Query         psy227
Match_columns 139
No_of_seqs    110 out of 469
Neff          5.4 
Searched_HMMs 46136
Date          Fri Aug 16 20:24:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy227.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/227hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3913|consensus              100.0 2.1E-39 4.5E-44  275.1   8.9   99   14-138   106-204 (356)
  2 smart00097 WNT1 found in Wnt-1 100.0 1.4E-36   3E-41  254.2   9.0   99   14-138    57-155 (305)
  3 PF00110 wnt:  wnt family;  Int 100.0 3.4E-34 7.3E-39  240.0   8.5   99   14-138    61-159 (310)
  4 PF09832 DUF2059:  Uncharacteri  41.9      15 0.00034   23.2   1.2   22  118-139    21-42  (64)
  5 PF12342 DUF3640:  Protein of u  28.5      33 0.00073   19.1   1.0   14    1-14      1-14  (26)
  6 CHL00020 psbN photosystem II p  19.4   1E+02  0.0022   19.2   2.0   19   21-39      2-20  (43)
  7 PRK13183 psbN photosystem II r  16.9 1.6E+02  0.0034   18.6   2.4   21   19-39      3-23  (46)
  8 PHA02100 hypothetical protein   15.7 1.5E+02  0.0032   21.7   2.4   19   74-93     23-41  (112)
  9 PF02468 PsbN:  Photosystem II   13.4 1.2E+02  0.0026   18.8   1.2   19   21-39      2-20  (43)
 10 PF12535 Nudix_N:  Hydrolase of  10.9 2.1E+02  0.0045   18.4   1.8   12   25-36     11-22  (58)

No 1  
>KOG3913|consensus
Probab=100.00  E-value=2.1e-39  Score=275.06  Aligned_cols=99  Identities=37%  Similarity=0.752  Sum_probs=89.8

Q ss_pred             hhccCchhhHHHHHHHHHHHHHHHHhhhcCCCCCCcccCCCCCccchhhhcCCccccCCCcchHhHHHHHHhhhhhhhhh
Q psy227           14 FRLNGTREQGIVYALGSAAITYTLARGCADGTIFHCSCATPSKKATAKAIKNSFQWGGCGDNVRWGAQFARSFTDILENE   93 (139)
Q Consensus        14 ~~~~gtREtAfvyAisSAgv~~~ItraCs~G~l~~CgC~~~~~~~~~~~~~~~~~WgGCsdnV~~G~~fsr~Fld~~e~~   93 (139)
                      ++++|+||+||||||+||||+|+|||||++|.|..||||...++.+.   +++|+||||||||+||++|||.|||++|+.
T Consensus       106 ~l~~g~REsAFv~AIssAgV~havtraCs~G~l~~CgCd~~~~~~~~---~~~w~WGGCsDnv~fG~~fsr~FlD~re~~  182 (356)
T KOG3913|consen  106 LLSRGTRETAFVYAISSAGVAHAVTRACSQGNLESCGCDPSPNGKSG---PEGWEWGGCSDNVDFGIRFSRKFLDAREKR  182 (356)
T ss_pred             hhcccchHHHHHHHHHHhHHHHHHHHHhcCCCCCCcCCCCCCCCCCC---CCCccccCCCCchHHHHHHHHHhccccccc
Confidence            45679999999999999999999999999999999999987765544   366999999999999999999999988865


Q ss_pred             hhhhhhHhHHHHHHHhhhhhhhhhhHHHHHHhhhhHHHHhhhhcC
Q psy227           94 RDIQTQRNLRLIDAAMFDEKNNRNYMLNVMNLHNNKAGRKIDTYQ  138 (139)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~mnlHNn~aGR~av~~~  138 (139)
                      +                       |++.+||||||+|||+||+++
T Consensus       183 ~-----------------------d~r~lmnlHNNeaGR~av~~~  204 (356)
T KOG3913|consen  183 K-----------------------DARALMNLHNNEAGRKAVKKN  204 (356)
T ss_pred             c-----------------------CHHHHHHHhhhHHHHHHHHHh
Confidence            4                       899999999999999999864


