expressed and involved in cytoskeletal
          architecture, especially in the organization of focal
          adhesions. LASP-1 and LASP-2, are important during
          early embryo- and fetogenesis and are highly expressed
          in the central nervous system of the adult. However,
          only LASP-1 seems to participate significantly in
          neuronal differentiation and plays an important
          functional role in migration and proliferation of
          certain cancer cells while the role of LASP-2 is more
          structural. The expression of LASP-1 in breast tumors
          is increased significantly.  N-RAP is a muscle-specific
          protein concentrated at myotendinous junctions in
          skeletal muscle and intercalated disks in cardiac
          muscle. LIM domain is found at the N-terminus of N-RAP
          and the C-terminal of N-RAP contains a region with
          multiple of nebulin repeats. N-RAP functions as a
          scaffolding protein that organizes alpha-actinin and
          actin into symmetrical I-Z-I structures in developing
          myofibrils. Nebulin repeat is known as actin binding
          domain. The N-RAP is hypothesized to form antiparallel
          dimerization via its LIM domain. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 41.1 bits (96), Expect = 1e-05
 Identities = 17/43 (39%), Positives = 23/43 (53%)

Query: 51 MYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCN 93
          +Y  E+   L K WH +C  CE C  TL   ++  +  KPYCN
Sbjct: 8  VYPTEKVNCLDKTWHKACFHCEVCKMTLNMNNYKGYQKKPYCN 50


>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein
           SF3.  The first Lim domain of pollen specific protein
           SF3: SF3 is a Lim protein that is found exclusively in
           mature plant pollen grains. It contains two LIM domains.
           The exact function of SF3 is unknown. It may be a
           transcription factor required for the expression of late
           pollen genes. It is possible that SF3 protein is
           involved in controlling pollen-specific processes such
           as male gamete maturation, pollen tube formation, or
           even fertilization. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 63

 Score = 40.9 bits (96), Expect = 2e-05
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 50  SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALFSE 103
           ++YL ++ ++ G  +H SC RC +C  TL   ++S  +G  YC  P +  LF E
Sbjct: 11  TVYLVDQLSADGVVYHKSCFRCSHCKGTLKLSNYSSMEGVLYCK-PHFEQLFKE 63


>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM
          (abLIM) proteins.  The third LIM domain of actin
          binding LIM (abLIM) proteins: Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 40.0 bits (94), Expect = 3e-05
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 1/33 (3%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L K WH  C +C+ C K L  G +   DGKPYC
Sbjct: 17 LDKQWHVWCFKCKECGKVL-TGEYMGKDGKPYC 48


>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin
          like protein family.  The third LIM domain of the
          paxillin like protein family: This family consists of
          paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 39.6 bits (93), Expect = 4e-05
 Identities = 15/35 (42%), Positives = 20/35 (57%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          ++L   WH  C  C  C+K  + GS  EH+G PYC
Sbjct: 14 SALNTQWHPECFVCRECHKPFINGSFFEHEGLPYC 48


>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP). 
          The LIM domain of LIM and SH3 Protein (LASP):  LASP
          family contains two highly homologous members, LASP-1
          and LASP-2. LASP contains a LIM motif at its amino
          terminus, a src homology 3 (SH3) domains at its
          C-terminal part, and a nebulin-like region in the
          middle. LASP-1 and -2 are highly conserved in their
          LIM, nebulin-like, and SH3 domains ,but differ
          significantly at their linker regions. Both proteins
          are ubiquitously expressed and involved in cytoskeletal
          architecture, especially in the organization of focal
          adhesions. LASP-1 and LASP-2, are important during
          early embryo- and fetogenesis and are highly expressed
          in the central nervous system of the adult. However,
          only LASP-1 seems to participate significantly in
          neuronal differentiation and plays an important
          functional role in migration and proliferation of
          certain cancer cells while the role of LASP-2 is more
          structural. The expression of LASP-1 in breast tumors
          is increased significantly. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 38.9 bits (91), Expect = 6e-05
 Identities = 17/42 (40%), Positives = 23/42 (54%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCN 93
          Y  E+   L K WH  C +CE C  TL   ++  ++ KPYCN
Sbjct: 9  YPTEKLNCLDKIWHKGCFKCEVCGMTLNMKNYKGYNKKPYCN 50


>gnl|CDD|188830 cd09446, LIM_N_RAP, The LIM domain of N-RAP.  The LIM domain of
          N-RAP:  N-RAP is a muscle-specific protein concentrated
          at myotendinous junctions in skeletal muscle and
          intercalated disks in cardiac muscle. LIM domain is
          found at the N-terminus of N-RAP and the C-terminal of
          N-RAP contains a region with multiple of nebulin
          repeats. N-RAP functions as a scaffolding protein that
          organizes alpha-actinin and actin into symmetrical
          I-Z-I structures in developing myofibrils. Nebulin
          repeat is known as actin binding domain. The N-RAP is
          hypothesized to form antiparallel dimerization via its
          LIM domain. As in other LIM domains, this domain family
          is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 39.1 bits (91), Expect = 6e-05
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          Y AE+   + + WH +C  CE C   L   +   H  KPYC
Sbjct: 9  YPAEKINCIDQTWHKACFHCEVCKMMLTVNNFVSHQKKPYC 49


>gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting
          with CasL).  The LIM domain of Mical (molecule
          interacting with CasL): MICAL is a large, multidomain,
          cytosolic protein with a single LIM domain, a calponin
          homology (CH) domain and a flavoprotein monooxygenase
          domain. In Drosophila, MICAL is expressed in axons,
          interacts with the neuronal A (PlexA)  receptor and is
          required for Semapho-rin 1a (Sema-1a)-PlexA-mediated
          repulsive axon guidance.  The LIM domain and calporin
          homology domain are known for interactions with the
          cytoskeleton, cytoskeletal adaptor proteins, and other
          signaling proteins. The flavoprotein monooxygenase (MO)
          is required for semaphorin-plexin repulsive axon
          guidance during axonal pathfinding in the Drosophila
          neuromuscular system. In addition, MICAL was
          characterized to interact with Rab13 and Rab8 to
          coordinate the assembly of tight junctions and adherens
          junctions in epithelial cells. Thus, MICAL was also
          named junctional Rab13-binding protein (JRAB). As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 55

 Score = 38.8 bits (91), Expect = 7e-05
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHS--EHDGKPYC 92
          Y+ ER ++ G  +H SC +C  C  TL  G+++    DGK YC
Sbjct: 9  YVMERLSAEGLFFHRSCFKCSYCGTTLRLGAYAFDRDDGKFYC 51


>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH.  The
          fourth LIM domain of protein PINCH: PINCH plays a
          pivotal role in the assembly of focal adhesions (FAs),
          regulating diverse functions in cell adhesion, growth,
          and differentiation through LIM-mediated
          protein-protein interactions. PINCH comprises an array
          of five LIM domains that interact with integrin-linked
          kinase (ILK), Nck2 (also called Nckbeta or Grb4) and
          other interaction partners. These interactions are
          essential for triggering the FA assembly and for
          relaying diverse mechanical and biochemical signals
          between Cell-extracellular matrix and the actin
          cytoskeleton.  The PINCH LIM4 domain recognizes the
          third SH3 domain of another adaptor protein, Nck2. This
          step is an important component of integrin signaling
          event. LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assem bly of multimeric
          protein complexes.
          Length = 54

 Score = 38.5 bits (90), Expect = 1e-04
 Identities = 14/35 (40%), Positives = 16/35 (45%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T+LGK WH     C  C K  +   H E  G  YC
Sbjct: 16 TALGKHWHVEHFVCAKCEKPFLGHRHYEKKGLAYC 50


>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM
          domains protein (FHL).  The second LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 int eracts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 38.4 bits (90), Expect = 1e-04
 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          GK WH  C  C  C K +   S    D K YC  PCY
Sbjct: 19 GKFWHEKCFTCSECKKPIGTKSFIPKDDKIYCV-PCY 54


>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin.  The
          third LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 37.5 bits (87), Expect = 2e-04
 Identities = 16/35 (45%), Positives = 19/35 (54%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          ++L   WH  C  C  C    V GS  EHDG+PYC
Sbjct: 14 SALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYC 48


>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the
          paxillin like protein family.  The second LIM domain of
          the paxillin like protein family: This family consists
          of paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 37.0 bits (86), Expect = 3e-04
 Identities = 15/35 (42%), Positives = 16/35 (45%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T+L K WH     C  C K        E DGKPYC
Sbjct: 14 TALDKTWHPEHFFCAQCGKPFGDEGFHEKDGKPYC 48


>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin
          like protein family.  The first LIM domain of the
          paxillin like protein family: This family consists of
          paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 36.9 bits (86), Expect = 4e-04
 Identities = 15/35 (42%), Positives = 18/35 (51%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T+LGK WH     C  C   L   +  E DG+PYC
Sbjct: 14 TALGKTWHPEHFVCAECKTELGTKNFFERDGQPYC 48


>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1.  The Lim domain of DA1:
          DA1 contains one copy of LIM domain and a domain of
          unknown function. DA1 is predicted as an ubiquitin
          receptor, which sets final seed and organ size by
          restricting the period of cell proliferation. The LIM
          domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 36.1 bits (84), Expect = 6e-04
 Identities = 14/38 (36%), Positives = 16/38 (42%), Gaps = 1/38 (2%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          LG  WH  C RC  C K +     S     PY +  CY
Sbjct: 17 LGAVWHPECFRCHACRKPIAEHEFSVSGNDPY-HKSCY 53


>gnl|CDD|188825 cd09441, LIM2_SF3, The second Lim domain of pollen specific protein
           SF3.  The second Lim domain of pollen specific protein
           SF3: SF3 is a Lim protein that is found exclusively in
           mature plant pollen grains. It contains two LIM domains.
           The exact function of SF3 is unknown. It may be a
           transcription factor required for the expression of late
           pollen genes. It is possible that SF3 protein is
           involved in controlling pollen-specific processes such
           as male gamete maturation, pollen tube formation, or
           even fertilization. As in other LIM domains, this domain
           family is 50-60 amino acids in size and shares two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein.
          Length = 61

 Score = 36.3 bits (84), Expect = 8e-04
 Identities = 18/57 (31%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 48  PNSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALFSER 104
             ++Y  E+ T  G  +H SC +C +   T+ P +++ H+G+ YC    +S LF E+
Sbjct: 5   GKTVYPIEKVTVEGTSYHKSCFKCSHGGCTISPSNYAAHEGRLYCK-HHHSQLFKEK 60


>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin.
           The fifth LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 35.9 bits (83), Expect = 9e-04
 Identities = 14/35 (40%), Positives = 18/35 (51%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T   + WH  C  C NC+K+L     +  D KPYC
Sbjct: 14 TYKNEPWHRECFTCTNCSKSLAGQRFTSRDEKPYC 48


>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like
          family.  The first LIM domain of Testin_like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain.  Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 58

 Score = 35.7 bits (83), Expect = 0.001
 Identities = 20/41 (48%), Positives = 23/41 (56%), Gaps = 5/41 (12%)

Query: 54 AERKTSLGKD--WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          AER    G+D  WH  C  CE CN+ LV   +  HDGK YC
Sbjct: 17 AERA---GEDACWHPGCFVCETCNELLVDLIYFYHDGKIYC 54


>gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the
          Paxillin-like protein family.  The fourth LIM domain of
          the Paxillin like protein family: This family consists
          of paxillin, leupaxin, Hic-5 (ARA55), and other related
          proteins. There are four LIM domains in the C-terminal
          of the proteins and leucine-rich LD-motifs in the
          N-terminal region.  Members of this family are adaptor
          proteins to recruit key components of
          signal-transduction machinery to specific sub-cellular
          locations. Paxillin is found at the interface between
          the plasma membrane and the actin cytoskeleton.
          Paxillin serves as a platform for the recruitment of
          numerous regulatory and structural proteins that
          together control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression that
          are necessary for cell migration and survival. Leupaxin
          is a cytoskeleton adaptor protein, which is
          preferentially expressed in hematopoietic cells. It
          associates with focal adhesion kinases PYK2 and
          pp125FAK and identified to be a component of the
          osteoclast pososomal signaling complex. Hic-5 controls
          cell proliferation, migration and senescence by
          functioning as coactivator for steroid receptors such
          as androgen receptor, glucocorticoid receptor and
          progesterone receptor. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 35.4 bits (82), Expect = 0.001
 Identities = 16/40 (40%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          T++G+ +H     C  C K L  G+  E D KPYC+ PC+
Sbjct: 14 TAMGRKFHPEHFVCAFCLKQLSKGTFKEQDDKPYCH-PCF 52


