Query psy2264
Match_columns 148
No_of_seqs 140 out of 1049
Neff 8.3
Searched_HMMs 46136
Date Fri Aug 16 20:17:20 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy2264.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2264hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG1046|consensus 100.0 4.7E-44 1E-48 312.1 10.3 142 1-146 196-345 (882)
2 TIGR02412 pepN_strep_liv amino 100.0 1.7E-38 3.8E-43 276.4 12.4 141 1-146 161-308 (831)
3 TIGR02414 pepN_proteo aminopep 100.0 2E-38 4.3E-43 275.4 12.1 137 6-146 156-304 (863)
4 PF01433 Peptidase_M1: Peptida 100.0 3.2E-38 7E-43 253.7 11.2 142 1-146 167-316 (390)
5 PRK14015 pepN aminopeptidase N 100.0 9.7E-38 2.1E-42 271.6 12.8 140 3-146 166-317 (875)
6 COG0308 PepN Aminopeptidase N 100.0 6.7E-36 1.5E-40 260.7 9.8 141 1-146 177-328 (859)
7 TIGR02411 leuko_A4_hydro leuko 100.0 1.5E-34 3.2E-39 244.4 10.0 124 12-145 173-299 (601)
8 KOG1047|consensus 99.9 7.2E-28 1.6E-32 196.6 5.7 127 11-147 181-313 (613)
9 KOG1932|consensus 99.3 6.4E-12 1.4E-16 110.0 8.5 129 11-143 227-359 (1180)
10 PF13485 Peptidase_MA_2: Pepti 95.3 0.0038 8.3E-08 41.8 -0.3 18 126-143 26-43 (128)
11 COG3975 Predicted protease wit 94.8 0.093 2E-06 44.3 6.3 81 59-142 182-264 (558)
12 PRK04860 hypothetical protein; 93.5 0.18 3.9E-06 36.4 4.8 67 63-138 5-76 (160)
13 PF01863 DUF45: Protein of unk 90.9 0.63 1.4E-05 34.1 5.2 69 62-140 109-179 (205)
14 PF06114 DUF955: Domain of unk 88.7 0.27 5.9E-06 32.3 1.6 30 112-141 28-58 (122)
15 PF10026 DUF2268: Predicted Zn 86.3 2.2 4.7E-05 31.5 5.4 67 65-137 3-77 (195)
16 PF01435 Peptidase_M48: Peptid 83.1 0.95 2.1E-05 33.4 2.2 16 126-141 90-105 (226)
17 smart00731 SprT SprT homologue 83.0 1.9 4.2E-05 30.2 3.7 61 70-139 6-73 (146)
18 PF13574 Reprolysin_2: Metallo 79.5 0.91 2E-05 32.8 1.0 11 127-137 113-123 (173)
19 PF12725 DUF3810: Protein of u 78.9 1.6 3.4E-05 34.9 2.3 10 127-136 198-207 (318)
20 COG0501 HtpX Zn-dependent prot 73.7 4.2 9.1E-05 31.4 3.4 69 70-143 104-175 (302)
21 PF01447 Peptidase_M4: Thermol 72.4 7.3 0.00016 27.7 4.0 22 59-80 68-89 (150)
22 COG4783 Putative Zn-dependent 71.7 2.6 5.7E-05 35.4 1.8 47 88-135 93-140 (484)
23 PF13699 DUF4157: Domain of un 67.4 2.6 5.7E-05 26.6 0.8 63 70-137 6-73 (79)
24 cd04269 ZnMc_adamalysin_II_lik 67.2 22 0.00048 25.7 5.8 12 126-137 132-143 (194)
25 COG1451 Predicted metal-depend 66.9 9.7 0.00021 28.9 3.9 66 62-140 120-190 (223)
26 COG2856 Predicted Zn peptidase 65.8 3.8 8.3E-05 30.9 1.5 53 87-141 32-88 (213)
27 cd04272 ZnMc_salivary_gland_MP 65.8 13 0.00029 27.6 4.5 12 126-137 146-157 (220)
28 PF10263 SprT-like: SprT-like 65.7 3.4 7.4E-05 28.9 1.2 12 127-138 62-73 (157)
29 PF13688 Reprolysin_5: Metallo 65.2 3.2 7E-05 30.1 1.0 11 127-137 144-154 (196)
30 PHA02456 zinc metallopeptidase 64.9 4.4 9.5E-05 27.5 1.5 13 125-137 79-91 (141)
31 PF08325 WLM: WLM domain; Int 64.6 3.6 7.8E-05 30.3 1.2 13 128-140 85-97 (186)
32 PF10460 Peptidase_M30: Peptid 64.4 15 0.00033 30.0 4.8 37 46-82 20-65 (366)
33 PRK03982 heat shock protein Ht 61.9 12 0.00027 29.2 3.8 14 127-140 127-140 (288)
34 PRK01345 heat shock protein Ht 61.2 13 0.00029 29.6 3.9 15 126-140 125-139 (317)
35 PRK03001 M48 family peptidase; 60.6 14 0.0003 28.8 3.9 12 126-137 125-136 (283)
36 cd04279 ZnMc_MMP_like_1 Zinc-d 60.2 49 0.0011 23.0 6.4 36 46-82 3-41 (156)
37 PRK03072 heat shock protein Ht 56.9 18 0.00039 28.4 3.9 14 127-140 129-142 (288)
38 cd04273 ZnMc_ADAMTS_like Zinc- 56.3 5.9 0.00013 29.3 1.1 10 127-136 142-151 (207)
39 PRK02870 heat shock protein Ht 54.1 16 0.00034 29.5 3.3 10 127-136 175-184 (336)
40 PF13582 Reprolysin_3: Metallo 53.9 6.7 0.00015 26.1 1.0 12 126-137 108-119 (124)
41 PF13265 DUF4056: Protein of u 53.6 5.8 0.00012 30.8 0.7 11 129-140 152-162 (270)
42 PF04450 BSP: Peptidase of pla 52.4 27 0.00059 26.1 4.1 13 128-140 99-111 (205)
43 KOG3658|consensus 51.3 4.1 9E-05 35.7 -0.5 10 128-137 395-404 (764)
44 PF13402 M60-like: Peptidase M 49.7 22 0.00049 27.6 3.5 78 58-136 143-230 (307)
45 PF10023 DUF2265: Predicted am 49.5 8 0.00017 31.2 0.9 42 57-98 45-96 (337)
46 COG4324 Predicted aminopeptida 49.1 8.8 0.00019 30.2 1.0 53 59-111 79-145 (376)
47 PF14891 Peptidase_M91: Effect 48.8 8.8 0.00019 27.7 1.0 11 127-137 105-115 (174)
48 PRK04351 hypothetical protein; 48.6 7.8 0.00017 27.5 0.7 10 127-136 63-72 (149)
49 cd04267 ZnMc_ADAM_like Zinc-de 47.8 8.3 0.00018 27.9 0.7 11 127-137 135-145 (192)
50 COG3091 SprT Zn-dependent meta 47.7 8.4 0.00018 27.5 0.7 22 66-89 6-27 (156)
51 PF08219 TOM13: Outer membrane 46.9 11 0.00025 23.6 1.1 12 126-137 53-64 (77)
52 PF01421 Reprolysin: Reprolysi 46.5 42 0.00091 24.4 4.3 10 127-136 133-142 (199)
53 KOG2661|consensus 46.0 13 0.00028 30.2 1.6 13 126-138 276-288 (424)
54 cd04270 ZnMc_TACE_like Zinc-de 45.8 10 0.00022 29.0 1.0 11 127-137 169-179 (244)
55 PF05572 Peptidase_M43: Pregna 45.1 16 0.00035 25.9 1.8 16 126-142 70-85 (154)
56 PF06262 DUF1025: Possibl zinc 44.4 7 0.00015 25.7 -0.1 32 105-136 50-84 (97)
57 PF14521 Aspzincin_M35: Lysine 42.6 15 0.00032 25.9 1.3 17 124-140 95-112 (148)
58 PRK02391 heat shock protein Ht 41.7 14 0.0003 29.2 1.2 15 126-140 134-148 (296)
59 PRK04897 heat shock protein Ht 41.3 14 0.00031 29.1 1.2 15 126-140 138-152 (298)
60 PRK05457 heat shock protein Ht 40.3 15 0.00033 28.8 1.2 16 126-141 135-150 (284)
61 PF06167 Peptidase_M90: Glucos 39.5 7.7 0.00017 30.0 -0.6 10 128-137 157-166 (253)
62 cd04271 ZnMc_ADAM_fungal Zinc- 38.2 12 0.00025 28.4 0.2 9 128-136 148-156 (228)
63 cd04277 ZnMc_serralysin_like Z 36.0 20 0.00042 25.9 1.1 20 63-82 35-54 (186)
64 PRK01265 heat shock protein Ht 36.0 19 0.00042 28.9 1.2 11 126-136 141-151 (324)
65 PF13583 Reprolysin_4: Metallo 35.4 18 0.00038 26.9 0.8 11 127-137 139-149 (206)
66 cd04268 ZnMc_MMP_like Zinc-dep 35.0 21 0.00046 24.9 1.2 21 62-82 15-35 (165)
67 PF00413 Peptidase_M10: Matrix 34.0 21 0.00045 24.6 0.9 22 61-82 21-42 (154)
68 PF05569 Peptidase_M56: BlaR1 34.0 25 0.00053 27.4 1.5 11 126-136 197-207 (299)
69 cd00203 ZnMc Zinc-dependent me 33.0 20 0.00044 24.9 0.8 23 60-82 20-42 (167)
70 PF02031 Peptidase_M7: Strepto 32.3 25 0.00054 24.5 1.1 10 127-136 79-88 (132)
71 PF12315 DUF3633: Protein of u 32.1 23 0.00051 26.7 1.0 12 127-138 95-106 (212)
72 KOG3607|consensus 31.3 1.3E+02 0.0028 27.0 5.6 32 47-79 243-274 (716)
73 TIGR02289 M3_not_pepF oligoend 30.7 28 0.00061 29.8 1.4 31 106-136 318-348 (549)
74 PF12388 Peptidase_M57: Dual-a 28.5 28 0.0006 26.3 0.9 11 126-136 134-144 (211)
75 cd06007 R3H_DEXH_helicase R3H 26.7 44 0.00096 19.8 1.4 12 126-137 29-40 (59)
76 smart00235 ZnMc Zinc-dependent 26.6 30 0.00065 23.5 0.7 20 63-82 24-43 (140)
77 COG4900 Predicted metallopepti 26.3 47 0.001 22.6 1.6 10 127-136 82-91 (133)
78 COG4101 Predicted mannose-6-ph 26.0 22 0.00047 24.6 -0.1 10 133-142 77-86 (142)
79 PF04228 Zn_peptidase: Putativ 25.6 34 0.00074 27.1 0.9 9 128-136 173-181 (292)
80 PF10584 Proteasome_A_N: Prote 24.6 24 0.00053 16.9 -0.0 18 47-65 5-22 (23)
81 PF01431 Peptidase_M13: Peptid 24.3 38 0.00082 24.7 0.9 12 127-138 38-49 (206)
82 cd04278 ZnMc_MMP Zinc-dependen 23.9 35 0.00077 23.8 0.7 22 61-82 21-42 (157)
83 PF09471 Peptidase_M64: IgA Pe 23.7 47 0.001 25.9 1.4 13 127-139 218-230 (264)
84 cd02640 R3H_NRF R3H domain of 23.6 55 0.0012 19.4 1.4 13 125-137 29-41 (60)
85 cd04280 ZnMc_astacin_like Zinc 22.9 1.8E+02 0.0039 20.9 4.3 21 62-82 15-35 (180)
86 cd06459 M3B_Oligoendopeptidase 22.6 48 0.001 26.9 1.3 25 112-136 209-233 (427)
87 PF14831 DUF4484: Domain of un 21.1 67 0.0014 23.5 1.7 14 126-139 145-158 (176)
88 PF01400 Astacin: Astacin (Pep 20.9 1.3E+02 0.0028 22.0 3.2 19 64-82 21-39 (191)
89 PF09768 Peptidase_M76: Peptid 20.8 1.8E+02 0.004 21.1 3.9 12 126-137 72-83 (173)
90 PF10186 Atg14: UV radiation r 20.8 1.5E+02 0.0032 22.7 3.7 29 57-87 194-222 (302)
91 cd04281 ZnMc_BMP1_TLD Zinc-dep 20.7 1.8E+02 0.0039 21.6 3.9 19 64-82 28-46 (200)
92 PF04036 DUF372: Domain of unk 20.6 49 0.0011 17.9 0.7 13 132-144 13-25 (38)
93 PRK15410 DgsA anti-repressor M 20.1 45 0.00098 26.0 0.6 9 128-136 145-153 (260)
94 cd06160 S2P-M50_like_2 Unchara 20.0 53 0.0012 24.0 1.0 11 128-138 44-54 (183)
No 1
>KOG1046|consensus
Probab=100.00 E-value=4.7e-44 Score=312.11 Aligned_cols=142 Identities=37% Similarity=0.637 Sum_probs=129.7
Q ss_pred CCCcceeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeecCC---ceEEEecCccccccHHHHHHHHHHHHHHHHHH
Q psy2264 1 MPVSTSVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKDG---KFRVWGREDVVKTQGQYIFDKGPKILAALSDY 77 (148)
Q Consensus 1 MP~~~~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~~---~i~v~~~~~~~~~~~~~~l~~~~~~l~~~e~~ 77 (148)
||+.++..+ ++|+++++|++||+|||||+||+||+|+..+.... ++|+|++|+. ..+++++++.++++|++++++
T Consensus 196 m~v~~~~~~-~~~~~~~~F~~Tp~MstYLvAf~V~~f~~~e~~~~~~v~vrv~a~p~~-~~~~~~al~~~~~~L~~~e~~ 273 (882)
T KOG1046|consen 196 MPVIKEEPV-DDGWKTTTFEKTPKMSTYLVAFAVGDFVYVETITKSGVPVRVYARPEK-INQGQFALEVATKVLEFYEDY 273 (882)
T ss_pred Ccccccccc-cCCeeEEEEEecCCCchhhheeeeeccccceeecCCCceEEEEeChHH-hhHHHHHHHHHHHHHHHHHHH
Confidence 888888888 77799999999999999999999999999887653 8999999999 999999999999999999999
Q ss_pred hCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccccc-hhhh----hHHHHhhhhhhcCCeeeecc
Q psy2264 78 MGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHLY-LLQH----TSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 78 ~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~~-~~~~----~~iaHElaHqWfGn~Vt~~~ 146 (148)
||+|| |++|+|+|++|+|..|||||||||+|+|..+++++..+ ..++ .+||||+|||||||+|||+-
T Consensus 274 f~i~y--PLpK~D~iavPdf~~GAMENwGLvtyre~~lL~~~~~ss~~~k~~va~vIaHElAHQWFGNLVTm~w 345 (882)
T KOG1046|consen 274 FGIPY--PLPKLDLVAVPDFSAGAMENWGLVTYRETALLYDPQTSSSSNKQRVAEVIAHELAHQWFGNLVTMKW 345 (882)
T ss_pred hCCCC--CCccccEEecCCccccchhcCcceeeeehhhccCCCcCcHHHHHHHHHHHHHHHHHHHhcCcccHhh
Confidence 99999 99999999999999999999999999999999987543 2222 25999999999999999764
No 2
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type. This family is a subset of the members of the zinc metallopeptidase family M1 (pfam01433), with a single member characterized in Streptomyces lividans 66 and designated aminopeptidase N. The spectrum of activity may differ somewhat from the aminopeptidase N clade of E. coli and most other Proteobacteria, well separated phylogenetically within the M1 family. The M1 family also includes leukotriene A-4 hydrolase/aminopeptidase (with a bifunctional active site).