No 2  
>smart00097 WNT1 found in Wnt-1.
Probab=100.00  E-value=1.4e-36  Score=254.24  Aligned_cols=99  Identities=35%  Similarity=0.713  Sum_probs=87.4

Q ss_pred             hhccCchhhHHHHHHHHHHHHHHHHhhhcCCCCCCcccCCCCCccchhhhcCCccccCCCcchHhHHHHHHhhhhhhhhh
Q psy227           14 FRLNGTREQGIVYALGSAAITYTLARGCADGTIFHCSCATPSKKATAKAIKNSFQWGGCGDNVRWGAQFARSFTDILENE   93 (139)
Q Consensus        14 ~~~~gtREtAfvyAisSAgv~~~ItraCs~G~l~~CgC~~~~~~~~~~~~~~~~~WgGCsdnV~~G~~fsr~Fld~~e~~   93 (139)
                      ++.+|+||+||||||+||||+|+||+||++|.|..|+||...++.+.   .++|+||||+|||.||++|++.|||+++..
T Consensus        57 ~l~~~trEtAfv~Ai~sAgv~~~itraCs~G~l~~C~Cd~~~~~~~~---~~~w~WgGCsdnv~~G~~~s~~FlD~~~~~  133 (305)
T smart00097       57 VLRQGTRETAFVYAISSAGVAHAVTRACSEGELDSCGCDYRKRGRAG---GRGWKWGGCSDNIDFGIRFSREFVDARERG  133 (305)
T ss_pred             ccccccchHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCCCCCCCCC---CCCcccCCCCccHHHHHHHHHHHHhccccc
Confidence            44779999999999999999999999999999999999987654433   257999999999999999999999987643


Q ss_pred             hhhhhhHhHHHHHHHhhhhhhhhhhHHHHHHhhhhHHHHhhhhcC
Q psy227           94 RDIQTQRNLRLIDAAMFDEKNNRNYMLNVMNLHNNKAGRKIDTYQ  138 (139)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~mnlHNn~aGR~av~~~  138 (139)
                      +                       +++.+||||||+|||+||+.+
T Consensus       134 ~-----------------------d~r~lmnlHNn~aGR~~v~~~  155 (305)
T smart00097      134 K-----------------------DARALMNLHNNEAGRLAVKKT  155 (305)
T ss_pred             c-----------------------cHHHHHHHhhhHHHHHHHHHH
Confidence            2                       789999999999999999753


No 3  
>PF00110 wnt:  wnt family;  InterPro: IPR005817 Wnt proteins constitute a large family of secreted molecules that are involved in intercellular signalling during development. The name derives from the first 2 members of the family to be discovered: int-1 (mouse) and wingless (Drosophila) []. It is now recognised that Wnt signalling controls many cell fate decisions in a variety of different organisms, including mammals []. Wnt signalling has been implicated in tumourigenesis, early mesodermal patterning of the embryo, morphogenesis of the brain and kidneys, regulation of mammary gland proliferation and Alzheimer's disease [, ]. Wnt-mediated signalling is believed to proceed initially through binding to cell surface receptors of the frizzled family; the signal is subsequently transduced through several cytoplasmic components to B-catenin, which enters the nucleus and activates the transcription of several genes important in development []. Several non-canonical Wnt signalling pathways have also been elucidated that act independently of B-catenin. Canonical and noncanonical Wnt signaling branches are highly interconnected, and cross-regulate each other []. Members of the Wnt gene family are defined by their sequence similarity to mouse Wnt-1 and Wingless in Drosophila. They encode proteins of ~350-400 residues in length, with orthologues identified in several, mostly vertebrate, species. Very little is known about the structure of Wnts as they are notoriously insoluble, but they share the following features characteristics of secretory proteins: a signal peptide, several potential N-glycosylation sites and 22 conserved cysteines [] that are probably involved in disulphide bonds. The Wnt proteins seem to adhere to the plasma membrane of the secreting cells and are therefore likely to signal over only few cell diameters. Fifteen major Wnt gene families have been identified in vertebrates, with multiple subtypes within some classes. In humans, 19 Wnt proteins have been identified that share 27% to 83% amino-acid sequence identity and a conserved pattern of 23 or 24 cysteine residues []. Wnt genes are highly conserved between vertebrate species sharing overall sequence identity and gene structure, and are slightly less conserved between vertebrates and invertebrates.; GO: 0005102 receptor binding, 0007275 multicellular organismal development, 0016055 Wnt receptor signaling pathway, 0005576 extracellular region; PDB: 4F0A_B.
Probab=100.00  E-value=3.4e-34  Score=239.97  Aligned_cols=99  Identities=38%  Similarity=0.783  Sum_probs=73.7