>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain
          Kinase ).  The first LIM domain of LIMK (LIM domain
          Kinase ): LIMK protein family is  comprised of two
          members LIMK1 and LIMK2. LIMK contains two LIM domains,
          a PDZ domain and a kinase domain. LIMK is involved in
          the regulation of actin polymerization and microtubule
          disassembly. LIMK influences architecture of the actin
          cytoskeleton by regulating the activity of the cofilin
          family proteins cofilin1, cofilin2, and destrin. The
          mechanism of the activation is to phosphorylates
          cofilin on serine 3 and inactivates its actin-severing
          activity, and altering the rate of actin
          depolymerisation. LIMKs can function in both cytoplasm
          and nucleus and are expressed in all tissues. Both
          LIMK1 and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. However,
          LIMK1 and LIMk2 have different cellular locations.
          While LIMK1 localizes mainly at focal adhesions, LIMK2
          is found in cytoplasmic punctae, suggesting that they
          may have different cellular functions. The LIM domains
          of LIMK have been shown to play an important role in
          regulating kinase activity and likely also contribute
          to LIMK function by acting as sites of
          protein-to-protein interactions. All LIM domains are
          50-60 amino acids in size and share two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 53

 Score = 34.8 bits (80), Expect = 0.002
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 49 NSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
            +  ++   +L +DWH  C RC  C+ +L    + E DGK YC
Sbjct: 6  GKILDSQYVQALNQDWHCDCFRCSVCSDSL-SNWYFEKDGKLYC 48


>gnl|CDD|188798 cd09414, LIM1_LIMPETin, The first LIM domain of protein LIMPETin.
           The first LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the Testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 58

 Score = 34.7 bits (80), Expect = 0.003
 Identities = 13/45 (28%), Positives = 20/45 (44%)

Query: 48 PNSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
             + +   K      WH +C RC  C + LV  ++  HD + YC
Sbjct: 10 YGELAVTAPKFGESLLWHPACFRCSTCEELLVDLTYCVHDDQIYC 54


>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH.  The
           first LIM domain of paxillin: Paxillin is an adaptor
           protein, which recruits key components of the
           signal-transduction machinery to specific sub-cellular
           locations to respond to environmental changes rapidly.
           The C-terminal region of paxillin contains four LIM
           domains which target paxillin to focal adhesions,
           presumably through a direct association with the
           cytoplasmic tail of beta-integrin. The N-terminal of
           paxillin is leucine-rich LD-motifs. Paxillin is found at
           the interface between the plasma membrane and the actin
           cytoskeleton. The binding partners of paxillin are
           diverse and include protein tyrosine kinases, such as
           Src and FAK, structural proteins, such as vinculin and
           actopaxin, and regulators of actin organization.
           Paxillin recruits these proteins to their function sites
           to control the dynamic changes in cell adhesion,
           cytoskeletal reorganization and gene expression. LIM
           domains are 50-60 amino acids in size and share two
           characteristic zinc finger motifs. The two zinc fingers
           contain eight conserved residues, mostly cysteines and
           histidines, which coordinately bond to two zinc atoms.
           LIM domains function as adaptors or scaffolds to support
           the assembly of multimeric protein complexes.
          Length = 59

 Score = 33.8 bits (78), Expect = 0.005
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 1/45 (2%)

Query: 58  TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALFS 102
            S G+ +H  C  C  C +    G   E +G+ YC +  +  LF+
Sbjct: 16  NSNGELYHEQCFVCAQCFQPFPDGLFYEFEGRKYCEH-DFQVLFA 59


>gnl|CDD|188784 cd09400, LIM_like_1, LIM domain in proteins of unknown function. 
          LIM domain in proteins of unknown function: LIM domains
          are identified in a diverse group of proteins with wide
          variety of biological functions, including gene
          expression regulation, cell fate determination,
          cytoskeleton organization, tumor formation, and
          development. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes. They perform their functions through
          interactions with other protein partners. The LIM
          domains are 50-60 amino acids in size and share two
          characteristic highly conserved zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. The consensus sequence of LIM
          domain has been defined as
          C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,
          21)-C-x(2,3)-[CHD] (where X denotes any amino acid).
          Length = 61

 Score = 33.9 bits (78), Expect = 0.006
 Identities = 18/49 (36%), Positives = 24/49 (48%)

Query: 48 PNSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPC 96
             ++LAER    GK +H +C +C  C   L PGS  E +   YC   C
Sbjct: 9  GLPVFLAERLLIEGKVYHRTCFKCARCGVQLTPGSFYETEYGSYCCETC 57


>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin.  The
          third LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 33.3 bits (76), Expect = 0.008
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH  C  C +C K    GS  E DG+P C
Sbjct: 20 WHPECFVCSDCLKPFTDGSFFELDGRPLC 48


>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin.  The
          second LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 33.3 bits (76), Expect = 0.008
 Identities = 12/35 (34%), Positives = 17/35 (48%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T++ + WH     C +C +        E DGKPYC
Sbjct: 14 TAMDQTWHPEHFFCSHCGELFGDEGFLERDGKPYC 48


>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3.  The
          first LIM domain of Prickle 3/LIM domain only 6 (LM06):
          Prickle contains three C-terminal LIM domains and a
          N-terminal PET domain.  Prickles have been implicated
          in roles of regulating tissue polarity or planar cell
          polarity (PCP).  PCP establishment requires the
          conserved Frizzled/Dishevelled PCP pathway. Prickle
          interacts with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 32.9 bits (75), Expect = 0.012
 Identities = 14/36 (38%), Positives = 19/36 (52%)

Query: 57 KTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +  LG  WH  C +C +C + LV   +   DGK YC
Sbjct: 19 RAGLGACWHPQCFQCASCQELLVDLIYFYQDGKIYC 54


>gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin.  The
          fourth LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells. Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 32.8 bits (75), Expect = 0.012
 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 1/40 (2%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++LG+ +H     C  C + L  GS  E  GKPYC   C+
Sbjct: 14 SALGRKFHPEHFVCAFCLRPLTQGSFKEQSGKPYC-STCF 52


>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin.  The
          first LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight cons erved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 32.7 bits (74), Expect = 0.014
 Identities = 13/35 (37%), Positives = 20/35 (57%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T++GK WH     C +C + +   +  E DG+PYC
Sbjct: 15 TAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYC 49


>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog
          (ENH) family.  The second LIM domain of the Enigma
          Homolog (ENH) family: ENH was initially identified in
          rat brain. Same as enigma, it contains three LIM
          domains at the C-terminus and a PDZ domain at
          N-terminus. ENH is implicated in signal transduction
          processes involving protein kinases.  It has also been
          shown that ENH interacts with protein kinase D1 (PKD1)
          via its LIM domains and forms a complex with PKD1 and
          the alpha1C subunit of cardiac L-type voltage-gated
          calcium channel in rat neonatal cardiomyocytes. The
          N-terminal PDZ domain interacts with alpha-actinin at
          the Z-line. ENH is expressed in multiple tissues, such
          as skeletal muscle, heart, bone, and brain. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 32.3 bits (73), Expect = 0.019
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 53 LAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L E   +L + WH SC  C  C+  +        DG+PYC
Sbjct: 9  LGEVINALKQTWHVSCFVCVACHNPIRNNVFHLEDGEPYC 48


>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9
          family.  The first LIM domain of Lhx2 and Lhx9 family:
          Lhx2 and Lhx9 are highly homologous LHX regulatory
          proteins. They belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Although Lhx2 and Lhx9 are highly homologous, they
          seems to play regulatory roles in different organs.  In
          animals, Lhx2 plays important roles in eye, cerebral
          cortex, limb, the olfactory organs, and erythrocyte
          development. Lhx2 gene knockout mice exhibit impaired
          patterning of the cortical hem and the telencephalon of
          the developing brain, and a lack of development in
          olfactory structures. Lhx9 is expressed in several
          regions of the developing mouse brain , the spinal
          cord, the pancreas, in limb mesenchyme, and in the
          urogenital region. Lhx9 plays critical roles in gonad
          development.  Homozygous mice lacking functional Lhx9
          alleles exhibit numerous urogenital defects, such as
          gonadal agenesis, infertility, and undetectable levels
          of testosterone and estradiol coupled with high FSH
          levels. Lhx9 null mice are phenotypically female, even
          those that are genotypically male. As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 54

 Score = 31.9 bits (73), Expect = 0.020
 Identities = 14/37 (37%), Positives = 16/37 (43%), Gaps = 9/37 (24%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEH-----DGKPYC 92
           + WH SCL+C  C   L     SE      DG  YC
Sbjct: 18 DRQWHASCLKCCECRLPL----DSELSCFSRDGNIYC 50


>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM
          domains protein 1 (FHL1).  The third LIM domain of Four
          and a half LIM domains protein 1 (FHL1):  FHL1 is
          heavily expressed in skeletal and cardiac muscles. It
          plays important roles in muscle growth,
          differentiation, and sarcomere assembly by acting as a
          modulator of transcription factors. Defects in FHL1
          gene are responsible for a number of Muscular
          dystrophy-like muscle disorders. It has been detected
          that FHL1 binds to Myosin-binding protein C, regulating
          myosin filament formation and sarcomere assembly. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 32.1 bits (73), Expect = 0.020
 Identities = 11/34 (32%), Positives = 16/34 (47%), Gaps = 1/34 (2%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          WH  C  C +C+K L     +  + + YC   CY
Sbjct: 20 WHSECFVCSSCSKKLAGQRFTAVEDQYYC-VDCY 52


>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM
           domains protein 1 (FHL1).  The second LIM domain of Four
           and a half LIM domains protein 1 (FHL1):  FHL1 is
           heavily expressed in skeletal and cardiac muscles. It
           plays important roles in muscle growth, differentiation,
           and sarcomere assembly by acting as a modulator of
           transcription factors. Defects in FHL1 gene are
           responsible for a number of Muscular dystrophy-like
           muscle disorders. It has been detected that FHL1 binds
           to Myosin-binding protein C, regulating myosin filament
           formation and sarcomere assembly. LIM domains are 50-60
           amino acids in size and share two characteristic zinc
           finger motifs. The two zinc fingers contain eight
           conserved residues, mostly cysteines and histidines,
           which coordinately bond to two zinc atoms. LIM domains
           function as adaptors or scaffolds to support the
           assembly of multimeric protein complexes.
          Length = 58

 Score = 32.0 bits (73), Expect = 0.023
 Identities = 13/41 (31%), Positives = 16/41 (39%), Gaps = 1/41 (2%)

Query: 61  GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALF 101
           G  WH  C  C NC + +   S        YC  PC+   F
Sbjct: 19  GNVWHKDCFTCSNCKQPIGTKSFFPKGEDFYCV-PCHEKKF 58


>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain
          Kinase 2).  The first LIM domain of LIMK2 (LIM domain
          Kinase 2): LIMK2 is a member of the LIMK protein
          family, which comprises LIMK1 and LIMK2. LIMK contains
          two LIM domains, a PDZ domain, and a kinase domain.
          LIMK is involved in the regulation of actin
          polymerization and microtubule disassembly. LIMK
          influences architecture of the actin cytoskeleton by
          regulating the activity of the cofilin family proteins
          cofilin1, cofilin2, and destrin. The mechanism of the
          activation is to phosphorylates cofilin on serine 3 and
          inactivates its actin-severing activity, altering the
          rate of actin depolymerization. LIMK activity is
          activated by phosphorylation of a threonine residue
          within the activation loop of the kinase by
          p21-activated kinases 1 and 4 and by Rho kinase. LIMKs
          can function in both cytoplasm and nucleus. Both LIMK1
          and LIMK2 can act in the nucleus to suppress
          Rac/Cdc42-dependent cyclin D1 expression. LIMK2 is
          expressed in all tissues. While LIMK1 localizes mainly
          at focal adhesions, LIMK2 is found in cytoplasmic
          punctae, suggesting that they may have different
          cellular functions. The activity of LIM kinase 2 to
          regulate cofilin phosphorylation is inhibited by the
          direct binding of Par-3. LIMK2 activation promotes cell
          cycle progression. The phenotype of Limk2 knockout mice
          shows a defect in spermatogenesis. The LIM domains have
          been shown to play an important role in regulating
          kinase activity and likely also contribute to LIMK
          function by acting as sites of protein-to-protein
          interactions. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 53

 Score = 31.8 bits (72), Expect = 0.028
 Identities = 13/29 (44%), Positives = 15/29 (51%), Gaps = 1/29 (3%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH SC +C  C   L    + E DGK YC
Sbjct: 21 WHNSCFQCSVCQDLLT-NWYYEKDGKLYC 48


>gnl|CDD|188867 cd09483, LIM1_Prickle_1, The first LIM domain of Prickle 1.  The
          first LIM domain of Prickle 1. Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in mainly expressed in
          fetal brain, adult cartilage, pancreatic islet, and
          some types of timorous cells. In addition, Prickle 1
          regulates cell movements during gastrulation and
          neuronal migration through interaction with the
          noncanonical Wnt11/Wnt5 pathway in zebrafish. Mutations
          in prickle 1 have been linked to progressive myoclonus
          epilepsy.  LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 59

 Score = 31.8 bits (72), Expect = 0.030
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH SC  C  CN+ LV   +   DGK +C
Sbjct: 26 WHPSCFVCFTCNELLVDLIYFYQDGKIHC 54


