RPS-BLAST 2.2.26 [Sep-21-2011]

Database: CDD.v3.10 
           44,354 sequences; 10,937,602 total letters

Searching..................................................done

Query= psy2265
         (196 letters)



>gnl|CDD|189008 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N family incudes
           tricorn interacting factor F3, Endoplasmic reticulum
           aminopeptidase 1 (ERAP1), Aminopeptidase Q (APQ).  This
           M1 peptidase family includes eukaryotic and bacterial
           members: aminopeptidase N (APN), aminopeptidase Q (APQ,
           laeverin), endoplasmic reticulum aminopeptidase 1
           (ERAP1) as well as tricorn interacting factor F3.
           Aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC
           3.4.11.2), a Type II integral membrane protease,
           consists of a small N-terminal cytoplasmic domain, a
           single transmembrane domain and a large extracellular
           ectodomain that contains the active site. It
           preferentially cleaves neutral amino acids from the
           N-terminus of oligopeptides and is present in a variety
           of human tissues and cell types (leukocyte, fibroblast,
           endothelial and epithelial cells). APN expression is
           dysregulated in inflammatory diseases such as chronic
           pain, rheumatoid arthritis, multiple sclerosis, systemic
           sclerosis, systemic lupus erythematosus,
           polymyositis/dermatomyosytis and pulmonary sarcoidosis,
           and is enhanced in tumor cells such as melanoma, renal,
           prostate, pancreas, colon, gastric and thyroid cancers.
           It is considered a marker of differentiation since it is
           predominantly expressed on stem cells and on cells of
           the granulocytic and monocytic lineages at distinct
           stages of differentiation. Thus, APN inhibition may lead
           to the development of anti-cancer and anti-inflammatory
           drugs. ERAP1 also known as endoplasmic reticulum
           aminopeptidase associated with antigen processing
           (ERAAP), adipocyte derived leucine aminopeptidase
           (A-LAP) or aminopeptidase regulating tumor necrosis
           factor receptor I (THFRI) shedding (ARTS-1), associates
           with the closely related ER aminopeptidase ERAP2, for
           the final trimming of peptides within the ER for
           presentation by MHC class I molecules. ERAP1 is
           associated with ankylosing spondylitis (AS), an
           inflammatory arthritis that predominantly affects the
           spine. ERAP1 also aids in the shedding of membrane-bound
           cytokine receptors. The tricorn interacting factor F3,
           together with factors F1 and F2, degrades the tricorn
           protease products, producing free amino acids, thus
           completing the proteasomal degradation pathway. F3 is
           homologous to F2, but not F1, and shows a strong
           preference for glutamate in the P1' position. APQ, also
           known as laeverin, is specifically expressed in human
           embryo-derived extravillous trophoblasts (EVTs) that
           invade the uterus during early placentation. It cleaves
           the N-terminal amino acid of various peptides such as
           angiotensin III, endokinin C, and kisspeptin-10, all
           expressed in the placenta in large quantities. APN is a
           receptor for coronaviruses, although the virus receptor
           interaction site seems to be distinct from the enzymatic
           site and aminopeptidase activity is not necessary for
           viral infection. APNs are also putative Cry toxin
           receptors. Cry1 proteins are pore-forming toxins that
           bind to the midgut epithelial cell membrane of
           susceptible insect larvae, causing extensive damage.
           Several different toxins, including Cry1Aa, Cry1Ab,
           Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to
           bind to APNs; however, a direct role of APN in
           cytotoxicity has been yet to be firmly established.
          Length = 446

 Score = 88.4 bits (220), Expect = 8e-21
 Identities = 31/53 (58%), Positives = 36/53 (67%), Gaps = 2/53 (3%)

Query: 73  MGQYIFDKGPKILAALSDYMGLDYYTMLPKMDLVAVPDFDAGAMENWGMNTYR 125
            G Y  +  PKIL    DY G+ Y   LPK+DLVA+PDF AGAMENWG+ TYR
Sbjct: 217 QGDYALEVAPKILEFFEDYFGIPYP--LPKLDLVAIPDFAAGAMENWGLITYR 267


