Diaphorina citri psyllid: psy2280


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MVQLNTINFRDYAKKEKALLQALQMYNIEIASPMMFYTNRLATFTNWTFKSGNCTAEHMAHAGFYLIQDDCTKCVFCYKELDGWEVTDYPWDEHKSHKPDCPFVQLNKRDLTTCHIDEFIVLNSAVVKNKMMETLQQGKEELTRMFDDFKAKITEKINRVAF
ccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHcHcccccccccccHHHHHHcccEEcccccEEEEccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*************************YNIEIASPMMFYTNRLATFTNWTFKSGNCTAEHMAHAGFYLIQDDCTKCVFCYKELDGWEVTDYPWDEHKSHKPDCPFVQLNKRDLTTCHIDEFIVLNSAVVK*****************F*****KITEKINRVAF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVQLNTINFRDYAKKEKALLQALQMYNIEIASPMMFYTNRLATFTNWTFKSGNCTAEHMAHAGFYLIQDDCTKCVFCYKELDGWEVTDYPWDEHKSHKPDCPFVQLNKRDLTTCHIDEFIVLNSAVVKNKMxxxxxxxxxxxxxxxxxxxxxITEKINRVAF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Baculoviral IAP repeat-containing protein 5 Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.confidentQ9GLN5
Baculoviral IAP repeat-containing protein 5 Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokenesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.confidentQ8I009
Baculoviral IAP repeat-containing protein 5 Multitasking protein that has dual roles in promoting cell proliferation and preventing apoptosis. Component of a chromosome passage protein complex (CPC) which is essential for chromosome alignment and segregation during mitosis and cytokinesis. Acts as an important regulator of the localization of this complex; directs CPC movement to different locations from the inner centromere during prometaphase to midbody during cytokinesis and participates in the organization of the center spindle by associating with polymerized microtubules. The complex with RAN plays a role in mitotic spindle formation by serving as a physical scaffold to help deliver the RAN effector molecule TPX2 to microtubules. May counteract a default induction of apoptosis in G2/M phase. The acetylated form represses STAT3 transactivation of target gene promoters. May play a role in neoplasia. Inhibitor of CASP3 and CASP7.confidentQ6J1J1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0072557 [CC]IPAF inflammasome complexprobableGO:0043234, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005876 [CC]spindle microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0048037 [MF]cofactor bindingprobableGO:0003674, GO:0005488
GO:0043154 [BP]negative regulation of cysteine-type endopeptidase activity involved in apoptotic processprobableGO:0019222, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0051346, GO:2000116, GO:2000117, GO:0043086, GO:0043067, GO:0010466, GO:0065007, GO:0044092, GO:0043281, GO:0065009, GO:0010259, GO:0006915, GO:0052547, GO:0052548, GO:0009987, GO:0050794, GO:0012501, GO:0044763, GO:0010951, GO:0051336, GO:0050790, GO:0008150
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0000086 [BP]G2/M transition of mitotic cell cycleprobableGO:0000278, GO:0008150, GO:0009987, GO:0044770, GO:0044772, GO:0044763, GO:0044699, GO:0022402, GO:0007049
GO:0045787 [BP]positive regulation of cell cycleprobableGO:0051726, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0032133 [CC]chromosome passenger complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0005622, GO:0005875, GO:0044422
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0000777 [CC]condensed chromosome kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0000793, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0000779, GO:0043229, GO:0043228, GO:0044422, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0000776
GO:0031021 [CC]interphase microtubule organizing centerprobableGO:0005856, GO:0005575, GO:0015630, GO:0043228, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0005814 [CC]centrioleprobableGO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0008536 [MF]Ran GTPase bindingprobableGO:0019899, GO:0017016, GO:0031267, GO:0051020, GO:0003674, GO:0005488, GO:0005515
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0048545 [BP]response to steroid hormone stimulusprobableGO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0000226 [BP]microtubule cytoskeleton organizationprobableGO:0006996, GO:0007017, GO:0007010, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0000228 [CC]nuclear chromosomeprobableGO:0005575, GO:0031981, GO:0043232, GO:0043233, GO:0043227, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0005694, GO:0043226, GO:0044422, GO:0043231
GO:0015631 [MF]tubulin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0005881 [CC]cytoplasmic microtubuleprobableGO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QFA, chain A
Confidence level:very confident
Coverage over the Query: 27-154
View the alignment between query and template
View the model in PyMOL