>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma
          subfamily with unknown function.  The third LIM domain
          of an Enigma subfamily with unknown function: The
          Enigma LIM domain family is comprised of three
          characterized members: Enigma, ENH, and Cypher
          (mouse)/ZASP (human). These subfamily members contain a
          single PDZ domain at the N-terminus and three LIM
          domains at the C-terminus. They serve as adaptor
          proteins, where the PDZ domain tethers the protein to
          the cytoskeleton and the LIM domains, recruit signaling
          proteins to implement corresponding functions. The
          members of the enigma family have been implicated in
          regulating or organizing cytoskeletal structure, as
          well as involving multiple signaling pathways. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 31.8 bits (72), Expect = 0.031
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +L  ++H  C  C  CN  L   S     G+P+C
Sbjct: 17 ALNNNYHSQCFNCTRCNVNLEGQSFYAKGGRPFC 50


>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin.  The
          second LIM domain of paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 31.5 bits (71), Expect = 0.035
 Identities = 13/35 (37%), Positives = 15/35 (42%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T+L + WH     C  C     P    E DGK YC
Sbjct: 14 TALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYC 48


>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain
          Kinase 1).  The first LIM domain of LIMK1 (LIM domain
          Kinase 1): LIMK1 belongs to the LIMK protein family,
          which comprises LIMK1 and LIMK2. LIMK contains two LIM
          domains, a PDZ domain, and a kinase domain. LIMK is
          involved in the regulation of actin polymerization and
          microtubule disassembly. LIMK influences architecture
          of the actin cytoskeleton by regulating the activity of
          the cofilin family proteins cofilin1, cofilin2, and
          destrin. The mechanism of the activation is to
          phosphorylates cofilin on serine 3 and inactivates its
          actin-severing activity, and altering the rate of actin
          depolymerization. LIMKs can function in both cytoplasm
          and nucleus. Both LIMK1 and LIMK2 can act in the
          nucleus to suppress Rac/Cdc42-dependent cyclin D1
          expression. LIMK1 is expressed in all tissues and is
          localized to focal adhesions in the cell. LIMK1 can
          form homodimers upon binding of HSP90 and is activated
          by Rho effector Rho kinase and MAPKAPK2. LIMK1 is
          important for normal central nervous system
          development, and its deletion has been implicated in
          the development of the human genetic disorder Williams
          syndrome. Moreover, LIMK1 up-regulates the promoter
          activity of urokinase type plasminogen activator and
          induces its mRNA and protein expression in breast
          cancer cells. The LIM domains have been shown to play
          an important role in regulating kinase activity and
          likely also contribute to LIMK function by acting as
          sites of protein-to-protein interactions. All LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 74

 Score = 31.8 bits (72), Expect = 0.037
 Identities = 17/45 (37%), Positives = 23/45 (51%), Gaps = 5/45 (11%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHS--EHDGKPYC 92
          S+Y  +   +L  DWH  C RC  C  +L   SH   E DG+ +C
Sbjct: 28 SIYDGQYLQALNSDWHADCFRCCECGASL---SHWYYEKDGRLFC 69


>gnl|CDD|188828 cd09444, LIM_Mical_like_1, This domain belongs to the LIM domain
          family which are found on Mical (molecule interacting
          with CasL) like proteins.  The LIM domain on proteins
          of unknown function: This domain belongs to the LIM
          domain family which are found on Mical (molecule
          interacting with CasL) like proteins. Known members of
          the Mical-like family includes single LIM domain
          containing proteins, Mical (molecule interacting with
          CasL), pollen specific protein SF3, Eplin, xin
          actin-binding repeat-containing protein 2 (XIRP2), and
          Ltd-1. The members of this family function mainly at
          the cytoskeleton and focal adhesions. They interact
          with transcription factors or other signaling molecules
          to play roles in muscle development, neuronal
          differentiation, cell growth, and mobility.  As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 55

 Score = 31.2 bits (71), Expect = 0.041
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 49 NSMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHS 84
            ++L +R    GK +H +C RC+ C+ TL+PGS+ 
Sbjct: 6  QHVHLVQRHLVDGKLYHRNCFRCKECSSTLLPGSYK 41


>gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM
          domains protein 5 (FHL5).  The second LIM domain of
          Four and a half LIM domains protein 5 (FHL5): FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors , which are highly expressed in
          male germ cells and is required for post-meiotic gene
          expression. FHL5 associates with CREM and confers a
          powerful transcriptional activation function.
          Activation by CREB has known to occur upon
          phosphorylation at an essential regulatory site and the
          subsequent interaction with the ubiquitous coactivator
          CREB-binding protein (CBP). However, the activation by
          FHL5 is independent of phosphorylation and CBP
          association. It represents a new route for
          transcriptional activation by CREM and CREB.  LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 54

 Score = 31.0 bits (70), Expect = 0.045
 Identities = 11/37 (29%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          G +WH +C  C++C + +        + K YC  PC+
Sbjct: 19 GNEWHETCFVCQSCQQPIGTKPLITKENKNYC-VPCF 54


>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM
          domains protein (FHL).  The first LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and  an N-terminal single zinc finger domain
          with a consensus sequence equivalent to the C-terminal
          half of a LIM domain. LIMPETin is an exception,
          containing six LIM domains. FHL1, 2 and 3 are
          predominantly expressed in muscle tissues, and FHL5 is
          highly expressed in male germ cells.  FHL proteins
          exert their roles as transcription co-activators or
          co-repressors through a wide array of interaction
          partners. For example, FHL1 binds to Myosin-binding
          protein C, regulating myosin filament formation and
          sarcomere assembly. FHL2 has shown to interact with
          more than 50 different proteins, including receptors,
          structural proteins, transcription factors and
          cofactors, signal transducers, splicing factors, DNA
          replication and repair enzymes, and metabolic enzymes.
          FHL3 int eracts with many transcription factors, such
          as CREB, BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 31.3 bits (71), Expect = 0.049
 Identities = 12/37 (32%), Positives = 17/37 (45%), Gaps = 1/37 (2%)

Query: 62 KDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYS 98
          + WH  C +C  C ++LV    +  D    C   CYS
Sbjct: 24 RHWHEGCFKCFKCQRSLVDKPFAAKDEDLLCT-ECYS 59


>gnl|CDD|188730 cd09344, LIM1_FHL1, The first LIM domain of Four and a half LIM
          domains protein 1.  The first LIM domain of Four and a
          half LIM domains protein 1 (FHL1):  FHL1 is heavily
          expressed in skeletal and cardiac muscles. It plays
          important roles in muscle growth, differentiation, and
          sarcomere assembly by acting as a modulator of
          transcription factors. Defects in FHL1 gene are
          responsible for a number of Muscular dystrophy-like
          muscle disorders. It has been detected that FHL1 binds
          to Myosin-binding protein C, regulating myosin filament
          formation and sarcomere assembly. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes. .
          Length = 54

 Score = 30.9 bits (70), Expect = 0.055
 Identities = 11/33 (33%), Positives = 13/33 (39%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCN 93
           + WH +C RC  C K L        D K  C 
Sbjct: 19 NRYWHETCFRCAKCYKPLANEPFVAKDNKILCG 51


>gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein
          Lost in Neoplasm (Eplin) like proteins.  The Lim domain
          of Epithelial Protein Lost in Neoplasm (Eplin) like
          proteins: This family contains Epithelial Protein Lost
          in Neoplasm in Neoplasm (Eplin), xin actin-binding
          repeat-containing protein 2 (XIRP2) and a group of
          protein with unknown function.  The members of this
          family all contain a single LIM domain. Epithelial
          Protein Lost in Neoplasm is a cytoskeleton-associated
          tumor suppressor whose expression inversely correlates
          with cell growth, motility, invasion and cancer
          mortality.  Eplin interacts and stabilizes F-actin
          filaments and stress fibers, which correlates with its
          ability to suppress anchorage independent growth. In
          epithelial cells, Eplin is required for formation of
          the F-actin adhesion belt by binding to the
          E-cadherin-catenin complex through alpha-catenin. Eplin
          is expressed in two isoforms, a longer Eplin-beta and a
          shorter Eplin-alpha. Eplin-alpha mRNA is detected in
          various tissues and cell lines, but is absent or down
          regulated in cancer cells. Xirp2 contains a LIM domain
          and Xin re peats for binding to and stabilising
          F-actin. Xirp2 is expressed in muscles and is
          significantly induced in the heart in response to
          systemic administration of angiotensin II. Xirp2 is an
          important effector of the Ang II signaling pathway in
          the heart. The expression of Xirp2 is activated by
          myocyte enhancer factor (MEF)2A, whose  transcriptional
          activity is stimulated by angiotersin II. Thus, Xirp2
          plays important pathological roles in the angiotensin
          II induced hypertension. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 30.9 bits (70), Expect = 0.056
 Identities = 16/41 (39%), Positives = 25/41 (60%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          Y  ER  +  +++H SC RCE+CN  L  G+++   G+ YC
Sbjct: 9  YPMERLIADKQNFHKSCFRCEHCNSKLSLGNYASLHGRIYC 49


>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The second LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 53

 Score = 30.8 bits (70), Expect = 0.058
 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 1/38 (2%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPG-SHSEHDGKPYCNY 94
          T+LG+ +H     C  C     P  S+ EH+GK YC+Y
Sbjct: 14 TALGRKYHVEHFTCSVCPTVFGPNDSYYEHEGKIYCHY 51


>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like
          family.  The first LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone, and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
          It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 30.8 bits (70), Expect = 0.059
 Identities = 13/39 (33%), Positives = 18/39 (46%), Gaps = 1/39 (2%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +LG+ WH     C +C+ +L      E  G  YC   CY
Sbjct: 15 ALGRSWHPEEFTCSHCHCSLAEIGFVEEKGSLYCEL-CY 52


>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known
          as Lim1) and Lhx5.  The first LIM domain of Lhx1 (also
          known as Lim1) and Lhx5. Lhx1 and Lhx5 are closely
          related members of LHX protein family, which features
          two tandem N-terminal LIM domains and a C-terminal DNA
          binding homeodomain. Members of LHX family are found in
          the nucleus and act as transcription factors or
          cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Lhx1 is required
          for regulating the vertebrate head organizer, the
          nervous system, and female reproductive tract
          development. During embryogenesis in the mouse, Lhx1 is
          expressed early in mesodermal tissue, then later during
          urogenital, kidney, liver, and nervous system
          development. In the adult, expression is restricted to
          the kidney and brain. A mouse embryos with Lhx1 gene
          knockout cannot grow normal anterior head structures,
          kidneys, and gonads, but with normally developed trunk
          and tail morphology. In the developing nervous system,
          Lhx1 is required to direct the trajectories of motor
          axons in the limb. Lhx1 null female mice lack the
          oviducts and uterus.  Lhx5 protein may play
          complementary or overlapping roles with Lhx1. The
          expression of Lhx5 in the anterior portion of the mouse
          neural tube suggests a role in patterning of the
          forebrain. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 52

 Score = 30.5 bits (69), Expect = 0.078
 Identities = 12/33 (36%), Positives = 17/33 (51%), Gaps = 1/33 (3%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L + WH  C++C +C   L     S  +GK YC
Sbjct: 17 LDRAWHAKCVQCCDCKCPLTEKCFSR-EGKLYC 48


>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a.  The first
          LIM domain of Lhx3a: Lhx3a is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3a is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 56

 Score = 30.5 bits (69), Expect = 0.081
 Identities = 12/31 (38%), Positives = 15/31 (48%), Gaps = 1/31 (3%)

Query: 62 KDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          K WH  CL+C +C   L     S   G+ YC
Sbjct: 22 KPWHSKCLKCVDCQAQLTDKCFSR-GGQVYC 51


>gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin.  The
          fourth LIM domain of Paxillin: Paxillin is an adaptor
          protein, which recruits key components of the
          signal-transduction machinery to specific sub-cellular
          locations to respond to environmental changes rapidly.
          The C-terminal region of paxillin contains four LIM
          domains which target paxillin to focal adhesions,
          presumably through a direct association with the
          cytoplasmic tail of beta-integrin. The N-terminal of
          paxillin is leucine-rich LD-motifs. Paxillin is found
          at the interface between the plasma membrane and the
          actin cytoskeleton. The binding partners of paxillin
          are diverse and include protein tyrosine kinases, such
          as Src and FAK, structural proteins, such as vinculin
          and actopaxin, and regulators of actin organization.
          Paxillin recruits these proteins to their function
          sites to control the dynamic changes in cell adhesion,
          cytoskeletal reorganization and gene expression. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 30.3 bits (68), Expect = 0.093
 Identities = 14/36 (38%), Positives = 20/36 (55%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCN 93
          T++GK +H     C  C K L  G+  E + KPYC+
Sbjct: 14 TAMGKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCH 49