>gnl|CDD|216501 pfam01433, Peptidase_M1, Peptidase family M1.  Members of this
           family are aminopeptidases. The members differ widely in
           specificity, hydrolysing acidic, basic or neutral
           N-terminal residues. This family includes leukotriene-A4
           hydrolase, this enzyme also has an aminopeptidase
           activity.
          Length = 390

 Score = 85.8 bits (213), Expect = 5e-20
 Identities = 31/62 (50%), Positives = 37/62 (59%), Gaps = 4/62 (6%)

Query: 74  GQYIFDKGPKILAALSDYMGLDYYTMLPKMDLVAVPDFDAGAMENWGMNTYRLLASTQLV 133
           GQY  +   K+L    DY G  Y   LPK+D VA+PDF AGAMENWG+ TYR      L 
Sbjct: 227 GQYALEVTQKLLEFFEDYFGFPY--PLPKLDQVALPDFSAGAMENWGLITYR--EPALLY 282

Query: 134 EP 135
           +P
Sbjct: 283 DP 284


>gnl|CDD|223385 COG0308, PepN, Aminopeptidase N [Amino acid transport and
           metabolism].
          Length = 859

 Score = 57.5 bits (139), Expect = 5e-10
 Identities = 24/52 (46%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 74  GQYIFDKGPKILAALSDYMGLDYYTMLPKMDLVAVPDFDAGAMENWGMNTYR 125
            +Y  D+  + +    +Y GL Y   LP   +VAVPDF AGAMENWG+ T+R
Sbjct: 240 AKYALDETKRSIEFYEEYFGLPYA--LPID-IVAVPDFSAGAMENWGLVTFR 288


>gnl|CDD|189002 cd09595, M1, Peptidase M1 family contains aminopeptidase N and
           leukotriene A4 hydrolase.  M1 Peptidase family includes
           aminopeptidase N (APN) and leukotriene A4 hydrolase
           (LTA4H).  All peptidases in this family bind a single
           catalytic zinc ion which is tetrahedrally co-ordinated
           by three amino acid ligands and a water molecule that
           forms the nucleophile on activation during catalysis.
           APN consists of a small N-terminal cytoplasmic domain, a
           single transmembrane domain and a large extracellular
           ectodomain that contains the active site. It
           preferentially cleaves neutral amino acids from the
           N-terminus of oligopeptides and is present in a variety
           of human tissues and cell types. APN expression is
           dysregulated in many inflammatory diseases and is
           enhanced in numerous tumor cells, making it a lead
           target in the development of anti-cancer and
           anti-inflammatory drugs. LTA4H is a bifunctional enzyme,
           possessing an aminopeptidase as well as an epoxide
           hydrolase activity. The two activities occupy different,
           but overlapping sites. The activity and physiological
           relevance of the aminopeptidase in LTA4H is as yet
           unknown while the epoxide hydrolase converts leukotriene
           A4 (LTA4) into leukotriene B4 (LTB4), a potent
           chemotaxin that is fundamental to the inflammatory
           response of mammals.
          Length = 407

 Score = 43.2 bits (102), Expect = 3e-05
 Identities = 23/87 (26%), Positives = 32/87 (36%), Gaps = 13/87 (14%)

Query: 52  VPAAPLRLGEVELRKRVACRR-MGQYIFDKGPKILAALSDY------MGLDYYTML---- 100
           +P AP  +  V        R    Q I      +     D         L Y T L    
Sbjct: 167 IPIAPYLIALVVGDLEYPVREQTVQGIPLHLYFLTPLAVDTVLRLQSAFLFYETDLGGPY 226

Query: 101 --PKMDLVAVPDFDAGAMENWGMNTYR 125
              + D+V VP+F +GAMEN G+  + 
Sbjct: 227 PYSEYDVVEVPEFPSGAMENPGLIFFS 253