Probab=100.00 E-value=1.7e-38 Score=276.43 Aligned_cols=141 Identities=22% Similarity=0.376 Sum_probs=116.3
Q ss_pred CCCcceeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeecC-C-ceEEEecCcccccc--HHHHHHHHHHHHHHHHH
Q psy2264 1 MPVSTSVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKD-G-KFRVWGREDVVKTQ--GQYIFDKGPKILAALSD 76 (148)
Q Consensus 1 MP~~~~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~-~-~i~v~~~~~~~~~~--~~~~l~~~~~~l~~~e~ 76 (148)
||+.+.+. .++.++++|++||||||||+||+||+|+..+... + ++++|++++. .+. ++++++.++++|++|++
T Consensus 161 g~~~~~~~--~~~~~~~~F~~t~pmstYL~a~~vG~f~~~~~~~~gvpi~v~~~~~~-~~~~~~~~al~~~~~~l~~~e~ 237 (831)
T TIGR02412 161 SRETDVTP--EPADRRWEFPETPKLSTYLTAVAAGPYHSVQDESRSYPLGIYARRSL-AQYLDADAIFTITRQGLAFFHR 237 (831)
T ss_pred Cccccccc--cCCCeEEEecCCCCcccceEEEEEeceEEEeecCCCEEEEEEECcch-hhhhhHHHHHHHHHHHHHHHHH
Confidence 45444332 3567789999999999999999999999988643 3 8999999987 554 57899999999999999
Q ss_pred HhCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccccchh---hhhHHHHhhhhhhcCCeeeecc
Q psy2264 77 YMGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHLYLL---QHTSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 77 ~~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~~~~---~~~~iaHElaHqWfGn~Vt~~~ 146 (148)
+||+|| |++|+|+|++|+|..|||||||+|+|+|..++.+...... ...+|+||+|||||||+||++.
T Consensus 238 ~fg~pY--P~~k~d~V~vP~f~~GaMEn~Glit~~e~~l~~~~~~~~~~~~~~~viaHElAHqWFGnlVT~~w 308 (831)
T TIGR02412 238 KFGYPY--PFKKYDQIFVPEFNAGAMENAGCVTFAENFLHRAEATRAEKENRAGVILHEMAHMWFGDLVTMRW 308 (831)
T ss_pred HhCCCC--CcccCCEEEcCCCCCCcccccceeeechhhccCCcCCHHHHHHHHHHHHHHHHHHHhCCEecccc
Confidence 999999 9999999999999999999999999999965443222111 1246999999999999999763
No 3
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type. The M1 family of zinc metallopeptidases contains a number of distinct, well-separated clades of proteins with aminopeptidase activity. Several are designated aminopeptidase N, EC 3.4.11.2, after the Escherichia coli enzyme, suggesting a similar activity profile. This family consists of all aminopeptidases closely related to E. coli PepN and presumed to have similar (not identical) function. Nearly all are found in Proteobacteria, but members are found also in Cyanobacteria, plants, and apicomplexan parasites. This family differs greatly in sequence from the family of aminopeptidases typified by Streptomyces lividans PepN (TIGR02412), from the membrane bound aminopeptidase N family in animals, etc.
Probab=100.00 E-value=2e-38 Score=275.43 Aligned_cols=137 Identities=23% Similarity=0.341 Sum_probs=120.5
Q ss_pred eeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeec----CC---ceEEEecCccccccHHHHHHHHHHHHHHHHHHh
Q psy2264 6 SVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDK----DG---KFRVWGREDVVKTQGQYIFDKGPKILAALSDYM 78 (148)
Q Consensus 6 ~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~----~~---~i~v~~~~~~~~~~~~~~l~~~~~~l~~~e~~~ 78 (148)
+... .+|+++++|+.++|||+||+||+||+|+++++. .| ++++|++++. .+++.++++.++++++++|++|
T Consensus 156 ~~~~-~~g~~~~~f~~t~pmptYLfA~vaGdf~~~~~~~~t~sg~~v~l~iy~~p~~-~~~~~~al~~~~~~L~~~E~~f 233 (863)
T TIGR02414 156 SGEL-PDGRHWAEWEDPFPKPSYLFALVAGDLDVLEDTFTTKSGREVALRVYVEEGN-KDKCDHAMESLKKAMKWDEEVF 233 (863)
T ss_pred ceec-CCCeEEEEEeCCCCcChhHheEEEeCCEEEEEEeeccCCCceEEEEEEccCc-HHHHHHHHHHHHHHHHHHHHHh
Confidence 3344 688999999999999999999999999998753 22 7899999998 8889999999999999999999
Q ss_pred CCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccccc-hhh----hhHHHHhhhhhhcCCeeeecc
Q psy2264 79 GFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHLY-LLQ----HTSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 79 g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~~-~~~----~~~iaHElaHqWfGn~Vt~~~ 146 (148)
|.|| |++|+|+|++|+|..||||||||++|+++.++.++... ... ..+||||+|||||||+|||+.
T Consensus 234 G~pY--Pl~k~diVavpdf~~GaMEN~GLi~f~e~~lL~~~~~~td~~~~~i~~VIaHElaHqWfGNlVT~~~ 304 (863)
T TIGR02414 234 GLEY--DLDIFMIVAVDDFNMGAMENKGLNIFNSKYVLADPETATDADYERIESVIAHEYFHNWTGNRVTCRD 304 (863)
T ss_pred CCCC--ChhhccEEecCCCCCccccccceeccccceEEeCCCCCCHHHHHHHHHHHHHHHHHHHhcceeeecc
Confidence 9999 99999999999999999999999999999998876542 211 247999999999999999753
No 4
>PF01433 Peptidase_M1: Peptidase family M1 This is family M1 in the peptidase classification.; InterPro: IPR014782 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M1 (clan MA(E)), the type example being aminopeptidase N from Homo sapiens (Human). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Membrane alanine aminopeptidase (3.4.11.2 from EC) is part of the HEXXH+E group; it consists entirely of aminopeptidases, spread across a wide variety of species []. Functional studies show that CD13/APN catalyzes the removal of single amino acids from the amino terminus of small peptides and probably plays a role in their final digestion; one family member (leukotriene-A4 hydrolase) is known to hydrolyse the epoxide leukotriene-A4 to form an inflammatory mediator []. This hydrolase has been shown to have aminopeptidase activity [], and the zinc ligands of the M1 family were identified by site-directed mutagenesis on this enzyme [] CD13 participates in trimming peptides bound to MHC class II molecules [] and cleaves MIP-1 chemokine, which alters target cell specificity from basophils to eosinophils []. CD13 acts as a receptor for specific strains of RNA viruses (coronaviruses) which cause a relatively large percentage of upper respiratory trace infections. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0008237 metallopeptidase activity, 0008270 zinc ion binding; PDB: 2XQ0_A 2XPY_A 2XPZ_A 3SE6_B 3EBH_A 3EBG_A 3T8V_A 3Q44_A 3Q43_A 3EBI_A ....
Probab=100.00 E-value=3.2e-38 Score=253.69 Aligned_cols=142 Identities=34% Similarity=0.597 Sum_probs=117.6
Q ss_pred CCCcceeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeecCC---ceEEEecCccccccHHHHHHHHHHHHHHHHHH
Q psy2264 1 MPVSTSVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKDG---KFRVWGREDVVKTQGQYIFDKGPKILAALSDY 77 (148)
Q Consensus 1 MP~~~~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~~---~i~v~~~~~~~~~~~~~~l~~~~~~l~~~e~~ 77 (148)
||+.++... ++|+++++|+.|+|||+|++||+||+|+..+.... ++++|++++. .++++.+++.+++++++|+++
T Consensus 167 g~~~~~~~~-~~~~~~~~f~~t~p~~~yl~a~~vg~~~~~~~~~~~~~~v~~~~~~~~-~~~~~~~~~~~~~~l~~~~~~ 244 (390)
T PF01433_consen 167 GPLEEEESN-DDGWKTTTFETTPPMPTYLFAFAVGDFESVEVTTKSGVPVRVYARPGD-EEQLQFALDIAPKALEYYEEY 244 (390)
T ss_dssp SEEEEEEEE-TTTEEEEEEEEEEEEEGGG--EEEESEEEEEEETTTEEEEEEEEECTC-GGGHHHHHHHHHHHHHHHHHH
T ss_pred ccccccccc-cccceeEeeecccccCchhhhhhcCcccccccccccccchheeehhhh-HHHHHHHHHhhHHHHHHHHhh
Confidence 455566666 68999999999999999999999999999876553 7999999999 899999999999999999999
Q ss_pred hCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccccchh-h----hhHHHHhhhhhhcCCeeeecc
Q psy2264 78 MGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHLYLL-Q----HTSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 78 ~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~~~~-~----~~~iaHElaHqWfGn~Vt~~~ 146 (148)
||.|| |++|+|+|++|+|..+||||||+|+|+++.++++++.... + ..+||||+|||||||+||++.
T Consensus 245 ~g~~y--p~~k~~~v~~p~~~~~~me~~g~i~~~~~~l~~~~~~~~~~~~~~~~~~iahElahqWfGn~vt~~~ 316 (390)
T PF01433_consen 245 FGIPY--PFKKLDIVAVPDFPFGGMENWGLITYRESYLLYDPDISTIGDKQEIASLIAHELAHQWFGNLVTPKW 316 (390)
T ss_dssp HTS----SSSEEEEEEEST-SSSEE--TTEEEEEGGGTS-STTTS-HHHHHHHHHHHHHHHHTTTBTTTEEESS
T ss_pred ccccc--eecceeEEEEeccccccccccccccccccccccCcccccchhhhhhHHHHHHHHHHHHhccCCcccc
Confidence 99999 9999999999999999999999999999999987654322 1 246999999999999999763
No 5
>PRK14015 pepN aminopeptidase N; Provisional
Probab=100.00 E-value=9.7e-38 Score=271.62 Aligned_cols=140 Identities=21% Similarity=0.308 Sum_probs=121.3
Q ss_pred CcceeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeec----CC---ceEEEecCccccccHHHHHHHHHHHHHHHH
Q psy2264 3 VSTSVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDK----DG---KFRVWGREDVVKTQGQYIFDKGPKILAALS 75 (148)
Q Consensus 3 ~~~~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~----~~---~i~v~~~~~~~~~~~~~~l~~~~~~l~~~e 75 (148)
..++... .+|+++++|+.++|||+||+||+||+|+.+++. .| ++++|++|+. .+++.++++.++++|+++|
T Consensus 166 l~~~~~~-~~g~~~~~w~~~~PmpsYL~Al~aGdf~~~~d~~~~~~g~~vpl~iy~~p~~-~~~~~~al~~~~~~L~~~E 243 (875)
T PRK14015 166 LVESGEL-PDGRHWATWEDPFPKPSYLFALVAGDLDVLEDTFTTRSGREVALEIYVEPGN-LDKCDHAMDSLKKSMKWDE 243 (875)
T ss_pred cccceec-cCCeEEEEEEeCCCcccceEEEEEeCCEEEEEEeeccCCCeEEEEEEEeCCc-HHHHHHHHHHHHHHHHHHH
Confidence 3333334 578999999999999999999999999998753 22 7899999998 8889999999999999999
Q ss_pred HHhCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccccch-h----hhhHHHHhhhhhhcCCeeeecc
Q psy2264 76 DYMGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHLYL-L----QHTSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 76 ~~~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~~~-~----~~~~iaHElaHqWfGn~Vt~~~ 146 (148)
++||.|| |++|||+|++|+|..||||||||++|+++.++.++.... . ...+||||+|||||||+|||+.
T Consensus 244 ~~FG~pY--P~~k~diVavp~f~~GaMEN~Gl~~f~~~~lL~~~~~~t~~~~~~i~~vIaHElaHqWFGNlVT~~~ 317 (875)
T PRK14015 244 ERFGLEY--DLDIFMIVAVDDFNMGAMENKGLNIFNSKYVLADPETATDADYERIESVIAHEYFHNWTGNRVTCRD 317 (875)
T ss_pred HHhCCCC--ChhhhCEEeCCCCCCcccccccccccccceEecCcccCCHHHHHHHHHHHHHHHHHHHHhCcceecc
Confidence 9999999 999999999999999999999999999999988765421 1 2357999999999999999753
No 6
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism]
Probab=100.00 E-value=6.7e-36 Score=260.73 Aligned_cols=141 Identities=27% Similarity=0.520 Sum_probs=122.8
Q ss_pred CCCcceeeeeCCCEEEEEEecCCCCCceEEEEEEecceeeeecC-----C-ceEEEecCccccccHHHHHHHHHHHHHHH
Q psy2264 1 MPVSTSVEIANSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKD-----G-KFRVWGREDVVKTQGQYIFDKGPKILAAL 74 (148)
Q Consensus 1 MP~~~~~~~~~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~-----~-~i~v~~~~~~~~~~~~~~l~~~~~~l~~~ 74 (148)
||....... .+|+++++|+.++||||||+|+++|+|+++++.. + ++++|++++. ..+++++++.++++++++
T Consensus 177 ~~~~~~~~~-~~g~~~~~f~~~~~mptYL~al~~G~~~~~~~~~~~~~~~v~l~iy~~~g~-~~~a~~~~~~~~~~~~~~ 254 (859)
T COG0308 177 GNLIDGGTL-VDGRKIVKFEDTPPMPTYLFALVAGDLEVFRDKFDTRSRDVPLEIYVPPGV-LDRAKYALDETKRSIEFY 254 (859)
T ss_pred CCccccccc-cCCcEEEEEcCCCCcchHhhheeeecceeeeeeeccCCCCeeEEEEecCcc-hhhhhhhHHHHHHHhhhH
Confidence 344444444 6789999999999999999999999999888765 3 8899999977 889999999999999999
Q ss_pred HHHhCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhccccccccc-cchh----hhhHHHHhhhhhhcCCeeeecc
Q psy2264 75 SDYMGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATH-LYLL----QHTSMIRMTNIPWFPAWISWKY 146 (148)
Q Consensus 75 e~~~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~-~~~~----~~~~iaHElaHqWfGn~Vt~~~ 146 (148)
|++||.|| |++| ++|++|+|+.|||||||+++|++..++.++. .... ..++|+||+|||||||+|||+.
T Consensus 255 e~~fg~~y--~l~~-~~V~v~~f~~GaMEN~Gl~tf~~~~ll~~~~~at~~~~~~~~~viaHElaHqWfGnlVT~~~ 328 (859)
T COG0308 255 EEYFGLPY--ALPI-DIVAVPDFSAGAMENWGLVTFREKYLLADPETATDSDYENVEEVIAHELAHQWFGNLVTMKW 328 (859)
T ss_pred HHhcCCCC--CCcc-cEEeccCCCCccccccceeEEeeeEEeeCcccchhHHHHHHHHHHHHHHhhhcccceeeccC
Confidence 99999999 9999 9999999999999999999999999887743 3222 2247999999999999999875
No 7
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase. Members of this family represent a distinctive subset within the zinc metallopeptidase family M1 (pfam01433). The majority of the members of pfam01433 are aminopeptidases, but the sequences in this family for which the function is known are leukotriene A-4 hydrolase. A dual epoxide hydrolase and aminopeptidase activity at the same active site is indicated. The physiological substrate for aminopeptidase activity is not known.
