Diaphorina citri psyllid: psy225


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450
MVRSFTSWTKTLSFPARLNTHHKQQISSKENTLSSSSSSHSSDLPMICSQTKSRTPLSLTPDVSDSEKDTMGSLIHCIHYKEGCKWYDELKSLKGHLQTCKYDAIPCNKCLAAIPKTLMEDHSKFTCPERITTCQYCLESFSGMEMEDHTGHCSYEMVYCENKCGHKIQRRLMAKHRANDCYKRLVACRYCSKSYVADTLVTHQTKCTRAPIPCPNQCEMVALPREELDVHIKEHCNSLLVSCVFKDAGCRFKGMRGETMEKHIEENVNQHMLLMCSLVSKQQQQISTLKSALNKVTLNYSGTLIWKITDYSLKCQESIELLSPSFYTSQFGYKLQVSLFLNGNGAGEGTHVSVYIKLLPGEYDALLKWPFSHSVSFTLFDQSEKPVNVVESFVPDPTWENFQRPSKQPDSLGFGFPRFVSLDTIRKRQFLKDDAIFIRVKVDPSKIVAV
cccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccEEEEccccccccEEEEccHHHHHHccccccCCccccccccccccccccccccccccccccccccccccccccHHHHccccccCEEECcccccHHHHHHHHHHHcHHHHHHHHHHcccccccccccHHHHHHHccccccccccccccccccccccHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccccEECcccccEEEEEEECcccccccccEEEEEEEEccccccccccccccCEEEEEECccccccccEEEEECccccccccccccccccccccccccEEEEccccccccEEcccEEEEEEECccccccc
*****TSWTKTLSFPARLNT***************************CSQTKSRTPLSLTPDVSDSEKDTMGSLIHCIHYKEGCKWYDELKSLKGHLQTCKYDAIPCNKCLAAIPKTLMEDHSKFTCPERITTCQYCLESFSGMEMEDHTGHCSYEMVYCENKCGHKIQRRLMAKHRANDCYKRLVACRYCSKSYVADTLVTHQTKCTRAPIPCPNQCEMVALPREELDVHIKEHCNSLLVSCVFKDAGCRFKGMRGETMEKHIEENVNQHMLLMCSLVSKQQQQISTLKSALNKVTLNYSGTLIWKITDYSLKCQESIELLSPSFYTSQFGYKLQVSLFLNGNGAGEGTHVSVYIKLLPGEYDALLKWPFSHSVSFTLFDQSEKPVNVVESFVPDPTWENFQR*SKQPDSLGFGFPRFVSLDTIRKRQFLKDDAIFIRVKVDPSKIVA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRSFTSWTKTLSFPARLNTHHKQQISSKENTLSSSSSSHSSDLPMICSQTKSRTPLSLTPDVSDSEKDTMGSLIHCIHYKEGCKWYDELKSLKGHLQTCKYDAIPCNKCLAAIPKTLMEDHSKFTCPERITTCQYCLESFSGMEMEDHTGHCSYEMVYCENKCGHKIQRRLMAKHRANDCYKRLVACRYCSKSYVADTLVTHQTKCTRAPIPCPNQCEMVALPREELDVHIKEHCNSLLVSCVFKDAGCRFKGMRGETMEKHIEENVNQHMLLMCSLVSKQQQQISTLKSALNKVTLNYSGTLIWKITDYSLKCQESIELLSPSFYTSQFGYKLQVSLFLNGNGAGEGTHVSVYIKLLPGEYDALLKWPFSHSVSFTLFDQSEKPVNVVESFVPDPTWENFQRPSKQPDSLGFGFPRFVSLDTIRKRQFLKDDAIFIRVKVDPSKIVAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TNF receptor-associated factor 4 Adapter protein and signal transducer that links members of the tumor necrosis factor receptor (TNFR) family to different signaling pathways. Plays a role in the activation of NF-kappa-B and JNK, and in the regulation of cell survival and apoptosis. Regulates activation of NF-kappa-B in response to signaling through Toll-like receptors. Required for normal skeleton development, and for normal development of the respiratory tract (By similarity). Required for activation of RPS6KB1 in response to TNF signaling. Modulates TRAF6 functions.confidentQ9BUZ4
TNF receptor-associated factor 4 Adapter protein and signal transducer that links members of the tumor necrosis factor receptor (TNFR) family to different signaling pathways. Plays a role in the activation of NF-kappa-B and JNK, and in the regulation of cell survival and apoptosis. Regulates activation of NF-kappa-B in response to signaling through Toll-like receptors. Required for activation of RPS6KB1 in response to TNF signaling. Modulates TRAF6 functions (By similarity). Required for normal skeleton development, and for normal development of the respiratory tract.confidentQ61382

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046330 [BP]positive regulation of JNK cascadeprobableGO:0048584, GO:0048583, GO:0023056, GO:0023051, GO:0046328, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0043408, GO:0009966, GO:0009967, GO:0065007, GO:0048518, GO:0010740, GO:0070302, GO:0070304, GO:0050794, GO:0043410, GO:0008150, GO:0032874, GO:0032872, GO:0080134, GO:0080135, GO:0048522
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0090073 [BP]positive regulation of protein homodimerization activityprobableGO:0032092, GO:0051099, GO:0051098, GO:0043496, GO:0008150, GO:0043393, GO:0044093, GO:0065007, GO:0065009