>gnl|CDD|189009 cd09602, M1_APN_3, Peptidase M1 family containing Aminopeptidase N.
            This family contains bacterial and eukaryotic
           aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC
           3.4.11.2), a Type II integral membrane protease
           belonging to the M1 gluzincin family. APN consists of a
           small N-terminal cytoplasmic domain, a single
           transmembrane domain and a large extracellular
           ectodomain that contains the active site.  It
           preferentially cleaves neutral amino acids from the
           N-terminus of oligopeptides and, in higher eukaryotes,
           is present in a variety of human tissues and cell types
           (leukocyte, fibroblast, endothelial and epithelial
           cells). APN expression is dysregulated in inflammatory
           diseases such as chronic pain, rheumatoid arthritis,
           multiple sclerosis, systemic sclerosis, systemic lupus
           erythematosus, polymyositis/dermatomyosytis and
           pulmonary sarcoidosis, and is enhanced in tumor cells
           such as melanoma, renal, prostate, pancreas, colon,
           gastric and thyroid cancers. It is predominantly
           expressed on stem cells and on cells of the granulocytic
           and monocytic lineages at distinct stages of
           differentiation, thus considered a marker of
           differentiation. Thus, APN inhibition may lead to the
           development of anti-cancer and anti-inflammatory drugs.
           APNs are also present in many pathogenic bacteria and
           represent potential drug targets, Some APNs have been
           used commercially, such as one from Lactococcus lactis
           used in the food industry. APN also serves as a receptor
           for coronaviruses, although the virus receptor
           interaction site seems to be distinct from the enzymatic
           site and aminopeptidase activity is not necessary for
           viral infection. APNs have also been extensively studied
           as putative Cry toxin receptors. Cry1 proteins are
           pore-forming toxins that bind to the midgut epithelial
           cell membrane of susceptible insect larvae, causing
           extensive damage. Several different toxins, including
           Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have
           been shown to bind to APNs; however, a direct role of
           APN in cytotoxicity has been yet to be firmly
           established.
          Length = 438

 Score = 42.2 bits (100), Expect = 7e-05
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 2/41 (4%)

Query: 85  LAALSDYMGLDYYTMLPKMDLVAVPDFDAGAMENWGMNTYR 125
           L    +Y G+ Y     K D V VP+F+ GAMEN G  T+R
Sbjct: 227 LDFFEEYFGIPYP--FGKYDQVFVPEFNFGAMENPGCVTFR 265


>gnl|CDD|189007 cd09600, M1_APN_1, Peptidase M1 family containing Aminopeptidase N.
            This family contains aminopeptidase N (APN; CD13;
           Alanyl aminopeptidase; EC 3.4.11.2), a Type II integral
           membrane protease belonging to the M1 gluzincin family.
           It includes bacterial-type alanyl aminopeptidases as
           well as PfA-M1 aminopeptidase (Plasmodium
           falciparum-type). APN consists of a small N-terminal
           cytoplasmic domain, a single transmembrane domain and a
           large extracellular ectodomain that contains the active
           site. It preferentially cleaves neutral amino acids from
           the N-terminus of oligopeptides and, in higher
           eukaryotes, is present in a variety of human tissues and
           cell types (leukocyte, fibroblast, endothelial and
           epithelial cells). APN expression is dysregulated in
           inflammatory diseases such as chronic pain, rheumatoid
           arthritis, multiple sclerosis, systemic sclerosis,
           systemic lupus erythematosus,
           polymyositis/dermatomyosytis and pulmonary sarcoidosis,
           and is enhanced in tumor cells such as melanoma, renal,
           prostate, pancreas, colon, gastric and thyroid cancers.
           It is predominantly expressed on stem cells and on cells
           of the granulocytic and monocytic lineages at distinct
           stages of differentiation, thus considered a marker of
           differentiation. Thus, APN inhibition may lead to the
           development of anti-cancer and anti-inflammatory drugs.
           APNs are also present in many pathogenic bacteria and
           represent potential drug targets, Some APNs have been
           used commercially, such as one from Lactococcus lactis
           used in the food industry. APN also serves as a receptor
           for coronaviruses, although the virus receptor
           interaction site seems to be distinct from the enzymatic
           site and aminopeptidase activity is not necessary for
           viral infection. APNs have also been extensively studied
           as putative Cry toxin receptors. Cry1 proteins are
           pore-forming toxins that bind to the midgut epithelial
           cell membrane of susceptible insect larvae, causing
           extensive damage. Several different toxins, including
           Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have
           been shown to bind to APNs; however, a direct role of
           APN in cytotoxicity has been yet to be firmly
           established.
          Length = 861