Probab=100.00 E-value=1.5e-34 Score=244.35 Aligned_cols=124 Identities=21% Similarity=0.335 Sum_probs=105.9
Q ss_pred CCEEEEEEecCCCCCceEEEEEEecceeeeecCC-ceEEEecCccccccHHHHHH-HHHHHHHHHHHHhCCcCCCCCCcc
Q psy2264 12 SDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKDG-KFRVWGREDVVKTQGQYIFD-KGPKILAALSDYMGFDYYKMLPKM 89 (148)
Q Consensus 12 ~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~~-~i~v~~~~~~~~~~~~~~l~-~~~~~l~~~e~~~g~~y~~p~~k~ 89 (148)
++..+++|++++|||+||+||+||+|+... .| ++++|++|+. .+++.+.+. .++++++++|+++| || |++||
T Consensus 173 ~~~~~~~F~~t~pmptYLia~avG~~~~~~--~g~~~~v~~~p~~-~~~~~~~~~~~~~~~l~~~e~~~~-pY--p~~k~ 246 (601)
T TIGR02411 173 NDPGKYLFKQKVPIPAYLIALASGDLASAP--IGPRSSVYSEPEQ-LEKCQYEFEHDTENFIKTAEDLIF-PY--EWGQY 246 (601)
T ss_pred CCCceEEEEeCCCcchhhheeeeccceecc--cCCceEEEccchh-HHHHHHHHHHhHHHHHHHHHHhCC-CC--cCccc
Confidence 345578999999999999999999998764 24 7899999998 888888888 99999999999866 99 99999
Q ss_pred cEEEe-CCCCCCchhhhhhhhhhccccccccccchhhhhHHHHhhhhhhcCCeeeec
Q psy2264 90 DLVAV-PDFDAGAMENWGMNTYRLGLVVEATHLYLLQHTSMIRMTNIPWFPAWISWK 145 (148)
Q Consensus 90 d~v~v-p~~~~~~MEn~Gli~~~e~~ll~~~~~~~~~~~~iaHElaHqWfGn~Vt~~ 145 (148)
|+|++ |+|++||||||| ++|.++.++..+.+ ...+||||||||||||+||++
T Consensus 247 d~vvlpp~f~~GgMEN~~-ltf~~~~ll~~d~s---~~~viaHElAHqWfGNlVT~~ 299 (601)
T TIGR02411 247 DLLVLPPSFPYGGMENPN-LTFATPTLIAGDRS---NVDVIAHELAHSWSGNLVTNC 299 (601)
T ss_pred eEEEecCccccccccccc-ceeeccccccCChh---hhhhHHHHHHhhccCceeecC
Confidence 99987 789999999999 56777777755332 235799999999999999954
No 8
>KOG1047|consensus
Probab=99.94 E-value=7.2e-28 Score=196.60 Aligned_cols=127 Identities=24% Similarity=0.427 Sum_probs=108.4
Q ss_pred CCCEEEEEEecCCCCCceEEEEEEecceeeeecCC-ceEEEecCccccccHHHHHH-HHHHHHHHHHHHhCCcCCCCCCc
Q psy2264 11 NSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKDG-KFRVWGREDVVKTQGQYIFD-KGPKILAALSDYMGFDYYKMLPK 88 (148)
Q Consensus 11 ~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~~-~i~v~~~~~~~~~~~~~~l~-~~~~~l~~~e~~~g~~y~~p~~k 88 (148)
++|....+|++..|+|+||+||++|++.+.+ -| +.+||+.|.. .+.+.+-+. .++++|+.-|+.+| || ++++
T Consensus 181 ~~~~~~f~f~q~~pIP~YLiai~~G~L~s~e--IgpRs~VwaEp~~-~~a~~~ef~~~~e~~L~~Ae~l~G-pY--~Wgr 254 (613)
T KOG1047|consen 181 SNGRAIFRFKQEVPIPSYLIAIAVGDLESRE--IGPRSRVWAEPCL-LDACQEEFAGETEDFLKAAEKLFG-PY--VWGR 254 (613)
T ss_pred CCCcceEEEEeccCchhhhHHHhhccccccc--cCCccceecchhh-hHHHHHHHHhhhHHHHHHHHHHcC-Cc--cccc
Confidence 5667889999999999999999999998665 35 6899999999 888888887 99999999999999 99 9999
Q ss_pred ccEEEe-CCCCCCchhhhhhhhhhccccccccccchhhhhHHHHhhhhhhcCCeee---eccc
Q psy2264 89 MDLVAV-PDFDAGAMENWGMNTYRLGLVVEATHLYLLQHTSMIRMTNIPWFPAWIS---WKYY 147 (148)
Q Consensus 89 ~d~v~v-p~~~~~~MEn~Gli~~~e~~ll~~~~~~~~~~~~iaHElaHqWfGn~Vt---~~~~ 147 (148)
||+|++ |+|++|||||+ +++|-...|+-.+.+ ...+|||||||.||||+|| |+||
T Consensus 255 yDllvlPpSFP~gGMENP-cltF~TpTllaGDrs---l~~vIaHEIAHSWtGNlVTN~sWehf 313 (613)
T KOG1047|consen 255 YDLLVLPPSFPFGGMENP-CLTFVTPTLLAGDRS---LVDVIAHEIAHSWTGNLVTNASWEHF 313 (613)
T ss_pred ceEEEecCCCCcccccCc-ceeeecchhhcCCcc---hhhHHHHHhhhhhcccccccCccchh
Confidence 999999 57999999999 555555555544332 2346999999999999998 8876
No 9
>KOG1932|consensus
Probab=99.31 E-value=6.4e-12 Score=110.01 Aligned_cols=129 Identities=13% Similarity=0.166 Sum_probs=106.9
Q ss_pred CCCEEEEEEecCCCCCceEEEEEEecceeeeecCC-ceEEEecCccccccHHHHHHHHHHHHHHHHHHhCCcCCCCCCcc
Q psy2264 11 NSDKVTDTFQQSPPMPTYLVGFAVFEFNSLSDKDG-KFRVWGREDVVKTQGQYIFDKGPKILAALSDYMGFDYYKMLPKM 89 (148)
Q Consensus 11 ~~~~~~~~F~~tppmstYl~a~~vg~f~~~~~~~~-~i~v~~~~~~~~~~~~~~l~~~~~~l~~~e~~~g~~y~~p~~k~ 89 (148)
+-+.++.+|+.|-|+++.-+|||||.|+....... ++..+|.|+. ....+...-...++++|+|+.++..| ||+-|
T Consensus 227 D~~Kkt~~ys~tvPvA~~~I~~AiG~F~~~~~P~~~~i~~f~LP~~-~~~v~nt~~~l~k~iefye~~ls~rY--PF~~~ 303 (1180)
T KOG1932|consen 227 DLRKKTYHYSLTVPVAPSNIGFAIGPFKSYVEPSMIDITHFCLPGL-EPLVKNTTVYLHKAIEFYEEELSSRY--PFSCY 303 (1180)
T ss_pred cccccEEEEEEeccCCccccceeeccccccCCCccCcceeEecCcc-hHHhhhHHHHHHHHHHHHHHHhccCC--Cccee
Confidence 44678899999999999999999999998854444 8999999998 88888888899999999999999889 99999
Q ss_pred cEEEeCCCCCCchhhhhhhhhhcccccccccc-c--hhhhhHHHHhhhhhhcCCeee
Q psy2264 90 DLVAVPDFDAGAMENWGMNTYRLGLVVEATHL-Y--LLQHTSMIRMTNIPWFPAWIS 143 (148)
Q Consensus 90 d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~-~--~~~~~~iaHElaHqWfGn~Vt 143 (148)
.+|+||.-..--+...+|.++..+ +|++... + ...+..+|-.||-||||-++|
T Consensus 304 k~VFvd~~~~~i~~~asl~I~st~-lLy~~~iIDq~~~tr~~La~aLA~Q~fg~yIs 359 (1180)
T KOG1932|consen 304 KTVFVDEAAVEISSYASLSIFSTS-LLYSKNIIDQTFLTRRKLAWALASQWFGVYIS 359 (1180)
T ss_pred eEEEecCCcceeeecceeeeeecc-ccchHhhhhHHHHHHHHHHHHHHHhhhEEEee
Confidence 999999876666667777777755 5554432 2 223456999999999999998
No 10
>PF13485 Peptidase_MA_2: Peptidase MA superfamily
Probab=95.33 E-value=0.0038 Score=41.77 Aligned_cols=18 Identities=11% Similarity=0.383 Sum_probs=15.6
Q ss_pred hhHHHHhhhhhhcCCeee
Q psy2264 126 HTSMIRMTNIPWFPAWIS 143 (148)
Q Consensus 126 ~~~iaHElaHqWfGn~Vt 143 (148)
..+++||++|+|+++.+.
T Consensus 26 ~~~l~HE~~H~~~~~~~~ 43 (128)
T PF13485_consen 26 DRVLAHELAHQWFGNYFG 43 (128)
T ss_pred HHHHHHHHHHHHHHHHcC
Confidence 467999999999998874
No 11
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only]
Probab=94.84 E-value=0.093 Score=44.31 Aligned_cols=81 Identities=12% Similarity=-0.010 Sum_probs=52.6
Q ss_pred cHHHHHHHHHHHHHHHHHHhCCcCCCCCCcccEEEe-CCCCCCchhhhhhhhhhccccccccccc-hhhhhHHHHhhhhh
Q psy2264 59 QGQYIFDKGPKILAALSDYMGFDYYKMLPKMDLVAV-PDFDAGAMENWGMNTYRLGLVVEATHLY-LLQHTSMIRMTNIP 136 (148)
Q Consensus 59 ~~~~~l~~~~~~l~~~e~~~g~~y~~p~~k~d~v~v-p~~~~~~MEn~Gli~~~e~~ll~~~~~~-~~~~~~iaHElaHq 136 (148)
+.+...+.+++++..=.+.|| +- |+.||.+++- .+...||||+---.....+.....+... ..-...++||..|-
T Consensus 182 d~~~~~~~~k~ii~~~~~vFg-~~--~~~~Y~Fl~~~s~q~~GGlEH~~St~l~~~r~~~~~~~ky~~~l~llsHEyfH~ 258 (558)
T COG3975 182 DKERLASDTKKIIEAEIKVFG-SA--PFDKYVFLLHLSDQIYGGLEHRRSTALIYDRFGFTDQDKYQDLLGLLSHEYFHA 258 (558)
T ss_pred cHHHHHHHHHHHHHHHHHHhc-CC--CccceEEEEEecCCCCCCceeccccccccccccccchhHHHHHHHHHHHHHHHh
Confidence 556666788889999889999 67 8999987765 4456789998532222222222211111 11134699999999
Q ss_pred hcCCee
Q psy2264 137 WFPAWI 142 (148)
Q Consensus 137 WfGn~V 142 (148)
|-+-.+
T Consensus 259 WNvKrI 264 (558)
T COG3975 259 WNVKRI 264 (558)
T ss_pred ccceec
Confidence 987654
No 12
>PRK04860 hypothetical protein; Provisional
Probab=93.48 E-value=0.18 Score=36.35 Aligned_cols=67 Identities=9% Similarity=-0.006 Sum_probs=35.4
Q ss_pred HHHHHHHHHHHHHHHhCCcCCCCCCcccEEEeCCCCCCchhhhhhhhhhcccccccccc-----chhhhhHHHHhhhhhh
Q psy2264 63 IFDKGPKILAALSDYMGFDYYKMLPKMDLVAVPDFDAGAMENWGMNTYRLGLVVEATHL-----YLLQHTSMIRMTNIPW 137 (148)
Q Consensus 63 ~l~~~~~~l~~~e~~~g~~y~~p~~k~d~v~vp~~~~~~MEn~Gli~~~e~~ll~~~~~-----~~~~~~~iaHElaHqW 137 (148)
+...+...+..-+.+||.|+ +-++..+= .....+|+ -......+-.++.. ...-..+|+||+||-|
T Consensus 5 ~~~~~~~~~~~a~~~f~~~f--~~p~~~f~--~R~rtaG~-----~~l~~~~I~~Np~ll~~~~~~~l~~~v~HEl~H~~ 75 (160)
T PRK04860 5 VMRRLRECLAQANLYFKRTF--PEPKVSYT--QRGTSAGT-----AWLQSNEIRLNPVLLLENQQAFIDEVVPHELAHLL 75 (160)
T ss_pred HHHHHHHHHHHHHHHhCCCC--CCCEEEEe--ecchhhcc-----hhHhcCCeeeCHHHHhhCcHHHHHhHHHHHHHHHH
Confidence 44566777788888999888 66533211 12222333 22222333333221 1112346899999976
Q ss_pred c
Q psy2264 138 F 138 (148)
Q Consensus 138 f 138 (148)
.
T Consensus 76 ~ 76 (160)
T PRK04860 76 V 76 (160)
T ss_pred H
Confidence 3
No 13
>PF01863 DUF45: Protein of unknown function DUF45; InterPro: IPR002725 Members of this family are found in some archaebacteria, as well as Helicobacter pylori. The proteins are 190-240 amino acids long, with the C terminus being the most conserved region, containing three conserved histidines.
Probab=90.92 E-value=0.63 Score=34.14 Aligned_cols=69 Identities=14% Similarity=0.137 Sum_probs=36.6
Q ss_pred HHHHHHHHHHHHHHHHhCCcCCCCCCcccEEEeCCCC--CCchhhhhhhhhhccccccccccchhhhhHHHHhhhhhhcC
Q psy2264 62 YIFDKGPKILAALSDYMGFDYYKMLPKMDLVAVPDFD--AGAMENWGMNTYRLGLVVEATHLYLLQHTSMIRMTNIPWFP 139 (148)
Q Consensus 62 ~~l~~~~~~l~~~e~~~g~~y~~p~~k~d~v~vp~~~--~~~MEn~Gli~~~e~~ll~~~~~~~~~~~~iaHElaHqWfG 139 (148)
.+.+..++.+..+++.+|.++ .-|.+-+.. .|.--.-|.|.++-..+..+.. ..+-+|+|||||--.-
T Consensus 109 ~~~~~l~~~~~~~~~~~~~~~-------~~i~ir~~ksrWGsc~~~~~I~ln~~L~~~P~~---~idYVvvHEL~Hl~~~ 178 (205)
T PF01863_consen 109 QAKEYLPERLKKYAKKLGLPP-------PKIKIRDMKSRWGSCSSKGNITLNWRLVMAPPE---VIDYVVVHELCHLRHP 178 (205)
T ss_pred HHHHHHHHHHHHHHHHcCCCc-------ceEEEeehhhccccCCCCCcEEeecccccCCcc---HHHHHHHHHHHHhccC
Confidence 344555666666667666544 234443321 2333334455555444444332 2344799999997655
Q ss_pred C
Q psy2264 140 A 140 (148)
Q Consensus 140 n 140 (148)
|
T Consensus 179 n 179 (205)
T PF01863_consen 179 N 179 (205)
T ss_pred C
Confidence 4
No 14
>PF06114 DUF955: Domain of unknown function (DUF955); InterPro: IPR010359 This is a family of bacterial and viral proteins with undetermined function. A conserved H-E-X-X-H motif is suggestive of a catalytic active site and shows similarity to IPR001915 from INTERPRO.; PDB: 3DTE_A 3DTK_A 3DTI_A.
Probab=88.66 E-value=0.27 Score=32.26 Aligned_cols=30 Identities=7% Similarity=-0.096 Sum_probs=18.7
Q ss_pred ccccccccccc-hhhhhHHHHhhhhhhcCCe
Q psy2264 112 LGLVVEATHLY-LLQHTSMIRMTNIPWFPAW 141 (148)
Q Consensus 112 e~~ll~~~~~~-~~~~~~iaHElaHqWfGn~ 141 (148)
...+..+...+ ..+..+++|||+|.+++..
T Consensus 28 ~~~I~in~~~~~~~~~f~laHELgH~~~~~~ 58 (122)
T PF06114_consen 28 NPIIFINSNLSPERQRFTLAHELGHILLHHG 58 (122)
T ss_dssp TTEEEEESSS-HHHHHHHHHHHHHHHHHHH-
T ss_pred CCEEEECCCCCHHHHHHHHHHHHHHHHhhhc
Confidence 44455554433 2345689999999998754
No 15
>PF10026 DUF2268: Predicted Zn-dependent protease (DUF2268); InterPro: IPR018728 This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function.
Probab=86.29 E-value=2.2 Score=31.49 Aligned_cols=67 Identities=6% Similarity=-0.066 Sum_probs=36.4
Q ss_pred HHHHHHHHHHHHHhCCcCCCCCCcccEEEeCCCCCC--chhh---hhhhhhhcccccc--ccccc-hhhhhHHHHhhhhh
Q psy2264 65 DKGPKILAALSDYMGFDYYKMLPKMDLVAVPDFDAG--AMEN---WGMNTYRLGLVVE--ATHLY-LLQHTSMIRMTNIP 136 (148)
Q Consensus 65 ~~~~~~l~~~e~~~g~~y~~p~~k~d~v~vp~~~~~--~MEn---~Gli~~~e~~ll~--~~~~~-~~~~~~iaHElaHq 136 (148)
+.+.+.+....+.+ |.+++++.++|.-+.+ -+++ .|-..+....++. +.... ..-..+||||+.|-
T Consensus 3 ~~i~~~~~~~~~~~------~~~~i~v~i~p~~~~~~~~~~~~g~~g~~~~~~~i~l~~~~~~~~~~~l~~~iaHE~hH~ 76 (195)
T PF10026_consen 3 EIIEEALEKSIELL------PGPDIPVFIFPADPENPFLIPELGGKGGGAIPGYIFLFLLPNDYSLEELPALIAHEYHHN 76 (195)
T ss_pred HHHHHHHHHHHHHc------CCCCCCEEEEeccCCCcccccccCcccccCCCCEEEEEecCCcccHHHHHHHHHHHHHHH
Confidence 34566666666666 5567888766643322 2222 3444444444333 22222 12234699999998
Q ss_pred h
Q psy2264 137 W 137 (148)
Q Consensus 137 W 137 (148)
+
T Consensus 77 ~ 77 (195)
T PF10026_consen 77 C 77 (195)
T ss_pred H
Confidence 5
No 16
>PF01435 Peptidase_M48: Peptidase family M48 This is family M48 in the peptidase classification. ; InterPro: IPR001915 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M48 (Ste24 endopeptidase family, clan M-); members of both subfamily are represented. The members of this set of proteins are mostly described as probable protease htpX homologue (3.4.24 from EC) or CAAX prenyl protease 1, which proteolytically removes the C-terminal three residues of farnesylated proteins. They are integral membrane proteins associated with the endoplasmic reticulum and Golgi, binding one zinc ion per subunit. In Saccharomyces cerevisiae (Baker's yeast) Ste24p is required for the first NH2-terminal proteolytic processing event within the a-factor precursor, which takes place after COOH-terminal CAAX modification is complete. The Ste24p contains multiple predicted membrane spans, a zinc metalloprotease motif (HEXXH), and a COOH-terminal ER retrieval signal (KKXX). The HEXXH protease motif is critical for Ste24p activity, since Ste24p fails to function when conserved residues within this motif are mutated. The Ste24p homologues occur in a diverse group of organisms, including Escherichia coli, Schizosaccharomyces pombe (Fission yeast), Haemophilus influenzae, and Homo sapiens (Human), which indicates that the gene is highly conserved throughout evolution. Ste24p and the proteins related to it define a subfamily of proteins that are likely to function as intracellular, membrane-associated zinc metalloproteases []. HtpX is a zinc-dependent endoprotease member of the membrane-localized proteolytic system in E. coli, which participates in the proteolytic quality control of membrane proteins in conjunction with FtsH, a membrane-bound and ATP-dependent protease. Biochemical characterisation revealed that HtpX undergoes self-degradation upon cell disruption or membrane solubilization. It can also degraded casein and cleaves solubilized membrane proteins, for example, SecY []. Expression of HtpX in the plasma membrane is under the control of CpxR, with the metalloproteinase active site of HtpX located on the cytosolic side of the membrane. This suggests a potential role for HtpX in the response to mis-folded proteins [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis, 0016020 membrane; PDB: 3CQB_A 3C37_B.
