Query         psy2256
Match_columns 103
No_of_seqs    104 out of 1203
Neff          8.2 
Searched_HMMs 46136
Date          Fri Aug 16 20:06:41 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2256.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2256hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3624|consensus               99.9 2.6E-24 5.7E-29  168.6   4.4   74   29-103   612-687 (687)
  2 PF01431 Peptidase_M13:  Peptid  99.9 2.3E-24   5E-29  147.5  -1.8   75   28-102   130-206 (206)
  3 COG3590 PepO Predicted metallo  99.8 1.2E-19 2.7E-24  137.8   2.8   72   32-103   579-654 (654)
  4 COG3590 PepO Predicted metallo  99.0 3.7E-10   8E-15   86.7   3.7   55    1-58    597-651 (654)
  5 KOG3624|consensus               98.5 8.2E-08 1.8E-12   76.0   3.9   51    1-55    632-682 (687)
  6 PF01431 Peptidase_M13:  Peptid  98.4   4E-08 8.6E-13   67.2  -0.8   45    1-45    152-196 (206)
  7 PF15021 DUF4521:  Protein of u  26.2      54  0.0012   22.7   1.9   25   73-97     94-118 (206)
  8 smart00153 VHP Villin headpiec  18.5      80  0.0017   15.6   1.1   13   79-91      4-16  (36)
  9 PF15182 OTOS:  Otospiralin      15.8      32 0.00069   19.5  -0.8   21   23-43     34-54  (69)
 10 PF07576 BRAP2:  BRCA1-associat  15.1 1.6E+02  0.0034   18.3   2.1   22   80-102    68-89  (110)

No 1  
>KOG3624|consensus
Probab=99.89  E-value=2.6e-24  Score=168.63  Aligned_cols=74  Identities=46%  Similarity=0.814  Sum_probs=70.1

Q ss_pred             CCCcHHHH--HhcCCCchhhhcccCChHHhhhhhccCCCCCCcceeeecccCchhHHHhcCCCCCCCCCCCCceecC
Q psy2256          29 LSNLKEFA--RDFQCPEEFHMCALVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPVGSRMNPPHKCEVW  103 (103)
Q Consensus        29 l~~~~~f~--q~Ff~~~a~~~C~~~~~~~~~~~~~~d~h~p~~~Rvn~~l~n~~~F~~aF~C~~g~~m~p~~~C~iw  103 (103)
                      |+.++ |+  |+||++|||.||+..+++.....+.+++|+|+++||||+|+|+++|++||+|+.||+|||.+||.||
T Consensus       612 lp~l~-~t~~QLFFl~~Aq~~C~~~~~~~~~~~~~~~~H~~~~~RVng~lsN~~eFa~aF~C~~gS~MnP~~kC~v~  687 (687)
T KOG3624|consen  612 LPGLD-LTPEQLFFLSYAQFFCSSEDPKKLPESLLTDPHSPESFRVNGVLSNSPEFAEAFNCPIGSPMNPEKKCKVW  687 (687)
T ss_pred             CCCCC-CChhHHHHHHHHHHHhccCChhhhhHHhhcCCCCCcceeEeeeccCcHHHHHhcCCCCCCCCCccccCcCC
Confidence            77776 65  9999999999999999888888889999999999999999999999999999999999999999999


No 2  
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=99.87  E-value=2.3e-24  Score=147.46  Aligned_cols=75  Identities=43%  Similarity=0.736  Sum_probs=56.6

Q ss_pred             cCCCcHHHH--HhcCCCchhhhcccCChHHhhhhhccCCCCCCcceeeecccCchhHHHhcCCCCCCCCCCCCceec
Q psy2256          28 PLSNLKEFA--RDFQCPEEFHMCALVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPVGSRMNPPHKCEV  102 (103)
Q Consensus        28 ~l~~~~~f~--q~Ff~~~a~~~C~~~~~~~~~~~~~~d~h~p~~~Rvn~~l~n~~~F~~aF~C~~g~~m~p~~~C~i  102 (103)
                      .|++++.++  |+||++||+.||+..++......+..++|+|.++|||++|+|+++|++||+|+.||+|||.+||.+
T Consensus       130 ~l~~~~~~t~~QlFF~~~a~~~C~~~~~~~~~~~~~~~~h~p~~~RvN~~L~n~~~Fa~aF~C~~gs~Mnp~~kC~~  206 (206)
T PF01431_consen  130 RLPGLEGLTPDQLFFISFAQSFCEKMSPESVYRQLQTDPHSPARFRVNGPLSNMPEFAEAFNCPSGSPMNPKKKCRC  206 (206)
T ss_dssp             B-TTCTTB-HHHHHHHHHHHHT-EEE-HHHHHHHHHH-SS--HHHHHHHHHHT-HHHHHHHT--TTSTTS-SSGG--
T ss_pred             cccccccchhHHHHHHHHHHHHhcCcchhhhhhhhhcCCCCchHHHHHHHHhcCHHHHHHcCCCCCCCCCCCCCCcC
Confidence            455566665  999999999999998888777778889999999999999999999999999999999999999975