>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like
          proteins.  The second LIM domain of Ajuba-like
          proteins: Ajuba like LIM protein family includes three
          highly homologous proteins Ajuba, Limd1, and WTIP.
          Members of the family contain three tandem C-terminal
          LIM domains and a proline-rich N-terminal region. This
          family of proteins functions as scaffolds,
          participating in the assembly of numerous protein
          complexes. In the cytoplasm, Ajuba binds Grb2 to
          modulate serum-stimulated ERK activation. Ajuba also
          recruits the TNF receptor-associated factor 6 (TRAF6)
          to p62 and activates PKCKappa activity. Ajuba interacts
          with alpha-catenin and F-actin to contribute to the
          formation or stabilization of adheren junctions by
          linking adhesive receptors to the actin cytoskeleton.
          Although Ajuba is a cytoplasmic protein, it can shuttle
          into the nucleus. In nucleus, Ajuba functions as a
          corepressor for the zinc finger-protein Snail. It binds
          to the SNAG repression domain of Snail through its LIM
          region.  Arginine methyltransferase-5 (Prmt5), a
          protein in the complex, is recruited to Snai l through
          an interaction with Ajuba. This ternary complex
          functions to repress E-cadherin, a Snail target gene.
          In addition, Ajuba contains functional nuclear-receptor
          interacting motifs and selectively interacts with
          retinoic acid receptors (RARs) and rexinoid receptor
          (RXRs) to negatively regulate retinoic acid signaling.
          Wtip, the Wt1-interacting protein, was originally
          identified as an interaction partner of the Wilms
          tumour protein 1 (WT1). Wtip is involved in kidney and
          neural crest development. Wtip interacts with the
          receptor tyrosine kinase Ror2 and inhibits canonical
          Wnt signaling. LIMD1 was reported to inhibit cell
          growth and metastases. The inhibition may be mediated
          through an interaction with the protein
          barrier-to-autointegration (BAF), a component of
          SWI/SNF chromatin-remodeling protein; or through the
          interaction with retinoblastoma protein (pRB),
          resulting in inhibition of E2F-mediated transcription,
          and expression of the majority of genes with E2F1-
          responsive elements. Recently, Limd1 was shown to
          interact with the p62/sequestosome protein and
          influence IL-1 and RANKL signaling by facilitating the
          assembly of a p62/TRAF6/a-PKC multi-protein complex.
          The Limd1-p62 interaction affects both NF-kappaB and
          AP-1 activity in epithelial cells and osteoclasts.
          Moreover, LIMD1 functions as tumor repressor to block
          lung tumor cell line in vitro and in vivo. Recent
          studies revealed that LIM proteins Wtip, LIMD1 and
          Ajuba interact with components of RNA induced silencing
          complexes (RISC) as well as eIF4E and the mRNA m7GTP
          cap-protein complex and are required for
          microRNA-mediated gene silencing.  As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 53

 Score = 30.0 bits (68), Expect = 0.093
 Identities = 14/36 (38%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 59 SLGKDWHGSCLRCENCNKTL--VPGSHSEHDGKPYC 92
          +LGK +H  C RC  CN+ L  VP +  + +   YC
Sbjct: 15 ALGKSYHPGCFRCCVCNECLDGVPFT-VDVENNIYC 49


>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2.  The
          first LIM domain of Prickle 2: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells. Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 29.9 bits (67), Expect = 0.13
 Identities = 13/29 (44%), Positives = 15/29 (51%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH  C  C  CN+ LV   +   DGK YC
Sbjct: 26 WHPQCFVCSVCNELLVDLIYFYQDGKIYC 54


>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin.  The first
          LIM domain of Zyxin: Zyxin exhibits three copies of the
          LIM domain, an extensive proline-rich domain and a
          nuclear export signal.  Localized at sites of cell
          substratum adhesion in fibroblasts, Zyxin interacts
          with alpha-actinin, members of the cysteine-rich
          protein (CRP) family, proteins that display Src
          homology 3 (SH3) domains and Ena/VASP family members.
          Zyxin and its partners have been implicated in the
          spatial control of actin filament assembly as well as
          in pathways important for cell differentiation. In
          addition to its functions at focal adhesion plaques,
          recent work has shown that zyxin moves from the sites
          of cell contacts to the nucleus, where it directly
          participates in the regulation of gene expression. As
          in other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 87

 Score = 30.6 bits (69), Expect = 0.14
 Identities = 14/39 (35%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +LG  +H +C  C  C + L        +GKPYC   CY
Sbjct: 50 ALGHLFHVTCFTCHQCEQQLQGQQFYSLEGKPYCE-ECY 87


>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like
          family.  The second LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
           It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 29.8 bits (67), Expect = 0.14
 Identities = 14/40 (35%), Positives = 19/40 (47%)

Query: 53 LAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L E   +L + WH SC  C  C + +        DG+PYC
Sbjct: 9  LGEVMHALKQTWHVSCFVCAACKQPIGNSLFHMEDGEPYC 48


>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM
          domains protein (FHL).  The third LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 int eracts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 29.6 bits (67), Expect = 0.16
 Identities = 11/29 (37%), Positives = 12/29 (41%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH  C  C  C K L     +  D  PYC
Sbjct: 20 WHKECFVCTGCKKQLAGQRFTSRDEYPYC 48


>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin.  The
          first LIM domain of Leupaxin: Leupaxin is a
          cytoskeleton adaptor protein, which is preferentially
          expressed in hematopoietic cells.  Leupaxin belongs to
          the paxillin focal adhesion protein family. Same as
          other members of the family, it has four leucine-rich
          LD-motifs in the N-terminus and four LIM domains in the
          C-terminus. It may function in cell type-specific
          signaling by associating with interaction partners
          PYK2, FAK, PEP and p95PKL.  When expressed in human
          leukocytic cells, leupaxin significantly suppressed
          integrin-mediated cell adhesion to fibronectin and the
          tyrosine phosphorylation of paxillin. These findings
          indicate that leupaxin may negatively regulate the
          functions of paxillin during integrin signaling. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 29.5 bits (66), Expect = 0.18
 Identities = 13/35 (37%), Positives = 17/35 (48%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          T+LG+ WH     C  C K L      E +G+ YC
Sbjct: 16 TALGQTWHPEHFVCCQCGKELGSRPFFERNGQAYC 50


>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma.  The first
          LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS. Thus Enigma is implicated
          in signal transduction processes such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 52

 Score = 29.4 bits (66), Expect = 0.20
 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 1/39 (2%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +LG+ +H     C  C K L  G   E  G  +C   CY
Sbjct: 15 ALGRSYHPEEFTCSQCKKVLDEGGFFEEKGSIFCP-KCY 52


>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like
          family.  The second LIM domain of Testin-like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain.  Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 56

 Score = 29.1 bits (66), Expect = 0.21
 Identities = 14/38 (36%), Positives = 19/38 (50%), Gaps = 1/38 (2%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
           GK+WH     C  C++ L    +   +GKPYC   CY
Sbjct: 19 EGKNWHLKHFCCFQCDEPLGGQRYVLREGKPYC-LDCY 55


>gnl|CDD|188863 cd09479, LIM1_CRP1, The first LIM domain of Cysteine Rich Protein
          1 (CRP1).  The first LIM domain of Cysteine Rich
          Protein 1 (CRP1): Cysteine-rich proteins (CRPs) are
          characterized by the presence of two LIM domains linked
          to a short glycine-rich repeats (GRRs). The CRP family
          members include CRP1, CRP2, CRP3/MLP and TLP. CRP1,
          CRP2 and CRP3 share a conserved nuclear targeting
          signal (K/R-K/R-Y-G-P-K), which supports the fact that
          these proteins function not only in the cytoplasm but
          also in the nucleus. CRPs control regulatory pathways
          during cellular differentiation, and involve in complex
          transcription circuits, and the organization as well as
          the arrangement of the myofibrillar/cytoskeletal
          network. CRP1 can associate with the actin cytoskeleton
          and are capable of interacting with alpha-actinin and
          zyxin. CRP1 was shown to regulate actin filament
          bundling by interaction with alpha-actinin and direct
          binding to actin filaments. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 29.2 bits (65), Expect = 0.22
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++Y AE     G+ +H SC  C  C K L   + + H  + YC   CY
Sbjct: 9  TVYFAEEVQCEGRSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCK-SCY 55


>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred
          partner (LPP).  The first LIM domain of lipoma
          preferred partner (LPP): LPP is a member of the zyxin
          LIM protein family and contains three LIM zinc-binding
          domains at the C-terminal and proline-rich region at
          the N-terminal.  LPP initially identified as the most
          frequent translocation partner of HMGA2 (High Mobility
          Group A2) in a subgroup of benign tumors of adipose
          tissue (lipomas). It was also shown to be rearranged in
          a number of other soft tissues, as well as in a case of
          acute monoblastic leukemia. In addition to its
          involvement in tumors, LPP was inedited as a smooth
          muscle restricted LIM protein that plays an important
          role in SMC migration. LPP is localized at sites of
          cell adhesion, cell-cell contacts and transiently in
          the nucleus. In nucleus, it acts as a coactivator for
          the ETS domain transcription factor PEA3. In addition
          to PEA3, it interacts with alpha-actinin,vasodilator
          stimulated phosphoprotein (VASP),Palladin, and Scrib.
          The  LIM domains are the main focal adhesion targeting
          elements and that the proline- rich region, which
          harbors binding sites for alpha-actinin and
          vasodilator- stimulated phosphoprotein (VASP), has a
          weak targeting capacity. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 54

 Score = 28.9 bits (65), Expect = 0.24
 Identities = 13/37 (35%), Positives = 17/37 (45%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNY 94
          T++ + +H SC  C  C   L        DGKPYC  
Sbjct: 16 TAMDQVYHISCFTCHQCQINLQGKPFYALDGKPYCEE 52


>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein
          LIMPETin.  The fourth LIM domain of protein LIMPETin:
          LIMPETin contains 6 LIM domains at the C-terminal and
          an N-terminal PET domain. Four of the six LIM domains
          are highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the Testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 28.9 bits (65), Expect = 0.28
 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 1/37 (2%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          G+ WH  C  C  C + +   S    D   YC  PCY
Sbjct: 19 GQQWHEKCFCCCECKQPIGTKSFIPKDDDVYCV-PCY 54


>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein
          LIMPETin and related proteins.  The second LIM domain
          of protein LIMPETin: LIMPETin contains 6 LIM domains at
          the C-terminal and an N-terminal PET domain. Four of
          the six LIM domains are highly homologous to the four
          and half LIM domain protein family and two of them show
          sequence similarity to the LIM domains of the testin
          family. Thus, LIMPETin may be the recombinant product
          of genes coding testin and FHL proteins.  In
          Schistosoma mansoni, where LIMPETin was first
          identified, LIMPETin is down regulated in sexually
          mature adult Schistosoma females compared to sexually
          immature adult females and adult male. Its differential
          expression indicates that it is a transcription
          regulator. LIM domains are 50-60 amino acids in size
          and share two characteristic zinc finger motifs. The
          two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 56

 Score = 29.0 bits (65), Expect = 0.28
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 55 ERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          E   ++ KDWH     C  C+++L    +   D  PYC   CY
Sbjct: 14 EYTKAMNKDWHSGHFCCWQCDESLTGQRYVLRDEHPYC-IKCY 55


>gnl|CDD|188786 cd09402, LIM1_CRP, The first LIM domain of Cysteine Rich Protein
          (CRP).  The first LIM domain of Cysteine Rich Protein
          (CRP): Cysteine-rich proteins (CRPs) are characterized
          by the presence of two LIM domains linked to a short
          glycine-rich repeats (GRRs). The CRP family members
          include CRP1, CRP2, CRP3/MLP. CRP1, CRP2 and CRP3 share
          a conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
          which supports the fact that these proteins function
          not only in the cytoplasm but also in the nucleus. CRPs
          control regulatory pathways during cellular
          differentiation, and involve in complex transcription
          control, and the organization as well as the
          arrangement of the myofibrillar/cytoskeletal network.
          It is evident that CRP1, CRP2, and CRP3/MLP are
          involved in promoting protein assembly along the
          actin-based cytoskeleton. Although members of the CRP
          family share common binding partners, they are also
          capable of recognizing different and specific targets.
          LIM domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 53

 Score = 28.8 bits (64), Expect = 0.28
 Identities = 16/48 (33%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++Y AE     G+ +H SC  C  C K L   + + H+ + YC   CY
Sbjct: 7  TVYHAEEVQCEGRSFHKSCFLCMVCRKNLDSTTVAAHEDEIYCK-SCY 53


>gnl|CDD|188799 cd09415, LIM1_Prickle, The first LIM domain of Prickle.  The
          first LIM domain of Prickle: Prickle contains three
          C-terminal LIM domains and a N-terminal PET domain.
          Prickles have been implicated in roles of regulating
          tissue polarity or planar cell polarity (PCP).  PCP
          establishment requires the conserved
          Frizzled/Dishevelled PCP pathway. Prickle interacts
          with Dishevelled, thereby modulating
          Frizzled/Dishevelled activity and PCP signaling. Four
          forms of prickles have been identified: prickle 1-4.
          The best characterized is prickle 1 and prickle 2 which
          are differentially expressed. While prickle 1 is
          expressed in fetal heart and hematological
          malignancies, prickle 2 is found in fetal brain, adult
          cartilage, pancreatic islet, and some types of timorous
          cells.  Mutations in prickle 1 have been linked to
          progressive myoclonus epilepsy. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 28.8 bits (65), Expect = 0.30
 Identities = 12/29 (41%), Positives = 15/29 (51%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          WH +C  C  C + LV   +   DGK YC
Sbjct: 26 WHPACFVCSTCKELLVDLIYFYQDGKVYC 54