Probab=83.14 E-value=0.95 Score=33.39 Aligned_cols=16 Identities=0% Similarity=-0.275 Sum_probs=12.4
Q ss_pred hhHHHHhhhhhhcCCe
Q psy2264 126 HTSMIRMTNIPWFPAW 141 (148)
Q Consensus 126 ~~~iaHElaHqWfGn~ 141 (148)
..+||||++|---++.
T Consensus 90 ~aVlaHElgH~~~~h~ 105 (226)
T PF01435_consen 90 AAVLAHELGHIKHRHI 105 (226)
T ss_dssp HHHHHHHHHHHHTTHC
T ss_pred HHHHHHHHHHHHcCCc
Confidence 3479999999876654
No 17
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=82.97 E-value=1.9 Score=30.21 Aligned_cols=61 Identities=11% Similarity=0.010 Sum_probs=32.3
Q ss_pred HHHHHH-HHhCCcCCCCCCcccEEEeCCCCCCchh-hhhhhhhhccccccccccch-----hhhhHHHHhhhhhhcC
Q psy2264 70 ILAALS-DYMGFDYYKMLPKMDLVAVPDFDAGAME-NWGMNTYRLGLVVEATHLYL-----LQHTSMIRMTNIPWFP 139 (148)
Q Consensus 70 ~l~~~e-~~~g~~y~~p~~k~d~v~vp~~~~~~ME-n~Gli~~~e~~ll~~~~~~~-----~~~~~iaHElaHqWfG 139 (148)
.+..+. .+|+.++ |-+ .|.... .|- .||.-..+...|..++.... .-..+|.||++|.+..
T Consensus 6 ~~~~~n~~~F~~~l--~~~---~i~w~~----r~~~~~G~~~~~~~~I~ln~~l~~~~~~~~l~~~l~HEm~H~~~~ 73 (146)
T smart00731 6 RLEDASLRVFGRKL--PHP---KVVWNK----RLRKTGGRCLLKSAEIRLNPKLLTENGRDRLRETLLHELCHAALY 73 (146)
T ss_pred HHHHHHHHHHCCCC--CCC---EEEEeh----hhhhhhHHhhcCCCEEEeCHHHHhhccHHHHHhhHHHHHHHHHHH
Confidence 344444 6888677 544 222211 222 35665554444554443311 1123699999999874
No 18
>PF13574 Reprolysin_2: Metallo-peptidase family M12B Reprolysin-like; PDB: 1KAP_P 1JIW_P 1AKL_A 1OM7_A 1OM8_A 1O0T_A 1OM6_A 1H71_P 1O0Q_A 1OMJ_A ....
Probab=79.54 E-value=0.91 Score=32.85 Aligned_cols=11 Identities=0% Similarity=-0.091 Sum_probs=9.6
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
..+||||+||+
T Consensus 113 ~~~aHElGH~l 123 (173)
T PF13574_consen 113 DTFAHELGHQL 123 (173)
T ss_dssp HHHHHHHHHHH
T ss_pred eeehhhhHhhc
Confidence 46999999996
No 19
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised. Proteins in this family are typically between 333 and 377 amino acids in length and contain a conserved HEXXH sequence motif that is characteristic of metallopeptidases. This family may therefore belong to an as yet uncharacterised family of peptidase enzymes.
Probab=78.93 E-value=1.6 Score=34.87 Aligned_cols=10 Identities=0% Similarity=-0.153 Sum_probs=9.0
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
..++||+|||
T Consensus 198 ~T~~HElAHq 207 (318)
T PF12725_consen 198 FTICHELAHQ 207 (318)
T ss_pred HHHHHHHHHH
Confidence 4699999998
No 20
>COG0501 HtpX Zn-dependent protease with chaperone function [Posttranslational modification, protein turnover, chaperones]
Probab=73.69 E-value=4.2 Score=31.44 Aligned_cols=69 Identities=14% Similarity=0.032 Sum_probs=35.8
Q ss_pred HHHHHHHHhCCcCCCCCCcccEEEeCCCCCCchhhh---hhhhhhccccccccccchhhhhHHHHhhhhhhcCCeee
Q psy2264 70 ILAALSDYMGFDYYKMLPKMDLVAVPDFDAGAMENW---GMNTYRLGLVVEATHLYLLQHTSMIRMTNIPWFPAWIS 143 (148)
Q Consensus 70 ~l~~~e~~~g~~y~~p~~k~d~v~vp~~~~~~MEn~---Gli~~~e~~ll~~~~~~~~~~~~iaHElaHqWfGn~Vt 143 (148)
.+..+...-+.++ -+++.++-.|..+.-++.+. |.|...+..+- ...++.-+.+++||++|.=-++.++
T Consensus 104 ~v~~~a~~~~~~~---~~~v~i~~~~~~NAFa~g~~~~~~~V~vt~gLl~--~l~~dEl~aVlaHElgHi~~rd~~~ 175 (302)
T COG0501 104 KVAELARQAGIPH---MPEVYILETPQPNAFALGGGPKNGRVVVTTGLLD--LLNDDELEAVLAHELGHIKNRHTLV 175 (302)
T ss_pred HHHHHHHHCCCCC---CCeeEEecCCCccceecCCCCCCeeEEecHHHHh--hCCHHHHHHHHHHHHHHHhcccHHH
Confidence 3344444444332 45555555554444455553 66665544332 1111123457999999987666543
No 21
>PF01447 Peptidase_M4: Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site. This is family M4 in the peptidase classification. ; InterPro: IPR013856 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases that belong to the MEROPS peptidase family M4 (thermolysin family, clan MA(E)). The protein fold of the peptidase domain of thermolysin, is the type example for members of the clan MA. The thermolysin family is composed only of secreted eubacterial endopeptidases. The zinc-binding residues are H-142, H-146 and E-166, with E-143 acting as the catalytic residue. Thermolysin also contains 4 calcium-binding sites, which contribute to its unusual thermostability. The family also includes enzymes from a number of pathogens, including Legionella and Listeria, and the protein pseudolysin, all with a substrate specificity for an aromatic residue in the P1' position. Three-dimensional structure analysis has shown that the enzymes undergo a hinge-bend motion during catalysis. Pseudolysin has a broader specificity, acting on large molecules such as elastin and collagen, possibly due to its wider active site cleft []. This entry represents a domain found in peptidase M4 family members.; GO: 0004222 metalloendopeptidase activity; PDB: 3NQX_A 3NQZ_B 3NQY_B 1BQB_A 1U4G_A 1EZM_A 3DBK_A 1ESP_A 1NPC_A 1LND_E ....
Probab=72.41 E-value=7.3 Score=27.68 Aligned_cols=22 Identities=9% Similarity=0.033 Sum_probs=18.0
Q ss_pred cHHHHHHHHHHHHHHHHHHhCC
Q psy2264 59 QGQYIFDKGPKILAALSDYMGF 80 (148)
Q Consensus 59 ~~~~~l~~~~~~l~~~e~~~g~ 80 (148)
.+..+..-+.+..++|.+.||.
T Consensus 68 ~~vdA~~~~~~v~d~y~~~~gr 89 (150)
T PF01447_consen 68 AAVDAHYNAGKVYDYYKNVFGR 89 (150)
T ss_dssp HHHHHHHHHHHHHHHHHHHHSS
T ss_pred HHHHHHHhHHHHHHHHHHHHCC
Confidence 4566777888999999999994
No 22
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]
Probab=71.69 E-value=2.6 Score=35.44 Aligned_cols=47 Identities=15% Similarity=0.054 Sum_probs=25.7
Q ss_pred cccEEEeCCCCCCchhhhhhhhh-hccccccccccchhhhhHHHHhhhh
Q psy2264 88 KMDLVAVPDFDAGAMENWGMNTY-RLGLVVEATHLYLLQHTSMIRMTNI 135 (148)
Q Consensus 88 k~d~v~vp~~~~~~MEn~Gli~~-~e~~ll~~~~~~~~~~~~iaHElaH 135 (148)
-+.+++|-+-..++=-.+|--++ +...++..+... .--.+||||++|
T Consensus 93 ~f~f~lV~d~~iNAFA~~Gg~v~vntGLll~ae~es-ElagViAHEigH 140 (484)
T COG4783 93 PFTFFLVNDDSINAFATPGGYVVVNTGLLLTAENES-ELAGVIAHEIGH 140 (484)
T ss_pred CeEEEEecCCccchhhcCCceEEEehHHHHhcCCHH-HHHHHHHHHHHH
Confidence 45888886655555555443333 333333333211 122469999999
No 23
>PF13699 DUF4157: Domain of unknown function (DUF4157)
Probab=67.41 E-value=2.6 Score=26.58 Aligned_cols=63 Identities=13% Similarity=0.014 Sum_probs=29.5
Q ss_pred HHHHHHHHhCCcCCCCCCcccEEEeCCCC--CCchhhhhhhhhhcccccccccc---chhhhhHHHHhhhhhh
Q psy2264 70 ILAALSDYMGFDYYKMLPKMDLVAVPDFD--AGAMENWGMNTYRLGLVVEATHL---YLLQHTSMIRMTNIPW 137 (148)
Q Consensus 70 ~l~~~e~~~g~~y~~p~~k~d~v~vp~~~--~~~MEn~Gli~~~e~~ll~~~~~---~~~~~~~iaHElaHqW 137 (148)
+-..||..||.++ ++..+-.=|.-. ...+ ++-.++..+...+..... +.....+++||++|=+
T Consensus 6 ~r~~~e~~~G~dl----~~Vrvh~~~~a~~~~~~~-~A~A~T~G~~I~f~~g~~~~~s~~~~~llaHEl~Hv~ 73 (79)
T PF13699_consen 6 IRSRLERAFGADL----SDVRVHTGPAASRAAAAL-GARAFTVGNDIYFAPGKYNPDSPEGRALLAHELAHVV 73 (79)
T ss_pred HHHHHHHHhCCCc----cceEEEeCCchhhhhhcc-CCeEEEECCEEEEcCCCcCCCCCCcchhHhHHHHHHH
Confidence 4567889998555 332222212111 1122 122344444444422211 1223568999999943
No 24
>cd04269 ZnMc_adamalysin_II_like Zinc-dependent metalloprotease; adamalysin_II_like subfamily. Adamalysin II is a snake venom zinc endopeptidase. This subfamily contains other snake venom metalloproteinases, as well as membrane-anchored metalloproteases belonging to the ADAM family. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=67.24 E-value=22 Score=25.73 Aligned_cols=12 Identities=8% Similarity=-0.050 Sum_probs=9.8
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
..++||||+|+.
T Consensus 132 a~~~AHElGH~l 143 (194)
T cd04269 132 AVTMAHELGHNL 143 (194)
T ss_pred HHHHHHHHHhhc
Confidence 357999999985
No 25
>COG1451 Predicted metal-dependent hydrolase [General function prediction only]
Probab=66.88 E-value=9.7 Score=28.86 Aligned_cols=66 Identities=9% Similarity=-0.011 Sum_probs=33.9
Q ss_pred HHHHHHHHHHHHHHHHhCCcCCCCCCcccEEEeCCCCCCchh-hhhhhhhhcccccccccc-c---hhhhhHHHHhhhhh
Q psy2264 62 YIFDKGPKILAALSDYMGFDYYKMLPKMDLVAVPDFDAGAME-NWGMNTYRLGLVVEATHL-Y---LLQHTSMIRMTNIP 136 (148)
Q Consensus 62 ~~l~~~~~~l~~~e~~~g~~y~~p~~k~d~v~vp~~~~~~ME-n~Gli~~~e~~ll~~~~~-~---~~~~~~iaHElaHq 136 (148)
.+.+..+..++.+.+.+|.++ ..+-+- .|- -||-..... .+..+-.. . ..-+-+|+||+||=
T Consensus 120 ~~~~~l~~~~~~~~~~l~~~~-------~~~~ik-----~~k~~WGScs~~~-~i~~~~~l~~~p~~~i~YVvvHELaHL 186 (223)
T COG1451 120 ILREILEIRLKEYAKKLGVPP-------RAIKLK-----NMKRRWGSCSKAG-EIRFNWRLVMAPEEVIDYVVVHELAHL 186 (223)
T ss_pred HHHHHHHHHHHHHHHHhCCCc-------cceeee-----eccceeeeecCCC-cEEeehhhhcCCHHHHHHHHHHHHHHH
Confidence 455666777777778888766 222221 121 255444433 22222111 0 11233699999995
Q ss_pred hcCC
Q psy2264 137 WFPA 140 (148)
Q Consensus 137 WfGn 140 (148)
=..|
T Consensus 187 ke~n 190 (223)
T COG1451 187 KEKN 190 (223)
T ss_pred hhhh
Confidence 5444
No 26
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism]
Probab=65.84 E-value=3.8 Score=30.88 Aligned_cols=53 Identities=6% Similarity=-0.098 Sum_probs=28.3
Q ss_pred CcccEEEeCCCCCCchhhhh-hhhhhcc--ccccccccc-hhhhhHHHHhhhhhhcCCe
Q psy2264 87 PKMDLVAVPDFDAGAMENWG-MNTYRLG--LVVEATHLY-LLQHTSMIRMTNIPWFPAW 141 (148)
Q Consensus 87 ~k~d~v~vp~~~~~~MEn~G-li~~~e~--~ll~~~~~~-~~~~~~iaHElaHqWfGn~ 141 (148)
.+.++++++.- +.+.|+. .-.|.+. .+..+...+ ..++.++||||+|=|++--
T Consensus 32 e~~gv~vf~~~--~~~~~~d~~~~~~~~~~~I~iN~n~~~~r~rFtlAHELGH~llH~~ 88 (213)
T COG2856 32 EKAGVLVFELS--FINKNIDAYGLYDEEKPVIYINANNSLERKRFTLAHELGHALLHTD 88 (213)
T ss_pred hcCCeEEEecc--ccccccccceeeeccCceEEEeCCCCHHHHHHHHHHHHhHHHhccc
Confidence 45566666541 2333332 3333322 333343333 3345689999999998754
No 27
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs. Metalloproteases secreted by the salivary glands of arthropods.
Probab=65.82 E-value=13 Score=27.63 Aligned_cols=12 Identities=8% Similarity=-0.188 Sum_probs=9.7
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
..++||||+|..
T Consensus 146 ~~~~AHElGH~l 157 (220)
T cd04272 146 VYTMTHELAHLL 157 (220)
T ss_pred HHHHHHHHHHHh
Confidence 457999999964
No 28
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases.
Probab=65.74 E-value=3.4 Score=28.92 Aligned_cols=12 Identities=0% Similarity=-0.080 Sum_probs=10.7
Q ss_pred hHHHHhhhhhhc
Q psy2264 127 TSMIRMTNIPWF 138 (148)
Q Consensus 127 ~~iaHElaHqWf 138 (148)
.+|+||++|.|.