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035071 [BP]salivary gland cell autophagic cell deathprobableGO:0010259, GO:0016271, GO:0009791, GO:0048102, GO:0002165, GO:0032501, GO:0007569, GO:0009653, GO:0007275, GO:0044699, GO:0007559, GO:0007435, GO:0007431, GO:0007552, GO:0008150, GO:0048513, GO:0022612, GO:0032502, GO:0048707, GO:0009886, GO:0035070, GO:0009987, GO:0009888, GO:0044767, GO:0012501, GO:0035272, GO:0044763, GO:0044707, GO:0048856, GO:0048731, GO:0048732
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0001654 [BP]eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0007370 [BP]ventral furrow formationprobableGO:0032502, GO:0001703, GO:0048856, GO:0044707, GO:0032501, GO:0007369, GO:0044767, GO:0009790, GO:0010004, GO:0008150, GO:0048646, GO:0048598, GO:0009653, GO:0007275, GO:0044699
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0002168 [BP]instar larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002165, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0030323 [BP]respiratory tube developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0007275, GO:0044699
GO:0034332 [BP]adherens junction organizationprobableGO:0034330, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0045216, GO:0008150, GO:0044699
GO:0050699 [MF]WW domain bindingprobableGO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0031996 [MF]thioesterase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0046529 [BP]imaginal disc fusion, thorax closureprobableGO:0048563, GO:0048569, GO:0009887, GO:0009791, GO:0002165, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0007552, GO:0048513, GO:0046528, GO:0032502, GO:0048707, GO:0009886, GO:0044767, GO:0008150, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731
GO:0003384 [BP]apical constriction involved in gastrulationprobableGO:0032502, GO:0030154, GO:0048468, GO:0006928, GO:0009790, GO:0032501, GO:0003381, GO:0003382, GO:0003383, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0007369, GO:0016043, GO:0032989, GO:0071840, GO:0030855, GO:0002064, GO:0048598, GO:0009987, GO:0030029, GO:0060429, GO:0009888, GO:0044767, GO:0030048, GO:0044763, GO:0044707, GO:0048856, GO:0008150, GO:0070252
GO:0007250 [BP]activation of NF-kappaB-inducing kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0038061, GO:0048583, GO:0032147, GO:0023052, GO:1901222, GO:0023051, GO:0071902, GO:0035556, GO:0010646, GO:0050789, GO:0044699, GO:0080090, GO:0051716, GO:0071900, GO:0051347, GO:0010604, GO:0048522, GO:0009966, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0043085, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0031325, GO:0009987, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0044763, GO:0007154, GO:0042325, GO:0044700, GO:0042327, GO:0001932, GO:0050790, GO:0050896, GO:0031401, GO:0051338, GO:0008150, GO:0045860, GO:0001934, GO:0007165
GO:0006911 [BP]phagocytosis, engulfmentprobableGO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0045167 [BP]asymmetric protein localization involved in cell fate determinationprobableGO:0032502, GO:0008105, GO:0008104, GO:0048869, GO:0001709, GO:0045165, GO:0044763, GO:0030154, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699
GO:0007585 [BP]respiratory gaseous exchangeprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007391 [BP]dorsal closureprobableGO:0048598, GO:0002009, GO:0001700, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0016331, GO:0009888, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0048729, GO:0009653, GO:0032502, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FLK, chain A
Confidence level:very confident
Coverage over the Query: 255-450
View the alignment between query and template
View the model in PyMOL
Template: 2YUC, chain A
Confidence level:very confident
Coverage over the Query: 173-245
View the alignment between query and template
View the model in PyMOL
Template: 2YUC, chain A
Confidence level:very confident
Coverage over the Query: 93-160
View the alignment between query and template
View the model in PyMOL
Template: 3HCS, chain A
Confidence level:very confident
Coverage over the Query: 1-155
View the alignment between query and template
View the model in PyMOL