No 3  
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=99.77  E-value=1.2e-19  Score=137.80  Aligned_cols=72  Identities=32%  Similarity=0.579  Sum_probs=68.6

Q ss_pred             cHHHH--HhcCCCchhhhcccCChHHhhhhhccCCCCCCcceeeecccCchhHHHhcCCCCCCCC--CCCCceecC
Q psy2256          32 LKEFA--RDFQCPEEFHMCALVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPVGSRM--NPPHKCEVW  103 (103)
Q Consensus        32 ~~~f~--q~Ff~~~a~~~C~~~~~~~~~~~~~~d~h~p~~~Rvn~~l~n~~~F~~aF~C~~g~~m--~p~~~C~iw  103 (103)
                      +++|+  |+||++||++|..+.+++....++..|+|+|+++|||+++.|+++|++||.|++|++|  .|++|..||
T Consensus       579 ~dg~tg~qrfF~~wAqiWR~K~r~e~~~~~l~~DpHsP~~fR~Ng~~~N~~~FyeaFdVke~D~myr~pe~Rv~IW  654 (654)
T COG3590         579 IDGFTGLQRFFLNWAQIWRMKARPEEQQMRLSVDPHSPAEFRVNGPVRNMDEFYEAFDVKEGDAMYRAPEERVVIW  654 (654)
T ss_pred             ccccchHHHHHHHHHHHHhhccCHHHHHHHHccCCCCCceeeccCCCCChHHHHHHcCCCCCcccccChhhccccC
Confidence            45676  9999999999999999999999999999999999999999999999999999999999  499999999


No 4  
>COG3590 PepO Predicted metalloendopeptidase [Posttranslational modification, protein turnover, chaperones]
Probab=98.98  E-value=3.7e-10  Score=86.75  Aligned_cols=55  Identities=36%  Similarity=0.576  Sum_probs=49.5

Q ss_pred             CCCCcHHHHHHHHhhCCCCCCCceeeccCCCcHHHHHhcCCCchhhhcccCChHHhhh
Q psy2256           1 CTLVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPEEFHMCALVRPERLKF   58 (103)
Q Consensus         1 c~~~~~~~~~~~~~~d~h~p~~~R~~~~l~~~~~f~q~Ff~~~a~~~C~~~~~~~~~~   58 (103)
                      +++.++|+++.++.+|+|||+++|+||++.|+++|+++|-|..++   .+++.++.+.
T Consensus       597 R~K~r~e~~~~~l~~DpHsP~~fR~Ng~~~N~~~FyeaFdVke~D---~myr~pe~Rv  651 (654)
T COG3590         597 RMKARPEEQQMRLSVDPHSPAEFRVNGPVRNMDEFYEAFDVKEGD---AMYRAPEERV  651 (654)
T ss_pred             hhccCHHHHHHHHccCCCCCceeeccCCCCChHHHHHHcCCCCCc---ccccChhhcc
Confidence            368899999999999999999999999999999999999999998   7777665543


No 5  
>KOG3624|consensus
Probab=98.53  E-value=8.2e-08  Score=76.03  Aligned_cols=51  Identities=47%  Similarity=0.804  Sum_probs=46.1

Q ss_pred             CCCCcHHHHHHHHhhCCCCCCCceeeccCCCcHHHHHhcCCCchhhhcccCChHH
Q psy2256           1 CTLVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPEEFHMCALVRPER   55 (103)
Q Consensus         1 c~~~~~~~~~~~~~~d~h~p~~~R~~~~l~~~~~f~q~Ff~~~a~~~C~~~~~~~   55 (103)
                      |+..+++.....+.+|+|+|..+||||+|+|+++|+++|.|+-+    +.++|..
T Consensus       632 C~~~~~~~~~~~~~~~~H~~~~~RVng~lsN~~eFa~aF~C~~g----S~MnP~~  682 (687)
T KOG3624|consen  632 CSSEDPKKLPESLLTDPHSPESFRVNGVLSNSPEFAEAFNCPIG----SPMNPEK  682 (687)
T ss_pred             hccCChhhhhHHhhcCCCCCcceeEeeeccCcHHHHHhcCCCCC----CCCCccc
Confidence            88889999999999999999999999999999999999999999    5555543