 Score = 40.3 bits (95), Expect = 4e-04
 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 15/50 (30%)

Query: 90  DYMGLDYYTMLPKMDL-----VAVPDFDAGAMENWGM---NTYRLLASTQ 131
           D  GL+Y       DL     VAV DF+ GAMEN G+   N+  +LA  +
Sbjct: 231 DRFGLEY-------DLDLFNIVAVDDFNMGAMENKGLNIFNSKLVLADPE 273


>gnl|CDD|233858 TIGR02414, pepN_proteo, aminopeptidase N, Escherichia coli type.
           The M1 family of zinc metallopeptidases contains a
           number of distinct, well-separated clades of proteins
           with aminopeptidase activity. Several are designated
           aminopeptidase N, EC 3.4.11.2, after the Escherichia
           coli enzyme, suggesting a similar activity profile (see
           SP|P04825 for a description of catalytic activity). This
           family consists of all aminopeptidases closely related
           to E. coli PepN and presumed to have similar (not
           identical) function. Nearly all are found in
           Proteobacteria, but members are found also in
           Cyanobacteria, plants, and apicomplexan parasites. This
           family differs greatly in sequence from the family of
           aminopeptidases typified by Streptomyces lividans PepN
           (TIGR02412), from the membrane bound aminopeptidase N
           family in animals, etc [Protein fate, Degradation of
           proteins, peptides, and glycopeptides].
          Length = 863

 Score = 36.5 bits (85), Expect = 0.006
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 5/45 (11%)

Query: 90  DYMGLDYYTMLPKMDLVAVPDFDAGAMENWGMNTYR---LLASTQ 131
           +  GL+Y   L    +VAV DF+ GAMEN G+N +    +LA  +
Sbjct: 231 EVFGLEY--DLDIFMIVAVDDFNMGAMENKGLNIFNSKYVLADPE 273


>gnl|CDD|233857 TIGR02412, pepN_strep_liv, aminopeptidase N, Streptomyces lividans
           type.  This family is a subset of the members of the
           zinc metallopeptidase family M1 (pfam01433), with a
           single member characterized in Streptomyces lividans 66
           and designated aminopeptidase N. The spectrum of
           activity may differ somewhat from the aminopeptidase N
           clade of E. coli and most other Proteobacteria, well
           separated phylogenetically within the M1 family. The M1
           family also includes leukotriene A-4
           hydrolase/aminopeptidase (with a bifunctional active
           site).
          Length = 831

 Score = 35.5 bits (82), Expect = 0.014
 Identities = 22/63 (34%), Positives = 29/63 (46%), Gaps = 6/63 (9%)

Query: 65  RKRVACRRMGQYIFDKGPKILAALSDYMGLDYYTMLP--KMDLVAVPDFDAGAMENWGMN 122
           R+ +A       IF    + LA      G  Y    P  K D + VP+F+AGAMEN G  
Sbjct: 212 RRSLAQYLDADAIFTITRQGLAFFHRKFGYPY----PFKKYDQIFVPEFNAGAMENAGCV 267