>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH.  The
          second LIM domain of protein PINCH: PINCH plays a
          pivotal role in the assembly of focal adhesions (FAs),
          regulating diverse functions in cell adhesion, growth,
          and differentiation through LIM-mediated
          protein-protein interactions. PINCH comprises an array
          of five LIM domains that interact with integrin-linked
          kinase (ILK), Nck2 (also called Nckbeta or Grb4) and
          other interaction partners.  These interactions are
          essential for triggering the FA assembly and for
          relaying diverse mechanical and biochemical signals
          between Cell-extracellular matrix and the actin
          cytoskeleton.  LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 52

 Score = 28.8 bits (65), Expect = 0.32
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 64 WHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPC 96
          WH  C RCE CNK L      ++ G+  C +PC
Sbjct: 20 WHPDCFRCEICNKELADIGFVKNAGRALC-HPC 51


>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM
          domains protein 2 (FHL2).  The second LIM domain of
          Four and a half LIM domains protein 2 (FHL2):  FHL2 is
          one of the best studied FHL proteins. FHL2 expression
          is most abundant in the heart, and in brain, liver and
          lung to a lesser extent. FHL2 participates in a wide
          range of cellular processes, such as transcriptional
          regulation, signal transduction, and cell survival by
          binding to various protein partners. FHL2 has shown to
          interact with more than 50 different proteins,
          including receptors, structural proteins, transcription
          factors and cofactors, signal transducers, splicing
          factors, DNA replication and repair enzymes, and
          metabolic enzymes. Although FHL2 is abundantly
          expressed in heart, the fhl2 null mice are viable and
          had no detectable abnormal cardiac phenotype. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to s
          upport the assembly of multimeric protein complexes.
          Length = 57

 Score = 28.9 bits (64), Expect = 0.32
 Identities = 12/37 (32%), Positives = 18/37 (48%), Gaps = 1/37 (2%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          G  WH +C  C+ C + +   S    D + +C  PCY
Sbjct: 19 GNSWHETCFICQRCQQPIGTKSFIPKDNQNFC-VPCY 54


>gnl|CDD|188864 cd09480, LIM1_CRP2, The first LIM domain of Cysteine Rich Protein
          2 (CRP2).  The first LIM domain of Cysteine Rich
          Protein 2 (CRP2): The CRP family members include CRP1,
          CRP2, CRP3/MLP and TLP. CRP1, CRP2 and CRP3 share a
          conserved nuclear targeting signal (K/R-K/R-Y-G-P-K),
          which supports the fact that these proteins function
          not only in the cytoplasm but also in the nucleus. CRPs
          control regulatory pathways during cellular
          differentiation, and involve in complex transcription
          circuits, and the organization as well as the
          arrangement of the myofibrillar/cytoskeletal network.
          CRP2 specifically binds to protein inhibitor of
          activated STAT-1 (PIAS1) and a novel human protein
          designed CRP2BP (for CRP2 binding partner). PIAS1
          specifically inhibits the STAT-1 pathway and CRP2BP is
          homologous to members of the histone acetyltransferase
          family raising the possibility that CRP2 is a modulator
          of cytokine-controlled pathways or is functionally
          active in the transcriptional regulatory network. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 28.4 bits (63), Expect = 0.46
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++Y AE     G+ +H  C  C  C K L   + + HD + YC   CY
Sbjct: 8  TVYHAEEVQCDGRSFHKCCFLCMVCRKNLDSTTVAIHDQEIYCK-SCY 54


>gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog
          (ENH) family.  The first LIM domain of the Enigma
          Homolog (ENH) family: ENH was initially identified in
          rat brain. Same as enigma, it contains three LIM
          domains at the C-terminus and a PDZ domain at
          N-terminus.  ENH is implicated in signal transduction
          processes involving protein kinases.  It has also been
          shown that ENH interacts with protein kinase D1 (PKD1)
          via its LIM domains and forms a complex with PKD1 and
          the alpha1C subunit of cardiac L-type voltage-gated
          calcium channel in rat neonatal cardiomyocytes. The
          N-terminal PDZ domain interacts with alpha-actinin at
          the Z-line. ENH is expressed in multiple tissues, such
          as skeletal muscle, heart, bone, and brain. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 52

 Score = 28.1 bits (62), Expect = 0.49
 Identities = 13/39 (33%), Positives = 17/39 (43%), Gaps = 1/39 (2%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          +LGK WH     C +C  ++      E  G  YC   CY
Sbjct: 15 ALGKSWHPEEFNCAHCKSSMAYIGFVEEKGALYCEI-CY 52


>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function.
          The first Lim domain of a LIM domain containing
          protein: The functions of the proteins are unknown. The
          members of this family contain two copies of LIM
          domain. The LIM domain is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 58

 Score = 28.4 bits (64), Expect = 0.53
 Identities = 10/34 (29%), Positives = 10/34 (29%), Gaps = 5/34 (14%)

Query: 64 WHGSCLRCENCNKTLVPGSHSE---HDGKPYCNY 94
          WH  C  C  C               D KPYC  
Sbjct: 24 WHRECFVCTTCGCPFQ--FSVPCYVLDDKPYCQQ 55


>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM
          domains protein 1 (FHL1).  The fourth LIM domain of
          Four and a half LIM domains protein 1 (FHL1):  FHL1 is
          heavily expressed in skeletal and cardiac muscles. It
          plays important roles in muscle growth,
          differentiation, and sarcomere assembly by acting as a
          modulator of transcription factors. Defects in FHL1
          gene are responsible for a number of Muscular
          dystrophy-like muscle disorders. It has been detected
          that FHL1 binds to Myosin-binding protein C, regulating
          myosin filament formation and sarcomere assembly. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 64

 Score = 28.2 bits (63), Expect = 0.63
 Identities = 11/32 (34%), Positives = 15/32 (46%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          G  WH  C  C+ C+  L       H+G+ YC
Sbjct: 26 GSSWHDYCFNCKKCSLNLANKRFVFHNGQIYC 57


>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH).  The
          first LIM domain of Arrowhead (AWH): Arrowhead belongs
          to the LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Members of LHX family are found in the
          nucleus and act as transcription factors or cofactors.
          LHX proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs, such as the pituitary
          gland and the pancreas. During embryogenesis of
          Drosophila, Arrowhead is expressed in each abdominal
          segment and in the labial segment. Late in embryonic
          development, expression of arrowhead is refined to the
          abdominal histoblasts and salivary gland imaginal ring
          cells themselves. The Arrowhead gene required for
          establishment of a subset of imaginal tissues: the
          abdominal histoblasts and the salivary gland imaginal
          rings. As in other LIM domains, this domain family is
          50-60 amino acids in size and shares two characteristic
          zinc finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 54

 Score = 27.7 bits (62), Expect = 0.68
 Identities = 10/18 (55%), Positives = 11/18 (61%)

Query: 61 GKDWHGSCLRCENCNKTL 78
          G+ WH SCLRC  C   L
Sbjct: 18 GRSWHVSCLRCCVCQTPL 35


>gnl|CDD|188743 cd09357, LIM3_Zyxin_like, The third LIM domain of Zyxin-like
          family.  The third LIM domain of Zyxin like family:
          This family includes Ajuba, Limd1, WTIP, Zyxin, LPP,
          and Trip6 LIM proteins. Members of Zyxin family contain
          three tandem C-terminal LIM domains, and a proline-rich
          N-terminal region.  Zyxin proteins are detected
          primarily in focal adhesion plaques. They function as
          scaffolds, participating in the assembly of multiple
          interactions and signal transduction networks, which
          regulate cell adhesion, spreading, and motility. They
          can also shuffle into nucleus.  In nucleus, zyxin
          proteins affect gene transcription by interaction with
          a variety of nuclear proteins, including several
          transcription factors, playing regulating roles in cell
          proliferation, differentiation and apoptosis. As in
          other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 63

 Score = 28.2 bits (63), Expect = 0.71
 Identities = 8/23 (34%), Positives = 14/23 (60%)

Query: 56 RKTSLGKDWHGSCLRCENCNKTL 78
          R  +L + +H +C +CE+C   L
Sbjct: 19 RIVALDRSFHVNCYKCEDCGMLL 41


>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog
          (ENH) family.  The third LIM domain of the Enigma
          Homolog (ENH) family: ENH was initially identified in
          rat brain. Same as enigma, it contains three LIM
          domains at the C-terminus and a PDZ domain at
          N-terminus. ENH is implicated in signal transduction
          processes involving protein kinases.  It has also been
          shown that ENH interacts with protein kinase D1 (PKD1)
          via its LIM domains and forms a complex with PKD1 and
          the alpha1C subunit of cardiac L-type voltage-gated
          calcium channel in rat neonatal cardiomyocytes. The
          N-terminal PDZ domain interacts with alpha-actinin at
          the Z-line. ENH is expressed in multiple tissues, such
          as skeletal muscle, heart, bone, and brain. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 55

 Score = 27.6 bits (61), Expect = 0.72
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +LG  WH +C  C  C ++L   +      KP C
Sbjct: 17 ALGHTWHDTCFVCSVCCESLEGQTFFSKKDKPLC 50


>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX
          protein family.  The first LIM domain of Isl: Isl is a
          member of LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Isl1 and Isl2 are the two conserved
          members of this family. Proteins in this group are
          found in the nucleus and act as transcription factors
          or cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Isl-1 is one of
          the LHX proteins isolated originally by virtue of its
          ability to bind DNA sequences from the 5'-flanking
          region of the rat insulin gene in pancreatic
          insulin-producing cells. Mice deficient in Isl-1 fail
          to form the dorsal exocrine pancreas and islet cells
          fail to differentiate. On the other hand, Isl-1 takes
          part in the pituitary development by activating the
          gonadotropin-releasing hormone receptor gene together
          with LHX3 and steroidogenic factor 1. Mouse Is l2 is
          expressed in the retinal ganglion cells and the
          developing spinal cord where it plays a role in motor
          neuron development. Same as Isl1, Isl2 may also be able
          to bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 27.7 bits (62), Expect = 0.74
 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%)

Query: 64 WHGSCLRCENCNKTLVPGSHS-EHDGKPYC 92
          WH +CL+C  C + L         DGK YC
Sbjct: 22 WHAACLKCAECGQYLDETCTCFVRDGKTYC 51


>gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial
          Protein Lost in Neoplasm (Eplin).  The Lim domain of
          Epithelial Protein Lost in Neoplasm (Eplin): Epithelial
          Protein Lost in Neoplasm is a cytoskeleton-associated
          tumor suppressor whose expression inversely correlates
          with cell growth, motility, invasion and cancer
          mortality.  Eplin interacts and stabilizes F-actin
          filaments and stress fibers, which correlates with its
          ability to suppress anchorage independent growth. In
          epithelial cells, Eplin is required for formation of
          the F-actin adhesion belt by binding to the
          E-cadherin-catenin complex through alpha-catenin. Eplin
          is expressed in two isoforms, a longer Eplin-beta and a
          shorter Eplin-alpha. Eplin-alpha mRNA is detected in
          various tissues and cell lines, but is absent or down
          regulated in cancer cells. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 53

 Score = 27.5 bits (61), Expect = 0.76
 Identities = 15/43 (34%), Positives = 23/43 (53%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          ++Y  ER  +  + +H SC RC  CN  L  G+++   G  YC
Sbjct: 7  TVYPLERLVANQQIYHNSCFRCSYCNTKLSLGTYASLHGNIYC 49


>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b.  The first
          LIM domain of Lhx3b. Lhx3b is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx3b is one of the two isoforms of Lhx3. The Lhx3 gene
          is expressed in the ventral spinal cord, the pons, the
          medulla oblongata, and the pineal gland of the
          developing nervous system during mouse embryogenesis,
          and transcripts are found in the emergent pituitary
          gland. Lhx3 functions in concert with other
          transcription factors to specify interneuron and motor
          neuron fates during development. Lhx3 proteins have
          been demonstrated to directly bind to the promoters of
          several pituitary hormone gene promoters. The Lhx3 gene
          encodes two isoforms, LHX3a and LHX3b that differ in
          their amino-terminal sequences, where Lhx3a has longer
          N-terminal.  They show differential activation of
          pituitary hormone genes and distinct DNA binding
          properties. In human, Lhx3a trans-activated the
          alpha-glycoprotein subunit promoter and genes
          containing a high-affinity Lhx3 binding site more
          effectively than the hLhx3b isoform. In addition,
          hLhx3a induce transcription of the TSHbeta-subunit gene
          by acting on pituitary POU domain factor, Pit-1, while
          hLhx3b does not. As in other LIM domains, this domain
          family is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 55

 Score = 27.6 bits (61), Expect = 0.77
 Identities = 12/33 (36%), Positives = 15/33 (45%), Gaps = 1/33 (3%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L + WH  CL+C +C   L     S  D   YC
Sbjct: 20 LDRHWHSKCLKCSDCQTQLAEKCFSRGDSV-YC 51