Q ss_pred             hhccCchhhHHHHHHHHHHHHHHHHhhhcCCCCCCcccCCCCCccchhhhcCCccccCCCcchHhHHHHHHhhhhhhhhh
Q psy227           14 FRLNGTREQGIVYALGSAAITYTLARGCADGTIFHCSCATPSKKATAKAIKNSFQWGGCGDNVRWGAQFARSFTDILENE   93 (139)
Q Consensus        14 ~~~~gtREtAfvyAisSAgv~~~ItraCs~G~l~~CgC~~~~~~~~~~~~~~~~~WgGCsdnV~~G~~fsr~Fld~~e~~   93 (139)
                      ++.+|+||+||||||+||||+|+||+||+.|.|..|+|+......+.   ++.|+|+||+|||.||++||++|||+++..
T Consensus        61 ~~~~gtrE~Afv~Ai~sAgv~~~itraCs~G~l~~C~C~~~~~~~~~---~~~~~wggCsdni~~G~~~sr~Fld~~~~~  137 (310)
T PF00110_consen   61 ILKKGTRETAFVYAISSAGVAHSITRACSRGKLKSCGCDRNPRGSSS---QNTWQWGGCSDNIKFGIKFSRRFLDAREKG  137 (310)
T ss_dssp             T--S--HHHHHHHHHHHHHHHHHHHHHHHTTT-SS-----TTTTSEE---ETTEEE-S----HHHHHHHHHHHHHHH--S
T ss_pred             ccccCcccceeeEhhhcCchHHHHHHHhhcccCCcCCCccccccccc---ccccccCCcccccccchHHHHHHHHhhhhh
Confidence            45789999999999999999999999999999999999988776544   356999999999999999999999998843


Q ss_pred             hhhhhhHhHHHHHHHhhhhhhhhhhHHHHHHhhhhHHHHhhhhcC
Q psy227           94 RDIQTQRNLRLIDAAMFDEKNNRNYMLNVMNLHNNKAGRKIDTYQ  138 (139)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~mnlHNn~aGR~av~~~  138 (139)
                      .                       +.+.+||+|||+|||++|.+.
T Consensus       138 ~-----------------------~~~~~mn~HNn~aGR~~v~~~  159 (310)
T PF00110_consen  138 S-----------------------DARSLMNLHNNEAGRKAVKKN  159 (310)
T ss_dssp             S-----------------------SHHHHHHHHHHHHHHHHHHHT
T ss_pred             h-----------------------hhhhhhhhhhhhhhhhhhccc
Confidence            2                       789999999999999999863


No 4  
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=41.86  E-value=15  Score=23.24  Aligned_cols=22  Identities=18%  Similarity=0.326  Sum_probs=19.1

Q ss_pred             hHHHHHHhhhhHHHHhhhhcCC
Q psy227          118 YMLNVMNLHNNKAGRKIDTYQP  139 (139)
Q Consensus       118 ~~~~~mnlHNn~aGR~av~~~~  139 (139)
                      ++..++...+.++|++++.++|
T Consensus        21 El~~i~~FY~Sp~Gqk~~~~~~   42 (64)
T PF09832_consen   21 ELDAILAFYESPLGQKIVAKEP   42 (64)
T ss_dssp             HHHHHHHHHHSHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCHHhHHHHHHhH
Confidence            6778899999999999998875


No 5  
>PF12342 DUF3640:  Protein of unknown function (DUF3640) ;  InterPro: IPR022101  This entry defines the N-terminal domain of the polyprotein of GB virus C; its function is not known. 
Probab=28.51  E-value=33  Score=19.09  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=9.9