T Consensus 62 ~tL~HEm~H~~~ 73 (157)
T PF10263_consen 62 DTLLHEMAHAAA 73 (157)
T ss_pred HHHHHHHHHHHh
Confidence 469999999998
No 29
>PF13688 Reprolysin_5: Metallo-peptidase family M12; PDB: 2FV5_B 3EWJ_A 3KME_A 3L0T_B 1BKC_E 3G42_D 2I47_D 2FV9_B 3LEA_A 1ZXC_B ....
Probab=65.21 E-value=3.2 Score=30.11 Aligned_cols=11 Identities=0% Similarity=-0.109 Sum_probs=9.3
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
.++||||+|.+
T Consensus 144 ~~~AHEiGH~l 154 (196)
T PF13688_consen 144 ITFAHEIGHNL 154 (196)
T ss_dssp HHHHHHHHHHT
T ss_pred hhhHHhHHHhc
Confidence 46999999975
No 30
>PHA02456 zinc metallopeptidase motif-containing protein
Probab=64.88 E-value=4.4 Score=27.54 Aligned_cols=13 Identities=15% Similarity=0.389 Sum_probs=11.0
Q ss_pred hhhHHHHhhhhhh
Q psy2264 125 QHTSMIRMTNIPW 137 (148)
Q Consensus 125 ~~~~iaHElaHqW 137 (148)
.+..++||++|-|
T Consensus 79 C~~TL~HEL~H~W 91 (141)
T PHA02456 79 CRDTLAHELNHAW 91 (141)
T ss_pred hHHHHHHHHHHHH
Confidence 3457999999999
No 31
>PF08325 WLM: WLM domain; InterPro: IPR013536 The WLM (WSS1-like metalloprotease) domain is a globular domain related to the zincin-like superfamily of Zn-dependent peptidase. Since the WLM domain contains all known active site residues of zincins, it is predicted to be a catalytically active peptidase domain. The WLM domain is a eukaryotic domain represented in plants, fungi, Plasmodium, and kinetoplastids. By contrast, it is absent in animals, Cryptosporidium, and Microsporidia, suggesting that it has been lost on multiple occasions during the evolution of eukaryotes. The WLM domain is found either in stand-alone form or in association with other domains such as the RanBP2 zinc finger , the ubiquitin domain, or the PUB/PUG domain. This domain could function as a specific de-SUMOylating domain of distinct protein complexes in the nucleus and the cytoplasm []. It has been suggested to form a segregated alpha/beta structure with eight helices and five strands. Proteins containign this domain include yeast WSS1 (a weak suppressor of the Ub-related protein SMT3), and various putative metalloproteases from plant and fungal species.
Probab=64.59 E-value=3.6 Score=30.32 Aligned_cols=13 Identities=8% Similarity=-0.036 Sum_probs=11.8
Q ss_pred HHHHhhhhhhcCC
Q psy2264 128 SMIRMTNIPWFPA 140 (148)
Q Consensus 128 ~iaHElaHqWfGn 140 (148)
++.|||||-++|+
T Consensus 85 t~lHELaH~~~~~ 97 (186)
T PF08325_consen 85 TMLHELAHNVHGP 97 (186)
T ss_pred HHHHHHHhcccCC
Confidence 5899999999997
No 32
>PF10460 Peptidase_M30: Peptidase M30; InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This family contains metallopeptidases belonging to MEROPS peptidase family M30 (hyicolysin family, clan MA). Hyicolysin has a zinc ion which is liganded by two histidine and one glutamate residue.
Probab=64.44 E-value=15 Score=29.99 Aligned_cols=37 Identities=19% Similarity=0.344 Sum_probs=20.2
Q ss_pred ceEEEecCccc----cc--cHHHHHHH-HH--HHHHHHHHHhCCcC
Q psy2264 46 KFRVWGREDVV----KT--QGQYIFDK-GP--KILAALSDYMGFDY 82 (148)
Q Consensus 46 ~i~v~~~~~~~----~~--~~~~~l~~-~~--~~l~~~e~~~g~~y 82 (148)
.+.||+..+.. .. .++...+. .. ++-....+.||.|+
T Consensus 20 ~vnvWVed~e~~~~~is~~~~~~l~~~F~~~~~iYp~~~~ifG~pw 65 (366)
T PF10460_consen 20 TVNVWVEDGEYGSNKISDAQADSLAQEFDNSGKIYPRLVEIFGEPW 65 (366)
T ss_pred EEEEEEEcCccCccccCHHHHHHHHHHhccccccchhHHHhcCCCC
Confidence 78899887620 22 12222222 22 46666777888773
No 33
>PRK03982 heat shock protein HtpX; Provisional
Probab=61.87 E-value=12 Score=29.20 Aligned_cols=14 Identities=0% Similarity=-0.358 Sum_probs=10.2
Q ss_pred hHHHHhhhhhhcCC
Q psy2264 127 TSMIRMTNIPWFPA 140 (148)
Q Consensus 127 ~~iaHElaHqWfGn 140 (148)
.++|||++|-==|+
T Consensus 127 AVlAHElgHi~~~h 140 (288)
T PRK03982 127 GVIAHELTHIKNRD 140 (288)
T ss_pred HHHHHHHHHHHcCC
Confidence 46999999964433
No 34
>PRK01345 heat shock protein HtpX; Provisional
Probab=61.16 E-value=13 Score=29.59 Aligned_cols=15 Identities=7% Similarity=-0.312 Sum_probs=10.9
Q ss_pred hhHHHHhhhhhhcCC
Q psy2264 126 HTSMIRMTNIPWFPA 140 (148)
Q Consensus 126 ~~~iaHElaHqWfGn 140 (148)
..++|||++|-==++
T Consensus 125 ~aVlAHElgHi~~~d 139 (317)
T PRK01345 125 AGVMAHELAHVKNRD 139 (317)
T ss_pred HHHHHHHHHHHHcCC
Confidence 347999999964444
No 35
>PRK03001 M48 family peptidase; Provisional
Probab=60.64 E-value=14 Score=28.84 Aligned_cols=12 Identities=8% Similarity=-0.232 Sum_probs=9.1
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
..++|||++|-=
T Consensus 125 ~aVlAHElgHi~ 136 (283)
T PRK03001 125 RGVMAHELAHVK 136 (283)
T ss_pred HHHHHHHHHHHh
Confidence 346999999953
No 36
>cd04279 ZnMc_MMP_like_1 Zinc-dependent metalloprotease; MMP_like sub-family 1. A group of bacterial, archaeal, and fungal metalloproteinase domains similar to matrix metalloproteinases and astacin.
Probab=60.18 E-value=49 Score=23.02 Aligned_cols=36 Identities=11% Similarity=0.106 Sum_probs=24.3
Q ss_pred ceEEEecCcccc---ccHHHHHHHHHHHHHHHHHHhCCcC
Q psy2264 46 KFRVWGREDVVK---TQGQYIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 46 ~i~v~~~~~~~~---~~~~~~l~~~~~~l~~~e~~~g~~y 82 (148)
++++|..+.. . .......+...++++..+++.++.+
T Consensus 3 ~i~~~i~~~~-~~~~~~~~~~~~~v~~A~~~W~~~~~l~F 41 (156)
T cd04279 3 PIRVYIDPTP-APPDSRAQSWLQAVKQAAAEWENVGPLKF 41 (156)
T ss_pred CeEEEEcCCC-CccccchHHHHHHHHHHHHHHHHhCCeEE
Confidence 5677776653 2 2345567788888888888876554
No 37
>PRK03072 heat shock protein HtpX; Provisional
Probab=56.89 E-value=18 Score=28.38 Aligned_cols=14 Identities=0% Similarity=-0.230 Sum_probs=10.0
Q ss_pred hHHHHhhhhhhcCC
Q psy2264 127 TSMIRMTNIPWFPA 140 (148)
Q Consensus 127 ~~iaHElaHqWfGn 140 (148)
.++|||++|-==|+
T Consensus 129 aVlAHElgHi~~~d 142 (288)
T PRK03072 129 GVLGHELSHVYNRD 142 (288)
T ss_pred HHHHHHHHHHhcCC
Confidence 46999999953333
No 38
>cd04273 ZnMc_ADAMTS_like Zinc-dependent metalloprotease, ADAMTS_like subgroup. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions. This particular subfamily represents domain architectures that combine ADAM-like metalloproteinases with thrombospondin type-1 repeats. ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) proteinases are inhibited by TIMPs (tissue inhibitors of metalloproteinases), and they play roles in coagulation, angiogenesis, development and progression of arthritis. They hydrolyze the von Willebrand factor precursor and various components of the extracellular matrix.
Probab=56.33 E-value=5.9 Score=29.26 Aligned_cols=10 Identities=0% Similarity=-0.173 Sum_probs=8.4
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.++||||+|.
T Consensus 142 ~~~aHElGH~ 151 (207)
T cd04273 142 FTIAHELGHV 151 (207)
T ss_pred Eeeeeechhh
Confidence 4699999995
No 39
>PRK02870 heat shock protein HtpX; Provisional
Probab=54.08 E-value=16 Score=29.51 Aligned_cols=10 Identities=10% Similarity=-0.114 Sum_probs=8.5
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.++|||++|-
T Consensus 175 aVlAHELgHi 184 (336)
T PRK02870 175 AVMAHELSHI 184 (336)
T ss_pred HHHHHHHHHH
Confidence 4699999995
No 40
>PF13582 Reprolysin_3: Metallo-peptidase family M12B Reprolysin-like; PDB: 3P24_C.
Probab=53.89 E-value=6.7 Score=26.12 Aligned_cols=12 Identities=0% Similarity=-0.138 Sum_probs=9.6
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
...++|||+|..
T Consensus 108 ~~~~~HEiGH~l 119 (124)
T PF13582_consen 108 VDTFAHEIGHNL 119 (124)
T ss_dssp TTHHHHHHHHHT
T ss_pred ceEeeehhhHhc
Confidence 357999999973
No 41
>PF13265 DUF4056: Protein of unknown function (DUF4056)
Probab=53.61 E-value=5.8 Score=30.80 Aligned_cols=11 Identities=9% Similarity=0.311 Sum_probs=8.8
Q ss_pred HHHhhhhhhcCC
Q psy2264 129 MIRMTNIPWFPA 140 (148)
Q Consensus 129 iaHElaHqWfGn 140 (148)
--|||| ||||=
T Consensus 152 ~WHEIA-QWyG~ 162 (270)
T PF13265_consen 152 QWHEIA-QWYGY 162 (270)
T ss_pred HHHHHH-HHcCc
Confidence 349998 89994
No 42
>PF04450 BSP: Peptidase of plants and bacteria; InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [].
Probab=52.37 E-value=27 Score=26.10 Aligned_cols=13 Identities=8% Similarity=-0.051 Sum_probs=9.9
Q ss_pred HHHHhhhhhhcCC
Q psy2264 128 SMIRMTNIPWFPA 140 (148)
Q Consensus 128 ~iaHElaHqWfGn 140 (148)
+|.||++|-|=.|
T Consensus 99 vl~HE~~H~~Q~~ 111 (205)
T PF04450_consen 99 VLYHEMVHCWQWD 111 (205)
T ss_pred HHHHHHHHHhhcC
Confidence 5899999966543
No 43
>KOG3658|consensus
Probab=51.35 E-value=4.1 Score=35.73 Aligned_cols=10 Identities=0% Similarity=0.082 Sum_probs=9.1
Q ss_pred HHHHhhhhhh
Q psy2264 128 SMIRMTNIPW 137 (148)
Q Consensus 128 ~iaHElaHqW 137 (148)
.+|||+.|.|
T Consensus 395 t~AHEiGHNf 404 (764)
T KOG3658|consen 395 TLAHEIGHNF 404 (764)
T ss_pred eehhhhcccc
Confidence 5899999998
No 44
>PF13402 M60-like: Peptidase M60-like family; PDB: 4FCA_A.
Probab=49.71 E-value=22 Score=27.60 Aligned_cols=78 Identities=13% Similarity=0.042 Sum_probs=38.3
Q ss_pred ccHHHHHHHHHHHHHHHHHHhCCcCC------CCCCcccEEEeCCCCCCchh-hhhhhhhhccc---cccccccchhhhh
Q psy2264 58 TQGQYIFDKGPKILAALSDYMGFDYY------KMLPKMDLVAVPDFDAGAME-NWGMNTYRLGL---VVEATHLYLLQHT 127 (148)
Q Consensus 58 ~~~~~~l~~~~~~l~~~e~~~g~~y~------~p~~k~d~v~vp~~~~~~ME-n~Gli~~~e~~---ll~~~~~~~~~~~ 127 (148)
.+.+..++...++++...++.|.+.. +|..+..+|.-.....+.|- ..+-|.+..+. ++..... ....-
T Consensus 143 ~d~~~ll~~~D~ii~~~~el~Gl~~~~~~~~~~~~~~~r~v~~v~~~~g~m~a~g~~i~~~~~~~~~~l~~~~~-~~~~W 221 (307)
T PF13402_consen 143 EDPEELLRFWDRIIDAEYELAGLDKSSPGPENNPMPNNRFVFDVQISAGYMHASGYPIGFPPNWMNELLNPNPL-RKGGW 221 (307)
T ss_dssp SSSHHHHHHHHHHHHHHHHHTT-BSS--GGGB--S--EEEEEETT----SEEEETTEEEEETT--HHHH-HHHH-HHH-H
T ss_pred hhHHHHHHHHHHHHHHHHHHhCCCcccCCccccCcccceEEEeccccccceeecCCcEEeeCcHHhcccCHhHc-CCCCe
Confidence 34667778888899999999997762 12222366666666666776 23333333221 1110000 00112
Q ss_pred HHHHhhhhh
Q psy2264 128 SMIRMTNIP 136 (148)
Q Consensus 128 ~iaHElaHq 136 (148)
-+.||+.|+
T Consensus 222 G~~HE~GH~ 230 (307)
T PF13402_consen 222 GPWHELGHN 230 (307)
T ss_dssp HHHHHHHHH
T ss_pred eehhhhhhh
Confidence 389999996
No 45
>PF10023 DUF2265: Predicted aminopeptidase (DUF2265); InterPro: IPR014553 This group represents a predicted aminopeptidase.
Probab=49.47 E-value=8 Score=31.25 Aligned_cols=42 Identities=17% Similarity=0.237 Sum_probs=25.0
Q ss_pred cccHHHHHHHHHHHHHHHHHHhCCc-------CC---CCCCcccEEEeCCCC
Q psy2264 57 KTQGQYIFDKGPKILAALSDYMGFD-------YY---KMLPKMDLVAVPDFD 98 (148)
Q Consensus 57 ~~~~~~~l~~~~~~l~~~e~~~g~~-------y~---~p~~k~d~v~vp~~~ 98 (148)
.+....-|..+.++=+|-.+.+|.| |. +|.--..+++.|.+.