Query: 123 TYR 125
           T+ 
Sbjct: 268 TFA 270


>gnl|CDD|189010 cd09603, M1_APN_4, Peptidase M1 family Aminopeptidase N.  This
           family contains mostly bacterial and some archaeal
           aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC
           3.4.11.2), a Type II integral membrane protease
           belonging to the M1 gluzincin family. APN consists of a
           small N-terminal cytoplasmic domain, a single
           transmembrane domain and a large extracellular
           ectodomain that contains the active site. It
           preferentially cleaves neutral amino acids from the
           N-terminus of oligopeptides and, in higher eukaryotes,
           is present in a variety of human tissues and cell types
           (leukocyte, fibroblast, endothelial and epithelial
           cells). APN expression is dysregulated in inflammatory
           diseases such as chronic pain, rheumatoid arthritis,
           multiple sclerosis, systemic sclerosis, systemic lupus
           erythematosus, polymyositis/dermatomyosytis and
           pulmonary sarcoidosis, and is enhanced in tumor cells
           such as melanoma, renal, prostate, pancreas, colon,
           gastric and thyroid cancers. It is predominantly
           expressed on stem cells and on cells of the granulocytic
           and monocytic lineages at distinct stages of
           differentiation, thus considered a marker of
           differentiation. Thus, APN inhibition may lead to the
           development of anti-cancer and anti-inflammatory drugs.
           APNs are also present in many pathogenic bacteria and
           represent potential drug targets, Some APNs have been
           used commercially, such as one from Lactococcus lactis
           used in the food industry. APN also serves as a receptor
           for coronaviruses, although the virus receptor
           interaction site seems to be distinct from the enzymatic
           site and aminopeptidase activity is not necessary for
           viral infection. APNs have also been extensively studied
           as putative Cry toxin receptors. Cry1 proteins are
           pore-forming toxins that bind to the midgut epithelial
           cell membrane of susceptible insect larvae, causing
           extensive damage. Several different toxins, including
           Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have
           been shown to bind to APNs; however, a direct role of
           APN in cytotoxicity has been yet to be firmly
           established.
          Length = 415

 Score = 35.3 bits (82), Expect = 0.015
 Identities = 15/52 (28%), Positives = 21/52 (40%), Gaps = 5/52 (9%)

Query: 74  GQYIFDKGPKILAALSDYMGLDY-YTMLPKMDLVAVPDFDAGAMENWGMNTY 124
            +  F + P++L    +  G  Y +    K   V V DF  G MEN     Y
Sbjct: 207 ARRAFARTPEMLDFFEELFG-PYPF---EKYGQVVVDDFLGGGMENQTRTVY 254


>gnl|CDD|237585 PRK14015, pepN, aminopeptidase N; Provisional.
          Length = 875

 Score = 34.7 bits (81), Expect = 0.025
 Identities = 17/35 (48%), Positives = 20/35 (57%), Gaps = 12/35 (34%)

Query: 93  GLDYYTMLPKMDL-----VAVPDFDAGAMENWGMN 122
           GL+Y       DL     VAV DF+ GAMEN G+N
Sbjct: 247 GLEY-------DLDIFMIVAVDDFNMGAMENKGLN 274


>gnl|CDD|236203 PRK08255, PRK08255, salicylyl-CoA 5-hydroxylase; Reviewed.
          Length = 765

 Score = 28.4 bits (64), Expect = 3.0
 Identities = 8/22 (36%), Positives = 10/22 (45%)

Query: 55  APLRLGEVELRKRVACRRMGQY 76
            P RL  + L+ RV    M  Y
Sbjct: 401 TPFRLRGLTLKNRVVVSPMAMY 422


  Database: CDD.v3.10
    Posted date:  Mar 20, 2013  7:55 AM
  Number of letters in database: 10,937,602
  Number of sequences in database:  44,354
  
Lambda     K      H
   0.322    0.134    0.413 

Gapped
Lambda     K      H
   0.267   0.0731    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 44354
Number of Hits to DB: 9,599,363
Number of extensions: 859349
Number of successful extensions: 525
Number of sequences better than 10.0: 1
Number of HSP's gapped: 523
Number of HSP's successfully gapped: 15
Length of query: 196
Length of database: 10,937,602
Length adjustment: 92
Effective length of query: 104
Effective length of database: 6,857,034
Effective search space: 713131536
Effective search space used: 713131536
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 56 (25.3 bits)