>gnl|CDD|188865 cd09481, LIM1_CRP3, The first LIM domain of Cysteine Rich Protein
          3 (CRP3/MLP).  The first LIM domain of Cysteine Rich
          Protein 3 (CRP3/MLP): Cysteine-rich proteins (CRPs) are
          characterized by the presence of two LIM domains linked
          to short glycine-rich repeats (GRRs). The CRP family
          members include CRP1, CRP2, CRP3/MLP and TLPCRP1, CRP2
          and CRP3 share a conserved nuclear targeting signal
          (K/R-K/R-Y-G-P-K), which supports the fact that these
          proteins function not only in the cytoplasm but also in
          the nucleus. CRPs control regulatory pathways during
          cellular differentiation, and involve in complex
          transcription circuits, and the organization as well as
          the arrangement of the myofibrillar/cytoskeletal
          network.CRP3 also called Muscle LIM Protein (MLP),
          which is a striated muscle-specific factor that
          enhances myogenic differentiation. CRP3/MLP interacts
          with cytoskeletal protein beta-spectrin. CRP3/MLP also
          interacts with the basic helix-loop-helix myogenic
          transcriptio n factors MyoD, myogenin, and MRF4 thereby
          increasing their affinity for specific DNA regulatory
          elements. LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 54

 Score = 27.8 bits (61), Expect = 0.80
 Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          ++Y AE     G+ +H +C  C  C K L   + + H+ + YC   CY
Sbjct: 8  TVYHAEEIQCNGRSFHKTCFICMACRKALDSTTVAAHESEIYCK-TCY 54


>gnl|CDD|188797 cd09413, LIM1_Testin, The first LIM domain of Testin.  The first
          LIM domain of Testin: Testin contains three C-terminal
          LIM domains and a PET protein-protein interaction
          domain at the N-terminal.   Testin is a cytoskeleton
          associated focal adhesion protein that localizes along
          actin stress fibers, at cell-cell-contact areas, and at
          focal adhesion plaques. Testin interacts with a variety
          of cytoskeletal proteins, including zyxin, mena, VASP,
          talin, and actin and it is involved in cell motility
          and adhesion events. Knockout mice experiments reveal
          that tumor repressor function of Testin. LIM domains
          are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 27.8 bits (62), Expect = 0.81
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 1/39 (2%)

Query: 54 AERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          AER     K WH +C  C  C + LV   +   +GK YC
Sbjct: 17 AER-AGYDKLWHPACFVCSTCGELLVDMIYFWKNGKLYC 54


>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like
          family.  The third LIM domain of Enigma-like family:
          The Enigma LIM domain family is comprised of three
          members: Enigma, ENH, and Cypher (mouse)/ZASP (human).
          These subfamily members contain a single PDZ domain at
          the N-terminus and three LIM domains at the C-terminus.
          Enigma was initially characterized in humans and is
          expressed in multiple tissues, such as skeletal muscle,
          heart, bone, and brain. The third LIM domain
          specifically interacts with the insulin receptor and
          the second LIM domain interacts with the receptor
          tyrosine kinase Ret and the adaptor protein APS.  Thus
          Enigma is implicated in signal transduction processes,
          such as mitogenic activity, insulin related actin
          organization, and glucose metabolism. The second
          member, ENH protein, was first identified in rat brain.
           It has been shown that ENH interacts with protein
          kinase D1 (PKD1) via its LIM domains and forms a
          complex with PKD1 and the alpha1C subunit of cardiac
          L-type voltage-gated calcium channel in rat neonatal
          cardiomyocytes. The N-terminal PDZ domain interacts
          with alpha-actinin at the Z-line. ZASP/Cypher is
          required for maintenance of Z-line structure during
          muscle contraction, but not required for Z-line
          assembly. In heart, Cypher/ZASP plays a structural role
          through its interaction with cytoskeletal Z-line
          proteins. In addition, there is increasing evidence
          that Cypher/ZASP also performs signaling functions.
          Studies reveal that Cypher/ZASP interacts with and
          directs PKC to the Z-line, where PKC phosphorylates
          downstream signaling targets. LIM domains are 50-60
          amino acids in size and share two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 54

 Score = 27.4 bits (61), Expect = 1.0
 Identities = 11/34 (32%), Positives = 15/34 (44%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +LG  WH +C  C  C+  L   +      KP C
Sbjct: 17 ALGHTWHDTCFVCAVCHVNLEGQTFYSKKDKPLC 50


>gnl|CDD|188820 cd09436, LIM3_TRIP6, The third LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The third LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 66

 Score = 27.7 bits (61), Expect = 1.0
 Identities = 11/28 (39%), Positives = 16/28 (57%)

Query: 56 RKTSLGKDWHGSCLRCENCNKTLVPGSH 83
          R  +L +D+H  C RCE+C   L  G +
Sbjct: 19 RIVALDRDFHVQCYRCEDCGSLLSEGDN 46


>gnl|CDD|188822 cd09438, LIM3_Ajuba_like, The third LIM domain of Ajuba-like
          proteins.  The third LIM domain of Ajuba-like proteins:
          Ajuba like LIM protein family includes three highly
          homologous proteins Ajuba, Limd1, and WTIP. Members of
          the family contain three tandem C-terminal LIM domains
          and a proline-rich N-terminal region. This family of
          proteins functions as scaffolds, participating in the
          assembly of numerous protein complexes. In the
          cytoplasm, Ajuba binds Grb2 to modulate
          serum-stimulated ERK activation. Ajuba also recruits
          the TNF receptor-associated factor 6 (TRAF6) to p62 and
          activates PKCKappa activity. Ajuba interacts with
          alpha-catenin and F-actin to contribute to the
          formation or stabilization of adheren junctions by
          linking adhesive receptors to the actin cytoskeleton.
          Although Ajuba is a cytoplasmic protein, it can shuttle
          into the nucleus. In nucleus, Ajuba functions as a
          corepressor for the zinc finger-protein Snail. It binds
          to the SNAG repression domain of Snail through its LIM
          region.  Arginine methyltransferase-5 (Prmt5), a
          protein in the complex, is recruited to Snai l through
          an interaction with Ajuba. This ternary complex
          functions to repress E-cadherin, a Snail target gene.
          In addition, Ajuba contains functional nuclear-receptor
          interacting motifs and selectively interacts with
          retinoic acid receptors (RARs) and rexinoid receptor
          (RXRs) to negatively regulate retinoic acid signaling.
          Wtip, the Wt1-interacting protein, was originally
          identified as an interaction partner of the Wilms
          tumour protein 1 (WT1). Wtip is involved in kidney and
          neural crest development. Wtip interacts with the
          receptor tyrosine kinase Ror2 and inhibits canonical
          Wnt signaling. LIMD1 was reported to inhibit cell
          growth and metastases. The inhibition may be mediated
          through an interaction with the protein
          barrier-to-autointegration (BAF), a component of
          SWI/SNF chromatin-remodeling protein; or through the
          interaction with retinoblastoma protein (pRB),
          resulting in inhibition of E2F-mediated transcription,
          and expression of the majority of genes with E2F1-
          responsive elements. Recently, Limd1 was shown to
          interact with the p62/sequestosome protein and
          influence IL-1 and RANKL signaling by facilitating the
          assembly of a p62/TRAF6/a-PKC multi-protein complex.
          The Limd1-p62 interaction affects both NF-kappaB and
          AP-1 activity in epithelial cells and osteoclasts.
          Moreover, LIMD1 functions as tumor repressor to block
          lung tumor cell line in vitro and in vivo. Recent
          studies revealed that LIM proteins Wtip, LIMD1 and
          Ajuba interact with components of RNA induced silencing
          complexes (RISC) as well as eIF4E and the mRNA m7GTP
          cap-protein complex and are required for
          microRNA-mediated gene silencing.  As in other LIM
          domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein.
          Length = 62

 Score = 27.4 bits (61), Expect = 1.2
 Identities = 10/23 (43%), Positives = 13/23 (56%)

Query: 56 RKTSLGKDWHGSCLRCENCNKTL 78
          R  S+ KD+H  C  CE+C   L
Sbjct: 19 RVVSMDKDYHVECYHCEDCGLQL 41


>gnl|CDD|234804 PRK00629, pheT, phenylalanyl-tRNA synthetase subunit beta;
           Reviewed.
          Length = 791

 Score = 29.4 bits (67), Expect = 1.3
 Identities = 13/48 (27%), Positives = 19/48 (39%), Gaps = 21/48 (43%)

Query: 137 RSDCLSMYGGKGNTSHTMIPDTYITQVTIVIARCLSSVYSIQLVKPSI 184
           R+DCLS+ G                     IAR L+++  + L  P I
Sbjct: 165 RADCLSVRG---------------------IARELAALLGLPLKLPEI 191


>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid
          receptor-interacting protein 6 (TRIP6).  The first LIM
          domain of Thyroid receptor-interacting protein 6
          (TRIP6): TRIP6 is a member of the zyxin LIM protein
          family and contains three LIM zinc-binding domains at
          the C-terminal. TRIP6 protein localizes to focal
          adhesion sites and along actin stress fibers.
          Recruitment of this protein to the plasma membrane
          occurs in a lysophosphatidic acid (LPA)-dependent
          manner. TRIP6 recruits a number of molecules involved
          in actin assembly, cell motility, survival and
          transcriptional control. The function of TRIP6 in cell
          motility is regulated by Src-dependent phosphorylation
          at a Tyr residue. The phosphorylation activates the
          coupling to the Crk SH2 domain, which is required for
          the function of TRIP6 in promoting lysophosphatidic
          acid (LPA)-induced cell migration. TRIP6 can shuttle to
          the nucleus to serve as a coactivator of AP-1 and
          NF-kappaB transcriptional factors. Moreover, TRIP6 can
          form a ternary complex with the NHERF2 PDZ protein and
          LPA2 receptor to regulate LPA-induced activation of ERK
          and AKT, rendering cells resistant to chemotherapy.
          Recent evidence shows that TRIP6 antagonizes
          Fas-Induced apoptosis by enhancing the antiapoptotic
          effect of LPA in cells. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 54

 Score = 27.0 bits (60), Expect = 1.3
 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 1/40 (2%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          T++ + +H  C  C  CN  L        + K YC  PCY
Sbjct: 16 TAMDQVFHVDCFTCMTCNGKLRGQPFYAVEKKAYCE-PCY 54


>gnl|CDD|188870 cd09486, LIM_Eplin_like_1, a LIM domain subfamily on a group of
          proteins with unknown function.  This model represents
          a LIM domain subfamily of Eplin-like family.  This
          family shows highest homology to the LIM domains on
          Eplin and XIRP2 protein families. Epithelial Protein
          Lost in Neoplasm is a cytoskeleton-associated tumor
          suppressor whose expression inversely correlates with
          cell growth, motility, invasion and cancer mortality.
          Xirp2 is expressed in muscles and is an important
          effector of the Ang II signaling pathway in the heart.
          As in other LIM domains, this domain family is 50-60
          amino acids in size and shares two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 53

 Score = 26.9 bits (59), Expect = 1.6
 Identities = 15/43 (34%), Positives = 24/43 (55%)

Query: 50 SMYLAERKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          ++Y  ER  +    +H SC  C++CN  L  GS++   G+ YC
Sbjct: 7  TVYPMERLVADKLVFHNSCFCCKHCNAKLSLGSYAALHGEFYC 49


>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4
          family.  The first LIM domain of Lhx3-Lhx4 family: Lhx3
          and Lhx4 belong to the LHX protein family, which
          features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          The LHX3 and LHX4 LIM-homeodomain transcription factors
          play essential roles in pituitary gland and nervous
          system development. Although LHX3 and LHX4 share marked
          sequence homology, the genes have different expression
          patterns. They play overlapping, but distinct functions
          during the establishment of the specialized cells of
          the mammalian pituitary gland and the nervous system.
          Lhx3 proteins have been demonstrated the ability to
          directly bind to the promoters/enhancers of several
          pituitary hormone gene promoters to cause increased
          transcription. Lhx3a and Lhx3b, whose mRNAs have
          distinct temporal expression profiles during
          development, are two isoforms of Lhx3. LHX4 plays
          essential roles in pituitary gland and nervous system
          development. In mice, the lhx4 gene is expressed in the
          developing hindbrain, cerebral cortex, pituitary gland,
          and spinal cord. LHX4 shows significant sequence
          similarity to LHX3, particularly to isoforms Lhx3a. In
          gene regulation experiments, the LHX4 protein exhibits
          regulation roles towards pituitary genes, acting on
          their promoters/enhancers. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 52

 Score = 26.6 bits (59), Expect = 1.6
 Identities = 11/33 (33%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L + WH  CL+C +C   L     +  +G  YC
Sbjct: 17 LDRTWHAKCLKCNDCGAQLTDKCFAR-NGHVYC 48