T Consensus 45 ~~~lr~rL~~~~~iR~FA~~~L~Lpdn~sY~~YadL~Rp~vvWnV~Aap~~s 96 (337)
T PF10023_consen 45 PPALRARLRLAQQIRRFASEELGLPDNGSYRSYADLDRPYVVWNVFAAPEFS 96 (337)
T ss_pred CHHHHHHHHHHHHHHHHHHHhcCCCCCCChhhhhhcCCCcEEEEEEecCccc
Confidence 4455566677777778877777744 11 122233567777664
No 46
>COG4324 Predicted aminopeptidase [General function prediction only]
Probab=49.11 E-value=8.8 Score=30.23 Aligned_cols=53 Identities=15% Similarity=0.227 Sum_probs=28.9
Q ss_pred cHHHHHHHHHHHHHHHHHHhCCc-------CC---CCCCcccEEEeCCCCCCchh----hhhhhhhh
Q psy2264 59 QGQYIFDKGPKILAALSDYMGFD-------YY---KMLPKMDLVAVPDFDAGAME----NWGMNTYR 111 (148)
Q Consensus 59 ~~~~~l~~~~~~l~~~e~~~g~~-------y~---~p~~k~d~v~vp~~~~~~ME----n~Gli~~~ 111 (148)
....-+..+.++-.|-++.++.| |. +|+-..++.+.|.+.....- -.||+.|+
T Consensus 79 rLr~rL~~A~aiR~fAseeL~LPDN~SYR~YadIgRp~vvwnVFAaPelSl~p~TwCFpv~GCV~YR 145 (376)
T COG4324 79 RLRARLTSASAIRRFASEELALPDNSSYRSYADIGRPDVVWNVFAAPELSLTPITWCFPVFGCVPYR 145 (376)
T ss_pred HHHHHHhhHHHHHHHHHHhccCCCCcceeeeeccCCcceeeeeccCcccccceeeeeeeeecceecc
Confidence 34455666777777777777754 11 23334456666776432221 13666664
No 47
>PF14891 Peptidase_M91: Effector protein
Probab=48.84 E-value=8.8 Score=27.71 Aligned_cols=11 Identities=0% Similarity=-0.064 Sum_probs=9.3
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
.+|+|||+|-|
T Consensus 105 v~L~HEL~HA~ 115 (174)
T PF14891_consen 105 VVLYHELIHAY 115 (174)
T ss_pred HHHHHHHHHHH
Confidence 36999999977
No 48
>PRK04351 hypothetical protein; Provisional
Probab=48.60 E-value=7.8 Score=27.52 Aligned_cols=10 Identities=0% Similarity=-0.406 Sum_probs=8.2
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.+|+||++|=
T Consensus 63 ~vv~HElcH~ 72 (149)
T PRK04351 63 GIIKHELCHY 72 (149)
T ss_pred hhHHHHHHHH
Confidence 4699999984
No 49
>cd04267 ZnMc_ADAM_like Zinc-dependent metalloprotease, ADAM_like or reprolysin_like subgroup. The adamalysin_like or ADAM family of metalloproteases contains proteolytic domains from snake venoms, proteases from the mammalian reproductive tract, and the tumor necrosis factor alpha convertase, TACE. ADAMs (A Disintegrin And Metalloprotease) are glycoproteins, which play roles in cell signaling, cell fusion, and cell-cell interactions.
Probab=47.80 E-value=8.3 Score=27.92 Aligned_cols=11 Identities=9% Similarity=-0.070 Sum_probs=8.9
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
.++||||+|..
T Consensus 135 ~~~aHElGH~l 145 (192)
T cd04267 135 LTMAHELGHNL 145 (192)
T ss_pred hhhhhhHHhhc
Confidence 47999999953
No 50
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=47.69 E-value=8.4 Score=27.55 Aligned_cols=22 Identities=18% Similarity=0.060 Sum_probs=12.4
Q ss_pred HHHHHHHHHHHHhCCcCCCCCCcc
Q psy2264 66 KGPKILAALSDYMGFDYYKMLPKM 89 (148)
Q Consensus 66 ~~~~~l~~~e~~~g~~y~~p~~k~ 89 (148)
...+.+.-.+..++..+ |-+|.
T Consensus 6 ~L~~~~~~as~~~~r~~--~~p~~ 27 (156)
T COG3091 6 KLQQCVEQASLKFFRKF--FRPKA 27 (156)
T ss_pred HHHHHHHHHHHHhcCCC--CCcce
Confidence 34455555565555577 65543
No 51
>PF08219 TOM13: Outer membrane protein TOM13; InterPro: IPR013262 The TOM13 family of proteins are mitochondrial outer membrane proteins that mediate the assembly of beta-barrel proteins [].; GO: 0005741 mitochondrial outer membrane
Probab=46.90 E-value=11 Score=23.62 Aligned_cols=12 Identities=0% Similarity=-0.155 Sum_probs=9.5
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
-+++|||+++.|
T Consensus 53 GEl~AhE~~fr~ 64 (77)
T PF08219_consen 53 GELFAHEIAFRL 64 (77)
T ss_pred HHHHHHHHHHHh
Confidence 357999999775
No 52
>PF01421 Reprolysin: Reprolysin (M12B) family zinc metalloprotease This Prosite motif covers only the active site.; InterPro: IPR001590 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12B (adamalysin family, clan (MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The adamalysins are zinc dependent endopeptidases found in snake venom. There are some mammalian proteins such as P78325 from SWISSPROT, and fertilin Q28472 from SWISSPROT. Fertilin and closely related proteins appear to not have some active site residues and may not be active enzymes. CD156 (also called ADAM8 (3.4.24 from EC) or MS2 human) has been implicated in extravasation of leukocytes. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2E3X_A 2W15_A 2W14_A 2W13_A 2W12_A 1ND1_A 3K7L_A 2DW2_A 2DW0_B 2DW1_A ....
Probab=46.53 E-value=42 Score=24.37 Aligned_cols=10 Identities=0% Similarity=-0.180 Sum_probs=8.3
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.++||||+|.
T Consensus 133 ~~~AHelGH~ 142 (199)
T PF01421_consen 133 VIIAHELGHN 142 (199)
T ss_dssp HHHHHHHHHH
T ss_pred HHHHHHHHHh
Confidence 4689999994
No 53
>KOG2661|consensus
Probab=45.95 E-value=13 Score=30.20 Aligned_cols=13 Identities=8% Similarity=-0.255 Sum_probs=10.3
Q ss_pred hhHHHHhhhhhhc
Q psy2264 126 HTSMIRMTNIPWF 138 (148)
Q Consensus 126 ~~~iaHElaHqWf 138 (148)
..+++||+|||--
T Consensus 276 AtvLgHE~aHaVa 288 (424)
T KOG2661|consen 276 ATVLGHEIAHAVA 288 (424)
T ss_pred HHHHHHHHHHHHH
Confidence 3579999999853
No 54
>cd04270 ZnMc_TACE_like Zinc-dependent metalloprotease; TACE_like subfamily. TACE, the tumor-necrosis factor-alpha converting enzyme, releases soluble TNF-alpha from transmembrane pro-TNF-alpha.
Probab=45.78 E-value=10 Score=28.97 Aligned_cols=11 Identities=0% Similarity=-0.163 Sum_probs=9.4
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
.++||||+|.+
T Consensus 169 ~t~AHElGHnl 179 (244)
T cd04270 169 LVTAHELGHNF 179 (244)
T ss_pred HHHHHHHHHhc
Confidence 46999999975
No 55
>PF05572 Peptidase_M43: Pregnancy-associated plasma protein-A; InterPro: IPR008754 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase M43 (cytophagalysin family, clan MA(M)), subfamily M43. The predicted active site residues for members of this family and thermolysin, the type example for clan MA, occur in the motif HEXXH. The type example of this family is the pregnancy-associated plasma protein A (PAPP-A), which cleaves insulin-like growth factor (IGF) binding protein-4 (IGFBP-4), causing a dramatic reduction in its affinity for IGF-I and -II. Through this mechanism, PAPP-A is a regulator of IGF bioactivity in several systems, including the Homo sapiens ovary and the cardiovascular system [, , , ].; PDB: 3LUN_A 3LUM_B 2J83_A 2CKI_A.
Probab=45.08 E-value=16 Score=25.94 Aligned_cols=16 Identities=6% Similarity=0.304 Sum_probs=10.6
Q ss_pred hhHHHHhhhhhhcCCee
Q psy2264 126 HTSMIRMTNIPWFPAWI 142 (148)
Q Consensus 126 ~~~iaHElaHqWfGn~V 142 (148)
...++||+.| |||=+=
T Consensus 70 g~TltHEvGH-~LGL~H 85 (154)
T PF05572_consen 70 GKTLTHEVGH-WLGLYH 85 (154)
T ss_dssp SHHHHHHHHH-HTT---
T ss_pred ccchhhhhhh-hhcccc
Confidence 4579999998 777543
No 56
>PF06262 DUF1025: Possibl zinc metallo-peptidase; InterPro: IPR010428 This is a family of bacterial protein with undetermined function.; PDB: 3E11_A.
Probab=44.41 E-value=7 Score=25.74 Aligned_cols=32 Identities=16% Similarity=0.026 Sum_probs=18.1
Q ss_pred hhhhhhhccccccccccchhhh---hHHHHhhhhh
Q psy2264 105 WGMNTYRLGLVVEATHLYLLQH---TSMIRMTNIP 136 (148)
Q Consensus 105 ~Gli~~~e~~ll~~~~~~~~~~---~~iaHElaHq 136 (148)
.-+++||......-......++ ..+.||+||.
T Consensus 50 ~rI~lyR~pl~~~~~~~~eL~~~I~~tlvhEiah~ 84 (97)
T PF06262_consen 50 DRIVLYRRPLERRARSREELAELIRDTLVHEIAHH 84 (97)
T ss_dssp EEEEEEHHHHHHT-SSHHHHHHHHHHHHHHHHHHH
T ss_pred CEEEEehHHHHHHhCCHHHHHHHHHHHHHHHHHHH
Confidence 3477777765554332222222 3589999995
No 57
>PF14521 Aspzincin_M35: Lysine-specific metallo-endopeptidase ; PDB: 2X3C_A 2X3A_A 2X3B_A 1GE7_B 1GE6_A 1GE5_A 1G12_A.
Probab=42.65 E-value=15 Score=25.87 Aligned_cols=17 Identities=6% Similarity=-0.070 Sum_probs=11.2
Q ss_pred hhhhHHHHhhhh-hhcCC
Q psy2264 124 LQHTSMIRMTNI-PWFPA 140 (148)
Q Consensus 124 ~~~~~iaHElaH-qWfGn 140 (148)
.+..+|+||++| ..+|.
T Consensus 95 Sk~~TLiHE~SHf~~~~~ 112 (148)
T PF14521_consen 95 SKEGTLIHEWSHFTAVGG 112 (148)
T ss_dssp -HHHHHHHHHHHSCCCT-
T ss_pred chHHHHHHhhhhhhhhcC
Confidence 355689999999 24544
No 58
>PRK02391 heat shock protein HtpX; Provisional
Probab=41.67 E-value=14 Score=29.18 Aligned_cols=15 Identities=0% Similarity=-0.254 Sum_probs=11.3
Q ss_pred hhHHHHhhhhhhcCC
Q psy2264 126 HTSMIRMTNIPWFPA 140 (148)
Q Consensus 126 ~~~iaHElaHqWfGn 140 (148)
+.++|||++|--=|+
T Consensus 134 ~aVlaHElgHi~~~d 148 (296)
T PRK02391 134 EAVLAHELSHVKNRD 148 (296)
T ss_pred HHHHHHHHHHHHcCC
Confidence 457999999965554
No 59
>PRK04897 heat shock protein HtpX; Provisional
Probab=41.30 E-value=14 Score=29.08 Aligned_cols=15 Identities=0% Similarity=-0.389 Sum_probs=10.9
Q ss_pred hhHHHHhhhhhhcCC
Q psy2264 126 HTSMIRMTNIPWFPA 140 (148)
Q Consensus 126 ~~~iaHElaHqWfGn 140 (148)
+.++|||++|-=-|+
T Consensus 138 ~aVlAHElgHi~~~d 152 (298)
T PRK04897 138 EGVIGHEISHIRNYD 152 (298)
T ss_pred HHHHHHHHHHHhcCC
Confidence 347999999954444
No 60
>PRK05457 heat shock protein HtpX; Provisional
Probab=40.25 E-value=15 Score=28.78 Aligned_cols=16 Identities=0% Similarity=-0.278 Sum_probs=12.3
Q ss_pred hhHHHHhhhhhhcCCe
Q psy2264 126 HTSMIRMTNIPWFPAW 141 (148)
Q Consensus 126 ~~~iaHElaHqWfGn~ 141 (148)
+.++|||++|.=-||.
T Consensus 135 ~aVlAHElgHi~~~d~ 150 (284)
T PRK05457 135 EAVLAHEISHIANGDM 150 (284)
T ss_pred HHHHHHHHHHHHcCCH
Confidence 3469999999866663
No 61
>PF06167 Peptidase_M90: Glucose-regulated metallo-peptidase M90; InterPro: IPR010384 MtfA (earlier known as YeeI) is a transcription factor that binds Mlc (make large colonies), itself a repressor of glucose and hence a protein important in regulation of the phosphoenolpyruvate:glucose-phosphotransferase (PtsG) system, the major glucose transporter in Escherichia coli. Mlc is a repressor of ptsG, and MtfA is found to bind and inactivate Mlc with high affinity []. The membrane-bound protein EIICBGlc encoded by the ptsG gene is the major glucose transporter in E. coli. ; PDB: 3DL1_A 3KHI_A.
Probab=39.49 E-value=7.7 Score=30.01 Aligned_cols=10 Identities=10% Similarity=-0.090 Sum_probs=8.5
Q ss_pred HHHHhhhhhh
Q psy2264 128 SMIRMTNIPW 137 (148)
Q Consensus 128 ~iaHElaHqW 137 (148)
++.||.||+=
T Consensus 157 VviHEfAH~L 166 (253)
T PF06167_consen 157 VVIHEFAHKL 166 (253)
T ss_dssp HHHHHHHHHH
T ss_pred hHHHHHHHHH
Confidence 6899999973
No 62
>cd04271 ZnMc_ADAM_fungal Zinc-dependent metalloprotease, ADAM_fungal subgroup. The adamalysin_like or ADAM (A Disintegrin And Metalloprotease) family of metalloproteases are integral membrane proteases acting on a variety of extracellular targets. They are involved in shedding soluble peptides or proteins from the cell surface. This subfamily contains fungal ADAMs, whose precise function has yet to be determined.
Probab=38.22 E-value=12 Score=28.40 Aligned_cols=9 Identities=0% Similarity=-0.141 Sum_probs=8.0
Q ss_pred HHHHhhhhh
Q psy2264 128 SMIRMTNIP 136 (148)
Q Consensus 128 ~iaHElaHq 136 (148)
++||||+|-
T Consensus 148 t~AHElGHn 156 (228)
T cd04271 148 VFAHEIGHT 156 (228)
T ss_pred ehhhhhhhh
Confidence 699999995
No 63
>cd04277 ZnMc_serralysin_like Zinc-dependent metalloprotease, serralysin_like subfamily. Serralysins and related proteases are important virulence factors in pathogenic bacteria. They may be secreted into the medium via a mechanism found in gram-negative bacteria, that does not require n-terminal signal sequences which are cleaved after the transmembrane translocation. A calcium-binding domain c-terminal to the metalloprotease domain, which contains multiple tandem repeats of a nine-residue motif including the pattern GGxGxD, and which forms a parallel beta roll may be involved in the translocation mechanism and/or substrate binding. Serralysin family members may have a broad spectrum of substrates each, including host immunoglobulins, complement proteins, cell matrix and cytoskeletal proteins, as well as antimicrobial peptides.
Probab=35.98 E-value=20 Score=25.88 Aligned_cols=20 Identities=20% Similarity=0.232 Sum_probs=14.6
Q ss_pred HHHHHHHHHHHHHHHhCCcC
Q psy2264 63 IFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 63 ~l~~~~~~l~~~e~~~g~~y 82 (148)
..+.++++++..++..++.+
T Consensus 35 ~~~~i~~A~~~w~~~~~l~F 54 (186)
T cd04277 35 QQAAARDALEAWEDVADIDF 54 (186)
T ss_pred HHHHHHHHHHHHHhhcCcee
Confidence 34567778888888888666
No 64
>PRK01265 heat shock protein HtpX; Provisional
Probab=35.97 E-value=19 Score=28.88 Aligned_cols=11 Identities=0% Similarity=-0.354 Sum_probs=8.8
Q ss_pred hhHHHHhhhhh
Q psy2264 126 HTSMIRMTNIP 136 (148)
Q Consensus 126 ~~~iaHElaHq 136 (148)
+.++|||++|-
T Consensus 141 ~aVlAHElgHi 151 (324)
T PRK01265 141 KAVAGHELGHL 151 (324)
T ss_pred HHHHHHHHHHH
Confidence 34699999994
No 65
>PF13583 Reprolysin_4: Metallo-peptidase family M12B Reprolysin-like
Probab=35.42 E-value=18 Score=26.89 Aligned_cols=11 Identities=0% Similarity=-0.091 Sum_probs=8.9
Q ss_pred hHHHHhhhhhh
Q psy2264 127 TSMIRMTNIPW 137 (148)
Q Consensus 127 ~~iaHElaHqW 137 (148)
.+++|||+|..
T Consensus 139 ~~~aHEiGH~l 149 (206)
T PF13583_consen 139 QTFAHEIGHNL 149 (206)
T ss_pred hHHHHHHHHHh
Confidence 46999999964
No 66
>cd04268 ZnMc_MMP_like Zinc-dependent metalloprotease, MMP_like subfamily. This group contains matrix metalloproteinases (MMPs), serralysins, and the astacin_like family of proteases.