No 6  
>PF01431 Peptidase_M13:  Peptidase family M13 This is family M13 in the peptidase classification. ;  InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell [].  Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=98.39  E-value=4e-08  Score=67.16  Aligned_cols=45  Identities=49%  Similarity=0.869  Sum_probs=34.1

Q ss_pred             CCCCcHHHHHHHHhhCCCCCCCceeeccCCCcHHHHHhcCCCchh
Q psy2256           1 CTLVRPERLKFLILTDTHSPSEFRVLGPLSNLKEFARDFQCPEEF   45 (103)
Q Consensus         1 c~~~~~~~~~~~~~~d~h~p~~~R~~~~l~~~~~f~q~Ff~~~a~   45 (103)
                      |++.+++....++.+|+|+|..+|||++|+|+++|+++|.|+-+.
T Consensus       152 C~~~~~~~~~~~~~~~~h~p~~~RvN~~L~n~~~Fa~aF~C~~gs  196 (206)
T PF01431_consen  152 CEKMSPESVYRQLQTDPHSPARFRVNGPLSNMPEFAEAFNCPSGS  196 (206)
T ss_dssp             -EEE-HHHHHHHHHH-SS--HHHHHHHHHHT-HHHHHHHT--TTS
T ss_pred             hcCcchhhhhhhhhcCCCCchHHHHHHHHhcCHHHHHHcCCCCCC
Confidence            677788888889999999999999999999999999999999994


No 7  
>PF15021 DUF4521:  Protein of unknown function (DUF4521)
Probab=26.24  E-value=54  Score=22.66  Aligned_cols=25  Identities=24%  Similarity=0.272  Sum_probs=19.7

Q ss_pred             eecccCchhHHHhcCCCCCCCCCCC
Q psy2256          73 LGPLSNLKEFARDFQCPVGSRMNPP   97 (103)
Q Consensus        73 n~~l~n~~~F~~aF~C~~g~~m~p~   97 (103)
                      +|.-+-++.|+++|+.++...++|-
T Consensus        94 dglRkSLD~FYe~f~~pqP~s~dpl  118 (206)
T PF15021_consen   94 DGLRKSLDRFYEMFGHPQPASGDPL  118 (206)
T ss_pred             chHHHHHHHHHHHhCCCCCCCCCcc
Confidence            3445567889999999999888863


No 8  
>smart00153 VHP Villin headpiece domain.
Probab=18.52  E-value=80  Score=15.61  Aligned_cols=13  Identities=15%  Similarity=0.176  Sum_probs=10.5

Q ss_pred             chhHHHhcCCCCC
Q psy2256          79 LKEFARDFQCPVG   91 (103)
Q Consensus        79 ~~~F~~aF~C~~g   91 (103)
                      ..+|.++|+|...
T Consensus         4 deeF~~vfgmsr~   16 (36)
T smart00153        4 DEDFEEVFGMTRE   16 (36)
T ss_pred             HHHHHHHHCCCHH
Confidence            5789999998654


No 9  
>PF15182 OTOS:  Otospiralin
Probab=15.84  E-value=32  Score=19.52  Aligned_cols=21  Identities=33%  Similarity=0.621  Sum_probs=16.1

Q ss_pred             ceeeccCCCcHHHHHhcCCCc
Q psy2256          23 FRVLGPLSNLKEFARDFQCPE   43 (103)
Q Consensus        23 ~R~~~~l~~~~~f~q~Ff~~~   43 (103)
                      +|..|+...+++.++.||--+
T Consensus        34 FrtlGAY~~indmARtfFAh~   54 (69)
T PF15182_consen   34 FRTLGAYNQINDMARTFFAHF   54 (69)
T ss_pred             HHHhccHHHHHHHHHHHHhhC
Confidence            456688888888888888654


No 10 
>PF07576 BRAP2:  BRCA1-associated protein 2;  InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening []. These proteins share a region of sequence similarity at their N terminus. They also have IPR001607 from INTERPRO at the C terminus.
Probab=15.09  E-value=1.6e+02  Score=18.29  Aligned_cols=22  Identities=27%  Similarity=0.555  Sum_probs=0.0

Q ss_pred             hhHHHhcCCCCCCCCCCCCceec
Q psy2256          80 KEFARDFQCPVGSRMNPPHKCEV  102 (103)
Q Consensus        80 ~~F~~aF~C~~g~~m~p~~~C~i  102 (103)
                      .+|.+.||=++=+.|-|+. |.|
T Consensus        68 d~Fy~~fNGk~FnslEpE~-Chv   89 (110)
T PF07576_consen   68 DEFYEEFNGKPFNSLEPET-CHV   89 (110)
T ss_pred             HHHHHHhCCCccCCCCCce-eEE


Done!