>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM
           domains protein 2 (FHL2).  The third LIM domain of Four
           and a half LIM domains protein 2 (FHL2):  FHL2 is one of
           the best studied FHL proteins. FHL2 expression is most
           abundant in the heart, and in brain, liver and lung to a
           lesser extent. FHL2 participates in a wide range of
           cellular processes, such as transcriptional regulation,
           signal transduction, and cell survival by binding to
           various protein partners. FHL2 has shown to interact
           with more than 50 different proteins, including
           receptors, structural proteins, transcription factors
           and cofactors, signal transducers, splicing factors, DNA
           replication and repair enzymes, and metabolic enzymes.
           Although FHL2 is abundantly expressed in heart, the fhl2
           null mice are viable and had no detectable abnormal
           cardiac phenotype. LIM domains are 50-60 amino acids in
           size and share two characteristic zinc finger motifs.
           The two zinc fingers contain eight conserved residues,
           mostly cysteines and histidines, which coordinately bond
           to two zinc atoms. LIM domains function as adaptors or
           scaffolds to s upport the assembly of multimeric protein
           complexes.
          Length = 57

 Score = 26.9 bits (59), Expect = 1.7
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 1/39 (2%)

Query: 64  WHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYSALFS 102
           WH  C  C  C K L     +  D   YC   C+  L++
Sbjct: 20  WHKECFVCTGCKKQLSGQRFTSRDDFAYC-LNCFCNLYA 57


>gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM
          domains protein 2 (FHL2).  The first LIM domain of Four
          and a half LIM domains protein 2 (FHL2):  FHL2 is one
          of the best studied FHL proteins. FHL2 expression is
          most abundant in the heart, and in brain, liver and
          lung at lesser extent. FHL2 participates in a wide
          range of cellular processes, such as transcriptional
          regulation, signal transduction, and cell survival by
          binding to various protein partners. FHL2 has shown to
          interact with more than 50 different proteins,
          including receptors, structural proteins, transcription
          factors and cofactors, signal transducers, splicing
          factors, DNA replication and repair enzymes, and
          metabolic enzymes. Although FHL2 is abundantly
          expressed in heart, the fhl2 null mice are viable and
          had no detectable abnormal cardiac phenotype. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 62

 Score = 26.8 bits (59), Expect = 1.8
 Identities = 12/37 (32%), Positives = 16/37 (43%), Gaps = 1/37 (2%)

Query: 62 KDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCYS 98
          + WH SC  C  C  +LV    +  +    C   CYS
Sbjct: 24 RHWHESCFHCFQCKNSLVDKPFAAKEEHLLCT-ECYS 59


>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9.  The second
          LIM domain of Lhx9: Lhx9 belongs to the LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain.
          Members of LHX family are found in the nucleus and act
          as transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          Lhx9 is highly homologous to Lhx2. It is expressed in
          several regions of the developing mouse brain, the
          spinal cord, the pancreas, in limb mesenchyme, and in
          the urogenital region. Lhx9 plays critical roles in
          gonad development.  Homozygous mice lacking functional
          Lhx9 alleles exhibit numerous urogenital defects, such
          as gonadal agenesis, infertility, and undetectable
          levels of testosterone and estradiol coupled with high
          FSH levels. Lhx9 null mice have reduced levels of the
          Sf1 nuclear receptor that is required for
          gonadogenesis, and recent studies have shown that Lhx9
          is able to activate the Sf1/FtzF1 gene. Lhx9 null mice
          are phenotypically female, even those that are
          genotypically male.  As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 59

 Score = 27.0 bits (59), Expect = 1.8
 Identities = 11/20 (55%), Positives = 12/20 (60%)

Query: 64 WHGSCLRCENCNKTLVPGSH 83
          +H SC  C  CNKTL  G H
Sbjct: 26 YHLSCFTCTTCNKTLTTGDH 45


>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM
          (abLIM) proteins.  The second LIM domain of actin
          binding LIM (abLIM) proteins:  Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 26.5 bits (59), Expect = 2.0
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 58 TSLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPY 91
          ++LGK +H  C  C  C +   PG     +GK  
Sbjct: 17 SALGKTYHPKCFVCSVCRQPFPPGDRVTFNGKEC 50


>gnl|CDD|188819 cd09435, LIM3_Zyxin, The third LIM domain of Zyxin.  The third
          LIM domain of Zyxin: Zyxin exhibits three copies of the
          LIM domain, an extensive proline-rich domain and a
          nuclear export signal.  Localized at sites of
          cellsubstratum adhesion in fibroblasts, Zyxin interacts
          with alpha-actinin, members of the cysteine-rich
          protein (CRP) family, proteins that display Src
          homology 3 (SH3) domains and Ena/VASP family members.
          Zyxin and its partners have been implicated in the
          spatial control of actin filament assembly as well as
          in pathways important for cell differentiation. In
          addition to its functions at focal adhesion plaques,
          recent work has shown that zyxin moves from the sites
          of cell contacts to the nucleus, where it directly
          participates in the regulation of gene expression. As
          in other LIM domains, this domain family is 50-60 amino
          acids in size and shares two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 67

 Score = 26.8 bits (59), Expect = 2.1
 Identities = 9/23 (39%), Positives = 15/23 (65%)

Query: 56 RKTSLGKDWHGSCLRCENCNKTL 78
          R  +L K++H  C +CE+C + L
Sbjct: 19 RVVALEKNFHMKCYKCEDCGRPL 41


>gnl|CDD|219945 pfam08634, Pet127, Mitochondrial protein Pet127.  Pet127 has been
           implicated in mitochondrial RNA stability and/or
           processing and is localised to the mitochondrial
           membrane. The Pet127 family is part of the PD-(D/E)XK
           nuclease superfamily including a full set of active site
           residues.
          Length = 274

 Score = 28.5 bits (64), Expect = 2.1
 Identities = 10/25 (40%), Positives = 15/25 (60%)

Query: 102 SERSKFLGCLSSVCSILSQTFYSLS 126
             + K++   SS+ SILSQ  + LS
Sbjct: 16  EHKKKYVSSTSSMTSILSQLHFLLS 40


>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM
          and RhoGap domain containing protein.  The first LIM
          domain of Lrg1p, a LIM and RhoGap domain containing
          protein: The members of this family contain three
          tandem repeats of LIM domains and a Rho-type GTPase
          activating protein (RhoGap) domain. Lrg1p is a Rho1
          GTPase-activating protein required for efficient cell
          fusion in yeast. Lrg1p-GAP domain strongly and
          specifically stimulates the GTPase activity of Rho1p, a
          regulator of beta (1-3)-glucan synthase in vitro. The
          LIM domain is 50-60 amino acids in size and shares two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein.
          Length = 57

 Score = 26.5 bits (59), Expect = 2.3
 Identities = 7/21 (33%), Positives = 10/21 (47%)

Query: 60 LGKDWHGSCLRCENCNKTLVP 80
          LG  +H  C  C +C K +  
Sbjct: 16 LGDVYHLDCFTCHDCGKPVAS 36


>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma.  The
          second LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS.  Thus Enigma is implicated
          in signal transduction processes, such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 52

 Score = 26.1 bits (57), Expect = 2.4
 Identities = 10/34 (29%), Positives = 14/34 (41%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +L   WH  C  C  C   +   +    +G PYC
Sbjct: 15 ALKMTWHVHCFTCAACKTPIRNRAFYMEEGAPYC 48


>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM
          domains protein (FHL).  The fourth LIM domain of Four
          and a half LIM domains protein (FHL): LIM-only protein
          family consists of five members, designated FHL1, FHL2,
          FHL3, FHL5 and LIMPETin. The first four members are
          composed of four complete LIM domains arranged in
          tandem and an N-terminal single zinc finger domain with
          a consensus sequence equivalent to the C-terminal half
          of a LIM domain. LIMPETin is an exception, containing
          six LIM domains. FHL1, 2 and 3 are predominantly
          expressed in muscle tissues, and FHL5 is highly
          expressed in male germ cells.  FHL proteins exert their
          roles as transcription co-activators or co-repressors
          through a wide array of interaction partners. For
          example, FHL1 binds to Myosin-binding protein C,
          regulating myosin filament formation and sarcomere
          assembly. FHL2 has shown to interact with more than 50
          different proteins, including receptors, structural
          proteins, transcription factors and cofactors, signal
          transducers, splicing factors, DNA replication and
          repair enzymes, and metabolic enzymes. FHL3 interacts
          with many transcription factors, such as CREB,
          BKLF/KLF3, CtBP2, MyoD, and MZF_1. FHL5 is a
          tissue-specific coactivator of CREB/CREM family
          transcription factors. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 26.2 bits (58), Expect = 2.5
 Identities = 7/18 (38%), Positives = 10/18 (55%)

Query: 62 KDWHGSCLRCENCNKTLV 79
          + WH  C  C  C+ +LV
Sbjct: 22 RQWHSDCFNCGKCSVSLV 39


>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4.  The first LIM
          domain of Lhx4. Lhx4 belongs to the LHX protein family,
          which features two tandem N-terminal LIM domains and a
          C-terminal DNA binding homeodomain. Members of LHX
          family are found in the nucleus and act as
          transcription factors or cofactors. LHX proteins are
          critical for the development of specialized cells in
          multiple tissue types, including the nervous system,
          skeletal muscle, the heart, the kidneys, and endocrine
          organs, such as the pituitary gland and the pancreas.
          LHX4 plays essential roles in pituitary gland and
          nervous system development. In mice, the lhx4 gene is
          expressed in the developing hindbrain, cerebral cortex,
          pituitary gland, and spinal cord. LHX4 shows
          significant sequence similarity to LHX3, particularly
          to isoforms Lhx3a. In gene regulation experiments, the
          LHX4 protein exhibits regulation roles towards
          pituitary genes, acting on their promoters/enhancers.
          As in other LIM domains, this domain family is 50-60
          amino acids in size and shares two characteristic zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein.
          Length = 52

 Score = 26.1 bits (57), Expect = 2.5
 Identities = 13/33 (39%), Positives = 16/33 (48%), Gaps = 1/33 (3%)

Query: 60 LGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          L + WH SCL+C +C   L     S   G  YC
Sbjct: 17 LDRHWHSSCLKCADCQMQLAERCFSRA-GNVYC 48


>gnl|CDD|180204 PRK05690, PRK05690, molybdopterin biosynthesis protein MoeB;
           Provisional.
          Length = 245

 Score = 28.3 bits (64), Expect = 2.7
 Identities = 13/41 (31%), Positives = 16/41 (39%), Gaps = 8/41 (19%)

Query: 71  CENCNKTLVPGSHSEHDG-----KPYCNYPCY---SALFSE 103
           C    K LV G+    +G         + PCY   S LF E
Sbjct: 143 CFAAKKPLVSGAAIRMEGQVTVFTYQDDEPCYRCLSRLFGE 183


>gnl|CDD|188805 cd09421, LIM3_LIMPETin, The third LIM domain of protein LIMPETin.
           The third LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 59

 Score = 26.0 bits (57), Expect = 3.0
 Identities = 12/36 (33%), Positives = 15/36 (41%), Gaps = 1/36 (2%)

Query: 62 KDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          K WH +C  C  C  +LV         + YC   CY
Sbjct: 24 KHWHEACFLCSKCKISLVDKPFGSKADRIYCG-NCY 58


>gnl|CDD|188827 cd09443, LIM_Ltd-1, The LIM domain of LIM and transglutaminase
          domains protein (Ltd-1).  The LIM domain of LIM and
          transglutaminase domains protein (Ltd-1): This family
          includes mouse Ky protein and Caenorhabditis elegans
          Ltd-1 protein. The members of this family consists a
          N-terminal  Lim domain and a C-terminal
          transglutaminase domain. The mouse Ky protein has
          putative function in muscle development. The mouse with
          ky mutant exhibits combined posterior and lateral
          curvature of the spine. The Ltd-1 gene in C. elegans is
          expressed in developing hypodermal cells from the
          twofold stage embryo through adulthood. These data
          define the ltd-1 gene as a novel marker for C. elegans
          epithelial cell development. As in other LIM domains,
          this domain family is 50-60 amino acids in size and
          shares two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 55

 Score = 25.8 bits (57), Expect = 3.1
 Identities = 9/27 (33%), Positives = 11/27 (40%)

Query: 52 YLAERKTSLGKDWHGSCLRCENCNKTL 78
          Y AE     G  +H  C +C  C   L
Sbjct: 9  YPAESVDKDGTFYHKGCFKCRECGTRL 35


>gnl|CDD|188728 cd09342, LIM3_Testin_like, The third LIM domain of Testin-like
          family.  The third LIM domain of Testin_like family:
          This family includes testin, prickle, dyxin and
          LIMPETin. Structurally, testin and prickle proteins
          contain three LIM domains at C-terminal; LIMPETin has
          six LIM domains; and dyxin presents only two LIM
          domains. However, all members of the family contain a
          PET protein-protein interaction domain. Testin is a
          cytoskeleton associated focal adhesion protein that
          localizes along actin stress fibers, at
          cell-cell-contact areas, and at focal adhesion plaques.
          Testin interacts with a variety of cytoskeletal
          proteins, including zyxin, mena, VASP, talin, and actin
          and it is involved in cell motility and adhesion
          events. Prickles have been implicated in roles of
          regulating tissue polarity or planar cell polarity
          (PCP).  Dyxin involves in lung and heart development by
          interaction with GATA6 and blocking GATA6 activated
          target genes. LIMPETin might be the recombinant product
          of genes coding testin and four and half LIM proteins
          and its function is not well understood. As in other
          LIM domains, this domain family is 50-60 amino acids in
          size and shares two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 57