Probab=35.03 E-value=21 Score=24.86 Aligned_cols=21 Identities=5% Similarity=0.029 Sum_probs=15.9
Q ss_pred HHHHHHHHHHHHHHHHhCCcC
Q psy2264 62 YIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 62 ~~l~~~~~~l~~~e~~~g~~y 82 (148)
...+.++++++..++.+.+.+
T Consensus 15 ~~r~~i~~A~~~W~~~~~i~F 35 (165)
T cd04268 15 KLRAAILDAIEAWNKAFAIGF 35 (165)
T ss_pred HHHHHHHHHHHHHHHHhCcCc
Confidence 345677888899999887665
No 67
>PF00413 Peptidase_M10: Matrixin This Prosite motif covers only the active site.; InterPro: IPR001818 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M10 (clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. Sequences having this domain are extracellular metalloproteases, such as collagenase and stromelysin, which degrade the extracellular matrix, are known as matrixins. They are zinc-dependent, calcium-activated proteases synthesised as inactive precursors (zymogens), which are proteolytically cleaved to yield the active enzyme [, ]. All matrixins and related proteins possess 2 domains: an N-terminal domain, and a zinc-binding active site domain. The N-terminal domain peptide, cleaved during the activation step, includes a conserved PRCGVPDV octapeptide, known as the cysteine switch, whose Cys residue chelates the active site zinc atom, rendering the enzyme inactive [, ]. The active enzyme degrades components of the extracellular matrix, playing a role in the initial steps of tissue remodelling during morphogenesis, wound healing, angiogenesis and tumour invasion [, ].; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0031012 extracellular matrix; PDB: 1Q3A_C 3V96_B 1HV5_D 1CXV_A 1SRP_A 1FBL_A 1ZVX_A 1JH1_A 1I76_A 2OY4_A ....
Probab=34.01 E-value=21 Score=24.56 Aligned_cols=22 Identities=14% Similarity=0.108 Sum_probs=15.2
Q ss_pred HHHHHHHHHHHHHHHHHhCCcC
Q psy2264 61 QYIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 61 ~~~l~~~~~~l~~~e~~~g~~y 82 (148)
....+.+.++++.-++..++.|
T Consensus 21 ~~~~~~i~~A~~~W~~~~~~~F 42 (154)
T PF00413_consen 21 SEQRDAIRQAFQAWNDVAPLNF 42 (154)
T ss_dssp HHHHHHHHHHHHHHHTTSSEEE
T ss_pred HHHHHHHHHHHHHHHhcCCceE
Confidence 4456678888888888765443
No 68
>PF05569 Peptidase_M56: BlaR1 peptidase M56; InterPro: IPR008756 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to MEROPS peptidase family M56 (clan M-). The predicted active site residues for members of this family occur in the motif HEXXH. The type example is BlaR1 peptidase from Bacillus licheniformis. Production of beta-Lactamase and penicillin-binding protein 2a (which mediate staphylococcal resistance to beta-lactam antibiotics) is regulated by a signal-transducing integral membrane protein and a transcriptional repressor. The signal transducer is a fusion protein with penicillin-binding and zinc metalloprotease domains. The signal for protein expression is transmitted by site-specific proteolytic cleavage of both the transducer, which auto-activates, and the repressor, which is inactivated, unblocking gene transcription.
Probab=34.00 E-value=25 Score=27.41 Aligned_cols=11 Identities=0% Similarity=-0.082 Sum_probs=8.9
Q ss_pred hhHHHHhhhhh
Q psy2264 126 HTSMIRMTNIP 136 (148)
Q Consensus 126 ~~~iaHElaHq 136 (148)
+.+++||++|=
T Consensus 197 ~~il~HEl~Hi 207 (299)
T PF05569_consen 197 RAILLHELAHI 207 (299)
T ss_pred HHHHHHHHHHH
Confidence 45799999994
No 69
>cd00203 ZnMc Zinc-dependent metalloprotease. This super-family of metalloproteases contains two major branches, the astacin-like proteases and the adamalysin/reprolysin-like proteases. Both branches have wide phylogenetic distribution, and contain sub-families, which are involved in vertebrate development and disease.
Probab=32.99 E-value=20 Score=24.92 Aligned_cols=23 Identities=13% Similarity=0.161 Sum_probs=17.6
Q ss_pred HHHHHHHHHHHHHHHHHHhCCcC
Q psy2264 60 GQYIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 60 ~~~~l~~~~~~l~~~e~~~g~~y 82 (148)
.....+.+..+++.+++..++.+
T Consensus 20 ~~~~~~~v~~a~~~w~~~~~i~f 42 (167)
T cd00203 20 SAQIQSLILIAMQIWRDYLNIRF 42 (167)
T ss_pred HHHHHHHHHHHHHHHHhhhCceE
Confidence 34566778888999999887766
No 70
>PF02031 Peptidase_M7: Streptomyces extracellular neutral proteinase (M7) family; InterPro: IPR000013 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M7 (snapalysin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA. With a molecular weight of around 16kDa, Streptomyces extracellular neutral protease is one of the smallest known proteases []; it is capable of hydrolysing milk proteins []. The enzyme is synthesised as a proenzyme with a signal peptide, a propeptide and an active domain that contains the conserved HEXXH motif characteristic of metalloproteases. Although family M7 shows active site sequence similarity to other members, it differs in one major respect: the third zinc ligand appears to be an aspartate residue rather than the usual histidine.; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding, 0006508 proteolysis, 0005576 extracellular region; PDB: 1C7K_A 1KUH_A.
Probab=32.26 E-value=25 Score=24.48 Aligned_cols=10 Identities=0% Similarity=-0.349 Sum_probs=8.2
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.+.+||+.|-
T Consensus 79 RIaaHE~GHi 88 (132)
T PF02031_consen 79 RIAAHELGHI 88 (132)
T ss_dssp HHHHHHHHHH
T ss_pred eeeeehhccc
Confidence 4789999993
No 71
>PF12315 DUF3633: Protein of unknown function (DUF3633); InterPro: IPR022087 This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length. The family is found in association with PF00412 from PFAM.
Probab=32.07 E-value=23 Score=26.66 Aligned_cols=12 Identities=8% Similarity=0.310 Sum_probs=10.4
Q ss_pred hHHHHhhhhhhc
Q psy2264 127 TSMIRMTNIPWF 138 (148)
Q Consensus 127 ~~iaHElaHqWf 138 (148)
.++|||+.|-|.
T Consensus 95 siLAHE~mHa~L 106 (212)
T PF12315_consen 95 SILAHELMHAWL 106 (212)
T ss_pred hHHHHHHHHHHh
Confidence 479999999995
No 72
>KOG3607|consensus
Probab=31.25 E-value=1.3e+02 Score=27.02 Aligned_cols=32 Identities=9% Similarity=0.213 Sum_probs=16.5
Q ss_pred eEEEecCccccccHHHHHHHHHHHHHHHHHHhC
Q psy2264 47 FRVWGREDVVKTQGQYIFDKGPKILAALSDYMG 79 (148)
Q Consensus 47 i~v~~~~~~~~~~~~~~l~~~~~~l~~~e~~~g 79 (148)
+.+|...+. ....+.+.+.....+.|=..++.
T Consensus 243 lE~Wt~~dk-i~~~~~~~~tL~~F~~wr~~~l~ 274 (716)
T KOG3607|consen 243 LEIWTDGNK-IDVSEDLRETLHNFLKWRKSYLT 274 (716)
T ss_pred EEecCCCCe-ecccccHHHHHHHHHHHHHhhcc
Confidence 557777766 44444444444444444444443
No 73
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family. This family consists of probable oligoendopeptidases in the M3 family, related to lactococcal PepF and group B streptococcal PepB (TIGR00181) but in a distinct clade with considerable sequence differences. The likely substrate is small peptides and not whole proteins, as with PepF, but members are not characterized and the activity profile may differ. Several bacteria have both a member of this family and a member of the PepF family.
Probab=30.67 E-value=28 Score=29.79 Aligned_cols=31 Identities=3% Similarity=-0.055 Sum_probs=17.9
Q ss_pred hhhhhhccccccccccchhhhhHHHHhhhhh
Q psy2264 106 GMNTYRLGLVVEATHLYLLQHTSMIRMTNIP 136 (148)
Q Consensus 106 Gli~~~e~~ll~~~~~~~~~~~~iaHElaHq 136 (148)
|+..+..+.++.+-.-+......++||++|-
T Consensus 318 ~~~~~~~P~I~~Nf~~t~~dv~TL~HElGHa 348 (549)
T TIGR02289 318 YLPKYKAPFIFSNFNGTSGDIDVLTHEAGHA 348 (549)
T ss_pred CCCCCCCcEEEEeCCCChhHHHHHHHHhhHH
Confidence 3444455666654333333445799999864
No 74
>PF12388 Peptidase_M57: Dual-action HEIGH metallo-peptidase; InterPro: IPR024653 This entry represents the metallopeptidases M10, M27 and M57. The catalytic triad for proteases in this entry is HE-H-H, which in many members is in the sequence motif HEIGH [].
Probab=28.52 E-value=28 Score=26.31 Aligned_cols=11 Identities=0% Similarity=-0.176 Sum_probs=8.8
Q ss_pred hhHHHHhhhhh
Q psy2264 126 HTSMIRMTNIP 136 (148)
Q Consensus 126 ~~~iaHElaHq 136 (148)
+-+|+|||.|-
T Consensus 134 ~hvi~HEiGH~ 144 (211)
T PF12388_consen 134 EHVITHEIGHC 144 (211)
T ss_pred HHHHHHHhhhh
Confidence 34799999994
No 75
>cd06007 R3H_DEXH_helicase R3H domain of a group of proteins which also contain a DEXH-box helicase domain, and may function as ATP-dependent DNA or RNA helicases. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=26.68 E-value=44 Score=19.78 Aligned_cols=12 Identities=8% Similarity=-0.025 Sum_probs=9.8
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
+..++|++|++|
T Consensus 29 eR~~vH~~a~~~ 40 (59)
T cd06007 29 ERAVIHRLCRKL 40 (59)
T ss_pred HHHHHHHHHHHc
Confidence 456999999994
No 76
>smart00235 ZnMc Zinc-dependent metalloprotease. Neutral zinc metallopeptidases. This alignment represents a subset of known subfamilies. Highest similarity occurs in the HExxH zinc-binding site/ active site.
Probab=26.59 E-value=30 Score=23.54 Aligned_cols=20 Identities=15% Similarity=0.228 Sum_probs=14.8
Q ss_pred HHHHHHHHHHHHHHHhCCcC
Q psy2264 63 IFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 63 ~l~~~~~~l~~~e~~~g~~y 82 (148)
..+.+.++++..++..++.+
T Consensus 24 ~~~~i~~A~~~w~~~t~i~F 43 (140)
T smart00235 24 VREAIARAFAEWSDVTCLRF 43 (140)
T ss_pred HHHHHHHHHHHHhcCCeeEE
Confidence 35677788888888877655
No 77
>COG4900 Predicted metallopeptidase [General function prediction only]
Probab=26.26 E-value=47 Score=22.62 Aligned_cols=10 Identities=10% Similarity=-0.160 Sum_probs=8.0
Q ss_pred hHHHHhhhhh
Q psy2264 127 TSMIRMTNIP 136 (148)
Q Consensus 127 ~~iaHElaHq 136 (148)
.+++||+.|-
T Consensus 82 KviiHEllHI 91 (133)
T COG4900 82 KVIIHELLHI 91 (133)
T ss_pred HHHHHHHhcC
Confidence 3699999983
No 78
>COG4101 Predicted mannose-6-phosphate isomerase [Carbohydrate transport and metabolism]
Probab=25.96 E-value=22 Score=24.57 Aligned_cols=10 Identities=10% Similarity=0.538 Sum_probs=8.5
Q ss_pred hhhhhcCCee
Q psy2264 133 TNIPWFPAWI 142 (148)
Q Consensus 133 laHqWfGn~V 142 (148)
-||.||||..
T Consensus 77 ~ah~w~G~rL 86 (142)
T COG4101 77 EAHTWYGNRL 86 (142)
T ss_pred eeeeeeccce
Confidence 5899999975
No 79
>PF04228 Zn_peptidase: Putative neutral zinc metallopeptidase; InterPro: IPR007343 Members of this family of bacterial proteins are described as hypothetical proteins or zinc metallopeptidases. The majority have a HExxH zinc-binding motif characteristic of neutral zinc metallopeptidases, however there is no evidence to support their function as metallopeptidases.
Probab=25.59 E-value=34 Score=27.09 Aligned_cols=9 Identities=0% Similarity=-0.189 Sum_probs=7.9
Q ss_pred HHHHhhhhh
Q psy2264 128 SMIRMTNIP 136 (148)
Q Consensus 128 ~iaHElaHq 136 (148)
+||||..|+
T Consensus 173 VlAHEyGHH 181 (292)
T PF04228_consen 173 VLAHEYGHH 181 (292)
T ss_pred HHHHHHHHH
Confidence 599999996
No 80
>PF10584 Proteasome_A_N: Proteasome subunit A N-terminal signature; InterPro: IPR000426 The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). This family contains the alpha subunit sequences which range from 210 to 290 amino acids. These sequences are classified as non-peptidase homologues in MEROPS peptidase family T1 (clan PB(T)). ; GO: 0004175 endopeptidase activity, 0006511 ubiquitin-dependent protein catabolic process, 0019773 proteasome core complex, alpha-subunit complex; PDB: 3H4P_M 1IRU_O 3UN4_U 1FNT_A 3OEV_G 3OEU_U 3SDK_U 3DY3_G 3MG7_G 3L5Q_C ....
Probab=24.62 E-value=24 Score=16.90 Aligned_cols=18 Identities=11% Similarity=0.198 Sum_probs=13.7
Q ss_pred eEEEecCccccccHHHHHH
Q psy2264 47 FRVWGREDVVKTQGQYIFD 65 (148)
Q Consensus 47 i~v~~~~~~~~~~~~~~l~ 65 (148)
+.+|+|.+. +-+.+++++
T Consensus 5 ~t~FSp~Gr-l~QVEYA~~ 22 (23)
T PF10584_consen 5 ITTFSPDGR-LFQVEYAMK 22 (23)
T ss_dssp TTSBBTTSS-BHHHHHHHH
T ss_pred ceeECCCCe-EEeeEeeec
Confidence 457888888 778888764
No 81
>PF01431 Peptidase_M13: Peptidase family M13 This is family M13 in the peptidase classification. ; InterPro: IPR018497 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M13 (neprilysin family, clan MA(E)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. M13 peptidases are well-studied proteases found in a wide range of organisms including mammals and bacteria. In mammals they participate in processes such as cardiovascular development, blood-pressure regulation, nervous control of respiration, and regulation of the function of neuropeptides in the central nervous system. In bacteria they may be used for digestion of milk [, ]. The family includes eukaryotic and prokaryotic oligopeptidases, as well as some of the proteins responsible for the molecular basis of the blood group antigens e.g. Kell []. Neprilysin (3.4.24.11 from EC), is another member of this group, it is variously known as common acute lymphoblastic leukemia antigen (CALLA), enkephalinase (gp100) and neutral endopeptidase metalloendopeptidase (NEP). It is a plasma membrane-bound mammalian enzyme that is able to digest biologically-active peptides, including enkephalins []. The zinc ligands of neprilysin are known and are analogous to those in thermolysin, a related peptidase [, ]. Neprilysins, like thermolysin, are inhibited by phosphoramidon, which appears to selectively inhibit this family in mammals. The enzymes are all oligopeptidases, digesting oligo- and polypeptides, but not proteins []. Neprilysin consists of a short cytoplasmic domain, a membrane-spanning region and a large extracellular domain. The cytoplasmic domain contains a conformationally-restrained octapeptide, which is thought to act as a stop transfer sequence that prevents proteolysis and secretion [, ].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 2QPJ_A 1R1I_A 1R1J_A 1Y8J_A 1R1H_A 1DMT_A 2YB9_A 3DWB_A 3ZUK_A.
Probab=24.34 E-value=38 Score=24.70 Aligned_cols=12 Identities=0% Similarity=-0.266 Sum_probs=9.4
Q ss_pred hHHHHhhhhhhc
Q psy2264 127 TSMIRMTNIPWF 138 (148)
Q Consensus 127 ~~iaHElaHqWf 138 (148)
.+|||||+|---
T Consensus 38 ~ilahel~hafd 49 (206)
T PF01431_consen 38 FILAHELMHAFD 49 (206)
T ss_dssp HHHHHHHHHCTS
T ss_pred HHHHHHHHHHHH
Confidence 479999999653
No 82
>cd04278 ZnMc_MMP Zinc-dependent metalloprotease, matrix metalloproteinase (MMP) sub-family. MMPs are responsible for a great deal of pericellular proteolysis of extracellular matrix and cell surface molecules, playing crucial roles in morphogenesis, cell fate specification, cell migration, tissue repair, tumorigenesis, gain or loss of tissue-specific functions, and apoptosis. In many instances, they are anchored to cell membranes via trans-membrane domains, and their activity is controlled via TIMPs (tissue inhibitors of metalloproteinases).