Q ss_pred             Chhhhhhhhhhhhh
Q psy227            1 METVQASFCRRLFF   14 (139)
Q Consensus         1 ~~~~~~~~~~~~~~   14 (139)
                      |.++-.+||+|+--
T Consensus         1 mslLtnr~crrvdk   14 (26)
T PF12342_consen    1 MSLLTNRMCRRVDK   14 (26)
T ss_pred             ChHHHHHHHhhhcc
Confidence            55677788888743


No 6  
>CHL00020 psbN photosystem II protein N
Probab=19.37  E-value=1e+02  Score=19.15  Aligned_cols=19  Identities=11%  Similarity=0.134  Sum_probs=15.4

Q ss_pred             hhHHHHHHHHHHHHHHHHh
Q psy227           21 EQGIVYALGSAAITYTLAR   39 (139)
Q Consensus        21 EtAfvyAisSAgv~~~Itr   39 (139)
                      |+|++.+|.-+.++.++|-
T Consensus         2 e~A~~~~i~i~~ll~~~Tg   20 (43)
T CHL00020          2 ETATLVAIFISGLLVSFTG   20 (43)
T ss_pred             CchhhHHHHHHHHHHHhhh
Confidence            6788889988888887763


No 7  
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=16.93  E-value=1.6e+02  Score=18.58  Aligned_cols=21  Identities=19%  Similarity=0.186  Sum_probs=16.9

Q ss_pred             chhhHHHHHHHHHHHHHHHHh
Q psy227           19 TREQGIVYALGSAAITYTLAR   39 (139)
Q Consensus        19 tREtAfvyAisSAgv~~~Itr   39 (139)
                      +-|+|++.+|.-++++.++|-
T Consensus         3 ~me~A~~~~i~i~~lL~~~Tg   23 (46)
T PRK13183          3 AMSPALSLAITILAILLALTG   23 (46)
T ss_pred             ccchhHHHHHHHHHHHHHHhh
Confidence            347899999999888888763


No 8  
>PHA02100 hypothetical protein
Probab=15.69  E-value=1.5e+02  Score=21.66  Aligned_cols=19  Identities=37%  Similarity=0.613  Sum_probs=14.4

Q ss_pred             cchHhHHHHHHhhhhhhhhh
Q psy227           74 DNVRWGAQFARSFTDILENE   93 (139)
Q Consensus        74 dnV~~G~~fsr~Fld~~e~~   93 (139)
                      ||| .|..++..-||.+|.+
T Consensus        23 dni-lG~~VTpQvlD~wE~e   41 (112)
T PHA02100         23 DNI-LGNRISEEQIDAVENE   41 (112)
T ss_pred             cch-hhhhcCHHHHHHHHHH
Confidence            555 5778888999988854


No 9  
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=13.42  E-value=1.2e+02  Score=18.79  Aligned_cols=19  Identities=16%  Similarity=0.195  Sum_probs=13.8

Q ss_pred             hhHHHHHHHHHHHHHHHHh
Q psy227           21 EQGIVYALGSAAITYTLAR   39 (139)
Q Consensus        21 EtAfvyAisSAgv~~~Itr   39 (139)
                      |+|++.+|+-+.++.++|-
T Consensus         2 e~a~~~~i~i~~~lv~~Tg   20 (43)
T PF02468_consen    2 ETATVLAIFISCLLVSITG   20 (43)
T ss_pred             CceeeHHHHHHHHHHHHHh
Confidence            5777788887777776653


No 10 
>PF12535 Nudix_N:  Hydrolase of X-linked nucleoside diphosphate N terminal ; PDB: 3Q1P_B 3Q4I_B.
Probab=10.93  E-value=2.1e+02  Score=18.43  Aligned_cols=12  Identities=17%  Similarity=0.551  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHHH
Q psy227           25 VYALGSAAITYT   36 (139)
Q Consensus        25 vyAisSAgv~~~   36 (139)
                      +.||+-+|++|+
T Consensus        11 lqaiAqtGL~Ys   22 (58)
T PF12535_consen   11 LQAIAQTGLAYS   22 (58)
T ss_dssp             HHHHHHHHHHH-
T ss_pred             HHHHHHhhhhhC
Confidence            678999999983


Done!