 Score = 26.2 bits (58), Expect = 3.1
 Identities = 13/45 (28%), Positives = 21/45 (46%), Gaps = 2/45 (4%)

Query: 54 AERKTSLGKDWHG--SCLRCENCNKTLVPGSHSEHDGKPYCNYPC 96
           +R    G+ WH    C  C NC K+L+       +G+ +C+  C
Sbjct: 12 VQRVAHNGQHWHATEECFCCSNCKKSLLGQPFLPKNGQIFCSPKC 56


>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX
          protein family.  The second LIM domain of Isl: Isl is a
          member of LHX protein family, which features two tandem
          N-terminal LIM domains and a C-terminal DNA binding
          homeodomain. Isl1 and Isl2 are the two conserved
          members of this family. Proteins in this group are
          found in the nucleus and act as transcription factors
          or cofactors. LHX proteins are critical for the
          development of specialized cells in multiple tissue
          types, including the nervous system, skeletal muscle,
          the heart, the kidneys, and endocrine organs, such as
          the pituitary gland and the pancreas. Isl-1 is one of
          the LHX proteins isolated originally by virtue of its
          ability to bind DNA sequences from the 5'-flanking
          region of the rat insulin gene in pancreatic
          insulin-producing cells. Mice deficient in Isl-1 fail
          to form the dorsal exocrine pancreas and islet cells
          fail to differentiate. On the other hand, Isl-1 takes
          part in the pituitary development by activating the
          gonadotropin-releasing hormone receptor gene together
          with LHX3 and steroidogenic factor 1. Mouse Isl2 is
          expressed in the retinal ganglion cells and the
          developing spinal cord where it plays a role in motor
          neuron development. Same as Isl1, Isl2 may also be able
          to bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 25.9 bits (57), Expect = 3.5
 Identities = 9/20 (45%), Positives = 13/20 (65%)

Query: 62 KDWHGSCLRCENCNKTLVPG 81
          K +H  C RC  C++ L+PG
Sbjct: 20 KIYHIECFRCSACSRQLIPG 39


>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher
          family.  The third LIM domain of ZASP/Cypher family:
          ZASP was identified in human heart and skeletal muscle
          and Cypher is a mice ortholog of ZASP. ZASP/Cyppher
          contains three LIM domains at the C-terminus and a PDZ
          domain at N-terminus.  ZASP/Cypher is required for
          maintenance of Z-line structure during muscle
          contraction, but not required for Z-line assembly. In
          heart, Cypher/ZASP plays a structural role through its
          interaction with cytoskeletal Z-line proteins. In
          addition, there is increasing evidence that Cypher/ZASP
          also performs signaling functions. Studies reveal that
          Cypher/ZASP interacts with and directs PKC to the
          Z-line, where PKC phosphorylates downstream signaling
          targets. LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 55

 Score = 25.8 bits (56), Expect = 3.9
 Identities = 11/34 (32%), Positives = 14/34 (41%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +LG  WH +C  C  C+  L          KP C
Sbjct: 17 ALGHTWHDTCFICAVCHVNLEGQPFYSKKDKPLC 50


>gnl|CDD|188816 cd09432, LIM6_LIMPETin, The sixth LIM domain of protein LIMPETin.
           The sixth LIM domain of protein LIMPETin: LIMPETin
          contains 6 LIM domains at the C-terminal and an
          N-terminal PET domain. Four of the six LIM domains are
          highly homologous to the four and half LIM domain
          protein family and two of them show sequence similarity
          to the LIM domains of the testin family. Thus, LIMPETin
          may be the recombinant product of genes coding testin
          and FHL proteins.  In Schistosoma mansoni, where
          LIMPETin was first identified, LIMPETin is down
          regulated in sexually mature adult Schistosoma females
          compared to sexually immature adult females and adult
          male. Its differential expression indicates that it is
          a transcription regulator. LIM domains are 50-60 amino
          acids in size and share two characteristic zinc finger
          motifs. The two zinc fingers contain eight conserved
          residues, mostly cysteines and histidines, which
          coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 56

 Score = 25.5 bits (56), Expect = 4.3
 Identities = 7/19 (36%), Positives = 9/19 (47%)

Query: 61 GKDWHGSCLRCENCNKTLV 79
           + WH  C  C  C  +LV
Sbjct: 21 DRHWHNDCFNCAGCRTSLV 39


>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2.  The second
          LIM domain of Isl2: Isl is a member of LHX protein
          family, which features two tandem N-terminal LIM
          domains and a C-terminal DNA binding homeodomain. LHX
          proteins are critical for the development of
          specialized cells in multiple tissue types, including
          the nervous system, skeletal muscle, the heart, the
          kidneys, and endocrine organs, such as the pituitary
          gland and the pancreas. Isl proteins are found in the
          nucleus and act as transcription factors or cofactors.
          Isl1 and Isl2 are the two conserved members of this
          family. Mouse Isl2 is expressed in the retinal ganglion
          cells and the developing spinal cord where it plays a
          role in motor neuron development. Isl2 may be able to
          bind to the insulin gene enhancer to promote gene
          activation. All LIM domains are 50-60 amino acids in
          size and share two characteristic zinc finger motifs.
          The two zinc fingers contain eight conserved residues,
          mostly cysteines and histidines, which coordinately
          bond to two zinc atoms. LIM domains function as
          adaptors or scaffolds to support the assembly of
          multimeric protein complexes.
          Length = 55

 Score = 25.7 bits (56), Expect = 4.4
 Identities = 8/18 (44%), Positives = 12/18 (66%)

Query: 64 WHGSCLRCENCNKTLVPG 81
          +H  C RC  C++ L+PG
Sbjct: 22 YHIECFRCSVCSRQLLPG 39


>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM
          domains protein 3 (FHL3).  The second LIM domain of
          Four and a half LIM domains protein 3 (FHL3):  FHL3 is
          highly expressed in the skeleton and cardiac muscles
          and possesses the transactivation and repression
          activities. FHL3 interacts with many transcription
          factors, such as CREB, BKLF/KLF3, CtBP2, MyoD, and
          MZF_1. Moreover, FHL3 interacts with alpha- and
          beta-subunits of the muscle alpha7beta1 integrin
          receptor. FHL3 was also proved to possess the
          auto-activation ability and was confirmed that the
          second zinc finger motif in fourth LIM domain was
          responsible for the auto-activation of FHL3. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 58

 Score = 25.6 bits (56), Expect = 5.0
 Identities = 12/37 (32%), Positives = 16/37 (43%), Gaps = 1/37 (2%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYCNYPCY 97
          G+ WH  C  C  C + +   S      + YC  PCY
Sbjct: 22 GQTWHEHCFICHGCEQPIGSRSFIPDKDEHYC-VPCY 57


>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma.  The third
          LIM domain of Enigma: Enigma was initially
          characterized in humans as a protein containing three
          LIM domains at the C-terminus and a PDZ domain at
          N-terminus.  The third LIM domain specifically
          interacts with the insulin receptor and the second LIM
          domain interacts with the receptor tyrosine kinase Ret
          and the adaptor protein APS.  Thus Enigma is implicated
          in signal transduction processes such as mitogenic
          activity, insulin related actin organization, and
          glucose metabolism. Enigma is expressed in multiple
          tissues, such as skeletal muscle, heart, bone, and
          brain.  LIM domains are 50-60 amino acids in size and
          share two characteristic zinc finger motifs. The two
          zinc fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric protein
          complexes.
          Length = 55

 Score = 25.4 bits (55), Expect = 6.3
 Identities = 11/34 (32%), Positives = 14/34 (41%)

Query: 59 SLGKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
          +LG  WH +C  C  C   L   +      KP C
Sbjct: 17 ALGFSWHDTCFVCAICQINLEGKTFYSKKDKPLC 50


>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM
          (abLIM) proteins.  The first LIM domain of actin
          binding LIM (abLIM) proteins:  Three homologous members
          of the abLIM protein family have been identified;
          abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM
          consists of four tandem repeats of LIM domains and the
          C-terminal of acting binding LIM protein is a villin
          headpiece domain, which has strong actin binding
          activity. The abLIM-1, which is expressed in retina,
          brain, and muscle tissue, has been indicated to
          function as a tumor suppressor. AbLIM-2 and -3, mainly
          expressed in muscle and neuronal tissue, bind to
          F-actin strongly.  They may serve as a scaffold for
          signaling modules of the actin cytoskeleton and thereby
          modulate transcription. It has shown that LIM domains
          of abLIMs interact with STARS (striated muscle
          activator of Rho signaling), which directly binds actin
          and stimulates serum-response factor (SRF)-dependent
          transcription. All LIM domains are 50-60 amino acids in
          size and share two characteristic highly conserved zinc
          finger motifs. The two zinc fingers contain eight
          conserved residues, mostly cysteines and histidines,
          which coordinately bond to two zinc atoms. LIM domains
          function as adaptors or scaffolds to support the
          assembly of multimeric protein complexes.
          Length = 52

 Score = 24.9 bits (55), Expect = 6.7
 Identities = 10/32 (31%), Positives = 14/32 (43%)

Query: 61 GKDWHGSCLRCENCNKTLVPGSHSEHDGKPYC 92
           K +H  C  C+ C   L  G     +G+ YC
Sbjct: 17 DKYFHIKCFTCKVCGCDLAQGGFFVKEGEYYC 48


>gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM
          domains protein 3 (FHL3).  The fourth LIM domain of
          Four and a half LIM domains protein 3 (FHL3):  FHL3 is
          highly expressed in the skeleton and cardiac muscles
          and possesses the transactivation and repression
          activities. FHL3 interacts with many transcription
          factors, such as CREB, BKLF/KLF3, CtBP2, MyoD, and
          MZF_1. Moreover, FHL3 interacts with alpha- and
          beta-subunits of the muscle alpha7beta1 integrin
          receptor. FHL3 was also proved to possess the
          auto-activation ability and was confirmed that the
          second zinc finger motif in fourth LIM domain was
          responsible for the auto-activation of FHL3. LIM
          domains are 50-60 amino acids in size and share two
          characteristic zinc finger motifs. The two zinc fingers
          contain eight conserved residues, mostly cysteines and
          histidines, which coordinately bond to two zinc atoms.
          LIM domains function as adaptors or scaffolds to
          support the assembly of multimeric protein complexes.
          Length = 56

 Score = 24.7 bits (54), Expect = 8.4
 Identities = 7/18 (38%), Positives = 11/18 (61%)

Query: 62 KDWHGSCLRCENCNKTLV 79
          + WH  C +C  C+ +LV
Sbjct: 22 RQWHQPCFKCSRCSVSLV 39


>gnl|CDD|188821 cd09437, LIM3_LPP, The third LIM domain of lipoma preferred
          partner (LPP).  The third LIM domain of lipoma
          preferred partner (LPP): LPP is a member of the zyxin
          LIM protein family and contains three LIM zinc-binding
          domains at the C-terminal and proline-rich region at
          the N-terminal.  LPP initially identified as the most
          frequent translocation partner of HMGA2 (High Mobility
          Group A2) in a subgroup of benign tumors of adipose
          tissue (lipomas). It was also shown to be rearranged in
          a number of other soft tissues, as well as in a case of
          acute monoblastic leukemia. In addition to its
          involvement in tumors, LPP was inedited as a smooth
          muscle restricted LIM protein that plays an important
          role in SMC migration. LPP is localized at sites of
          cell adhesion, cell-cell contacts and transiently in
          the nucleus. In nucleus, it acts as a coactivator for
          the ETS domain transcription factor PEA3. In addition
          to PEA3, it interacts with alpha-actinin,vasodilator
          stimulated phosphoprotein (VASP), Palladin, and Scrib.
          The LIM domains are the main focal adhesion targeting
          elements and that the proline- rich region, which
          harbors binding sites for alpha-actinin and
          vasodilator- stimulated phosphoprotein (VASP), has a
          weak targeting capacity. As in other LIM domains, this
          domain family is 50-60 amino acids in size and shares
          two characteristic zinc finger motifs. The two zinc
          fingers contain eight conserved residues, mostly
          cysteines and histidines, which coordinately bond to
          two zinc atoms. LIM domains function as adaptors or
          scaffolds to support the assembly of multimeric
          protein.
          Length = 68

 Score = 24.7 bits (54), Expect = 9.9
 Identities = 11/33 (33%), Positives = 18/33 (54%), Gaps = 2/33 (6%)

Query: 56 RKTSLGKDWHGSCLRCENCNKTLVPGSHSEHDG 88
          R  +L + +H  C +CE+C   L+  S +E  G
Sbjct: 19 RVVALDRSFHVQCYKCEDCG--LLLSSEAEGRG 49


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.320    0.131    0.399 

Gapped
Lambda     K      H
   0.267   0.0693    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 9,220,105
Number of extensions: 772291
Number of successful extensions: 747
Number of sequences better than 10.0: 1
Number of HSP's gapped: 741
Number of HSP's successfully gapped: 136
Length of query: 201
Length of database: 10,937,602
Length adjustment: 92
Effective length of query: 109
Effective length of database: 6,857,034
Effective search space: 747416706
Effective search space used: 747416706
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (25.4 bits)