Probab=23.88 E-value=35 Score=23.81 Aligned_cols=22 Identities=9% Similarity=0.101 Sum_probs=15.7
Q ss_pred HHHHHHHHHHHHHHHHHhCCcC
Q psy2264 61 QYIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 61 ~~~l~~~~~~l~~~e~~~g~~y 82 (148)
....+.+.++++..++..++.+
T Consensus 21 ~~~~~~i~~A~~~W~~~~~l~F 42 (157)
T cd04278 21 DDVRRAIARAFRVWSDVTPLTF 42 (157)
T ss_pred HHHHHHHHHHHHHHHhhcCcee
Confidence 4445677888888888877554
No 83
>PF09471 Peptidase_M64: IgA Peptidase M64; InterPro: IPR019026 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This is a family of highly selective metallo-endopeptidases belonging to the MEROPS peptidase family M64 (IgA peptidase, clan MA). The primary structure of the Clostridium ramosum IgA peptidase shows no significant overall similarity to any other known metallo-endopeptidase []. ; PDB: 3P1V_A 4DF9_D.
Probab=23.73 E-value=47 Score=25.88 Aligned_cols=13 Identities=0% Similarity=-0.112 Sum_probs=9.8
Q ss_pred hHHHHhhhhhhcC
Q psy2264 127 TSMIRMTNIPWFP 139 (148)
Q Consensus 127 ~~iaHElaHqWfG 139 (148)
.+++||+.|...|
T Consensus 218 ~v~vHE~GHsf~~ 230 (264)
T PF09471_consen 218 QVVVHEFGHSFGG 230 (264)
T ss_dssp HHHHHHHHHHTT-
T ss_pred ceeeeeccccccc
Confidence 4699999997554
No 84
>cd02640 R3H_NRF R3H domain of the NF-kappaB-repression factor (NRF). NRF is a nuclear inhibitor of NF-kappaB proteins that can silence the IFNbeta promoter via binding to a negative regulatory element (NRE). Beside R3H NRF also contains a G-patch domain. The name of the R3H domain comes from the characteristic spacing of the most conserved arginine and histidine residues. The function of the domain is predicted to bind ssDNA or ssRNA in a sequence-specific manner.
Probab=23.64 E-value=55 Score=19.44 Aligned_cols=13 Identities=8% Similarity=0.261 Sum_probs=10.1
Q ss_pred hhhHHHHhhhhhh
Q psy2264 125 QHTSMIRMTNIPW 137 (148)
Q Consensus 125 ~~~~iaHElaHqW 137 (148)
.+..++|++|+++
T Consensus 29 ~eR~~vH~~a~~~ 41 (60)
T cd02640 29 EERALIHQIAQKY 41 (60)
T ss_pred HHHHHHHHHHHHc
Confidence 3456999999994
No 85
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site. Members of this family may have an amino terminal propeptide, which is cleaved to yield the active protease domain, which is consequently always found at the N-terminus in multi-domain architectures. This family includes: astacin, a digestive enzyme from Crayfish; meprin, a multiple domain membrane component that is constructed from a homologous alpha and beta chain, proteins involved in (bone) morphogenesis, tolloid from drosophila, and the sea urchin SPAN protein, which may also play a role in development.
Probab=22.89 E-value=1.8e+02 Score=20.90 Aligned_cols=21 Identities=0% Similarity=-0.122 Sum_probs=16.4
Q ss_pred HHHHHHHHHHHHHHHHhCCcC
Q psy2264 62 YIFDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 62 ~~l~~~~~~l~~~e~~~g~~y 82 (148)
...+.++++++.+++.+.+.+
T Consensus 15 ~~~~~I~~A~~~w~~~TcIrF 35 (180)
T cd04280 15 SDRSLILRAMREIESNTCIRF 35 (180)
T ss_pred HHHHHHHHHHHHHHhCCcceE
Confidence 445778889999999887665
No 86
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3.4.24.-) is mostly bacterial and includes oligoendopeptidase F from Lactococcus lactis. This enzyme hydrolyzes peptides containing between 7 and 17 amino acids with fairly broad specificity. The PepF gene is duplicated in L. lactis on the plasmid that bears it, while a shortened second copy is found in Bacillus subtilis. Most bacterial PepFs are cytoplasmic endopeptidases; however, the PepF Bacillus amyloliquefaciens oligopeptidase is a secreted protein and may facilitate the process of sporulation. Specifically, the yjbG gene encoding the homolog of the PepF1 and PepF2 oligoendopeptidases of Lactococcus lactis has been identified in Bacillus subtilis as an inhibitor of sporulation initiation when over expressed from a multicopy plasmid.
Probab=22.61 E-value=48 Score=26.92 Aligned_cols=25 Identities=4% Similarity=-0.133 Sum_probs=14.4
Q ss_pred ccccccccccchhhhhHHHHhhhhh
Q psy2264 112 LGLVVEATHLYLLQHTSMIRMTNIP 136 (148)
Q Consensus 112 e~~ll~~~~~~~~~~~~iaHElaHq 136 (148)
...++.+-..+...-..++||++|-
T Consensus 209 ~p~i~~n~~~~~~~v~tl~HE~GHa 233 (427)
T cd06459 209 HPFILMNFNGTLDDVFTLAHELGHA 233 (427)
T ss_pred CCeEEecCCCChhhHHHHHHHhhHH
Confidence 4445544332333345699999884
No 87
>PF14831 DUF4484: Domain of unknown function (DUF4484)
Probab=21.13 E-value=67 Score=23.54 Aligned_cols=14 Identities=7% Similarity=0.290 Sum_probs=12.0
Q ss_pred hhHHHHhhhhhhcC
Q psy2264 126 HTSMIRMTNIPWFP 139 (148)
Q Consensus 126 ~~~iaHElaHqWfG 139 (148)
....++||++.|||
T Consensus 145 D~~FV~el~~~yf~ 158 (176)
T PF14831_consen 145 DAAFVKELVAKYFG 158 (176)
T ss_pred HHHHHHHHHHHHcC
Confidence 34589999999999
No 88
>PF01400 Astacin: Astacin (Peptidase family M12A) This Prosite motif covers only the active site.; InterPro: IPR001506 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of metallopeptidases belong to the MEROPS peptidase family M12, subfamily M12A (astacin family, clan MA(M)). The protein fold of the peptidase domain for members of this family resembles that of thermolysin, the type example for clan MA and the predicted active site residues for members of this family and thermolysin occur in the motif HEXXH []. The astacin () family of metalloendopeptidases encompasses a range of proteins found in hydra to humans, in mature and developmental systems []. Their functions include activation of growth factors, degradation of polypeptides, and processing of extracellular proteins []. The proteins are synthesised with N-terminal signal and pro-enzyme sequences, and many contain multiple domains C-terminal to the protease domain. They are either secreted from cells, or are associated with the plasma membrane. The astacin molecule adopts a kidney shape, with a deep active-site cleft between its N- and C-terminal domains []. The zinc ion, which lies at the bottom of the cleft, exhibits a unique penta-coordinated mode of binding, involving 3 histidine residues, a tyrosine and a water molecule (which is also bound to the carboxylate side chain of Glu93) []. The N-terminal domain comprises 2 alpha-helices and a 5-stranded beta-sheet. The overall topology of this domain is shared by the archetypal zinc-endopeptidase thermolysin. Astacin protease domains also share common features with serralysins, matrix metalloendopeptidases, and snake venom proteases; they cleave peptide bonds in polypeptides such as insulin B chain and bradykinin, and in proteins such as casein and gelatin; and they have arylamidase activity [].; GO: 0004222 metalloendopeptidase activity, 0006508 proteolysis; PDB: 3LQB_A 3EDH_A 3EDG_A 3EDI_A 1IAE_A 1IAB_A 1IAA_A 1AST_A 1IAC_A 1QJJ_A ....
Probab=20.89 E-value=1.3e+02 Score=21.95 Aligned_cols=19 Identities=5% Similarity=0.032 Sum_probs=16.0
Q ss_pred HHHHHHHHHHHHHHhCCcC
Q psy2264 64 FDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 64 l~~~~~~l~~~e~~~g~~y 82 (148)
.+.+.++++.+++.+.+.+
T Consensus 21 ~~~I~~Am~~~e~~TcI~F 39 (191)
T PF01400_consen 21 RQRIRKAMDEWEKNTCIRF 39 (191)
T ss_dssp HHHHHHHHHHHHHHSSEEE
T ss_pred HHHHHHHHHHHHhCCCEEE
Confidence 3678899999999998766
No 89
>PF09768 Peptidase_M76: Peptidase M76 family; InterPro: IPR019165 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. Mitochondrial inner membrane protease ATP23 has two roles in the assembly of mitochondrial ATPase. Firstly, it acts as a protease that removes the N-terminal 10 residues of mitochondrial ATPase CF(0) subunit 6 (ATP6) at the intermembrane space side. Secondly, it is involved in the correct assembly of the membrane-embedded ATPase CF(0) particle, probably mediating association of ATP6 with the subunit 9 ring [, ].; GO: 0004222 metalloendopeptidase activity
Probab=20.78 E-value=1.8e+02 Score=21.13 Aligned_cols=12 Identities=0% Similarity=0.025 Sum_probs=9.8
Q ss_pred hhHHHHhhhhhh
Q psy2264 126 HTSMIRMTNIPW 137 (148)
Q Consensus 126 ~~~iaHElaHqW 137 (148)
+.+|+|||.|-|
T Consensus 72 ~~~l~HELIHay 83 (173)
T PF09768_consen 72 EDTLTHELIHAY 83 (173)
T ss_pred HHHHHHHHHHHH
Confidence 457999999975
No 90
>PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking. In yeast, two distinct PI3-kinase complexes are known: complex I (Vps34, Vps15, Vps30/Atg6, and Atg14) is involved in autophagy, and complex II (Vps34, Vps15, Vps30/Atg6, and Vps38) functions in the vacuolar protein sorting pathway. In mammals, the counterparts of Vps34, Vps15, and Vps30/Atg6 are Vps34, p150, and Beclin 1, respectively. Mammalian UV irradiation resistance-associated gene (UVRAG) has been identified as identical to yeast Vps38 []. The Atg14 (autophagy-related protein 14) proteins are hydrophilic proteins and have a coiled-coil motif at the N terminus region. Yeast cells with mutant Atg14 are defective not only in autophagy but also in sorting of carboxypeptidase Y (CPY), a vacuolar-soluble hydrolase, to the vacuole []. This entry represents Atg14 and UVRAG, which bind Beclin 1 to forms two distinct PI3-kinase complexes. This entry also includes Bakor (beclin-1-associated autophagy-related key regulator), also known as autophagy-related protein 14-like protein, which share sequence similarity to the yeast Atg14 protein []. Barkor positively regulates autophagy through its interaction with Beclin-1, with decreased levels of autophagosome formation observed when Barkor expression is eliminated []. Autophagy mediates the cellular response to nutrient deprivation, protein aggregation, and pathogen invasion in humans, and malfunction of autophagy has been implicated in multiple human diseases including cancer. ; GO: 0010508 positive regulation of autophagy
Probab=20.75 E-value=1.5e+02 Score=22.67 Aligned_cols=29 Identities=17% Similarity=0.284 Sum_probs=24.8
Q ss_pred cccHHHHHHHHHHHHHHHHHHhCCcCCCCCC
Q psy2264 57 KTQGQYIFDKGPKILAALSDYMGFDYYKMLP 87 (148)
Q Consensus 57 ~~~~~~~l~~~~~~l~~~e~~~g~~y~~p~~ 87 (148)
.+...-++..+.+++..+..|+|+|+ |++
T Consensus 194 ~~~isaALgyvahlv~lls~yL~v~L--py~ 222 (302)
T PF10186_consen 194 DEEISAALGYVAHLVSLLSRYLGVPL--PYP 222 (302)
T ss_pred HHHHHHHHHHHHHHHHHHHHHhCCCC--CCC
Confidence 34677899999999999999999988 665
No 91
>cd04281 ZnMc_BMP1_TLD Zinc-dependent metalloprotease; BMP1/TLD-like subfamily. BMP1 (Bone morphogenetic protein 1) and TLD (tolloid)-like metalloproteases play vital roles in extracellular matrix formation, by cleaving precursor proteins such as enzymes, structural proteins, and proteins involved in the mineralization of the extracellular matrix. The drosophila protein tolloid and its Xenopus homologue xolloid cleave and inactivate Sog and chordin, respectively, which are inhibitors of Dpp (the Drosophila decapentaplegic gene product) and its homologue BMP4, involved in dorso-ventral patterning.
Probab=20.66 E-value=1.8e+02 Score=21.59 Aligned_cols=19 Identities=0% Similarity=0.016 Sum_probs=14.5
Q ss_pred HHHHHHHHHHHHHHhCCcC
Q psy2264 64 FDKGPKILAALSDYMGFDY 82 (148)
Q Consensus 64 l~~~~~~l~~~e~~~g~~y 82 (148)
...+.++++.+++.+-+.+
T Consensus 28 ~~~I~~Am~~~~~~TCirF 46 (200)
T cd04281 28 RAMFKQAMRHWENFTCVTF 46 (200)
T ss_pred HHHHHHHHHHHHhCCceEE
Confidence 4577889999999876555
No 92
>PF04036 DUF372: Domain of unknown function (DUF372); InterPro: IPR007179 This is a group of proteins of unknown function. It is found N-terminal to another domain of unknown function (IPR007181 from INTERPRO).; PDB: 2I52_B 2IEC_D 2OGF_C.
Probab=20.59 E-value=49 Score=17.87 Aligned_cols=13 Identities=8% Similarity=-0.197 Sum_probs=9.6
Q ss_pred hhhhhhcCCeeee
Q psy2264 132 MTNIPWFPAWISW 144 (148)
Q Consensus 132 ElaHqWfGn~Vt~ 144 (148)
.|-|||.|-=|+-
T Consensus 13 aLyHQF~GtPvs~ 25 (38)
T PF04036_consen 13 ALYHQFVGTPVSP 25 (38)
T ss_dssp HHHHHHTT-EEST
T ss_pred HHHHHhcCCcCCc
Confidence 4789999988764
No 93
>PRK15410 DgsA anti-repressor MtfA; Provisional
Probab=20.09 E-value=45 Score=25.97 Aligned_cols=9 Identities=11% Similarity=-0.001 Sum_probs=8.1
Q ss_pred HHHHhhhhh
Q psy2264 128 SMIRMTNIP 136 (148)
Q Consensus 128 ~iaHElaHq 136 (148)
++.||+|||
T Consensus 145 VvIHEFAH~ 153 (260)
T PRK15410 145 LIIHEVAHK 153 (260)
T ss_pred hhHhHHHhH
Confidence 689999997
No 94
>cd06160 S2P-M50_like_2 Uncharacterized homologs of Site-2 protease (S2P), zinc metalloproteases (MEROPS family M50) which cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of the S2P/M50 family of RIP proteases use proteolytic activity within the membrane to transfer information across membranes to integrate gene expression with physiologic stresses occurring in another cellular compartment. In eukaryotic cells they regulate such processes as sterol and lipid metabolism, and endoplasmic reticulum stress responses. In prokaryotes they regulate such processes as sporulation, cell division, stress response, and cell differentiation. This group includes bacterial, eukaryotic, and Archaeal S2P/M50s homologs with additional putative N- and C-terminal transmembrane spanning regions, relative to the core protein, and no PDZ domains.
Probab=20.01 E-value=53 Score=24.01 Aligned_cols=11 Identities=9% Similarity=-0.345 Sum_probs=8.3
Q ss_pred HHHHhhhhhhc
Q psy2264 128 SMIRMTNIPWF 138 (148)
Q Consensus 128 ~iaHElaHqWf 138 (148)
++.||++|-|.
T Consensus 44 l~iHElgH~~~ 54 (183)
T cd06160 44 LGIHEMGHYLA 54 (183)
T ss_pred HHHHHHHHHHH
Confidence 46899999763
Done!