Query         psy2284
Match_columns 175
No_of_seqs    141 out of 209
Neff          4.3 
Searched_HMMs 46136
Date          Fri Aug 16 20:45:23 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2284.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2284hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3362|consensus              100.0   2E-53 4.3E-58  340.3   4.2  154    2-173     3-156 (156)
  2 PF04438 zf-HIT:  HIT zinc fing  99.2 1.3E-12 2.9E-17   79.8  -0.3   30  134-163     1-30  (30)
  3 COG5195 Uncharacterized conser  97.3 0.00013 2.7E-09   56.8   2.3   57  102-158    32-89  (118)
  4 KOG4137|consensus               97.3 0.00026 5.5E-09   54.3   3.6   44  117-160    32-75  (102)
  5 PF01753 zf-MYND:  MYND finger;  95.6  0.0037   8E-08   38.8   0.2   29  138-166     1-30  (37)
  6 KOG1710|consensus               94.4  0.0072 1.6E-07   54.9  -1.2   35  133-167   317-353 (396)
  7 PF13824 zf-Mss51:  Zinc-finger  93.3   0.045 9.7E-07   38.0   1.3   27  137-163     1-32  (55)
  8 cd00350 rubredoxin_like Rubred  92.4   0.061 1.3E-06   32.9   1.0   20  136-155     2-26  (33)
  9 cd00729 rubredoxin_SM Rubredox  86.9    0.29 6.2E-06   30.4   0.8   20  136-155     3-27  (34)
 10 cd00730 rubredoxin Rubredoxin;  83.3    0.66 1.4E-05   31.3   1.3   10  146-155    34-43  (50)
 11 PF12387 Peptidase_C74:  Pestiv  83.2    0.62 1.4E-05   39.5   1.4   58  105-164   132-193 (200)
 12 PF00301 Rubredoxin:  Rubredoxi  83.2     0.5 1.1E-05   31.5   0.7   12  144-155    32-43  (47)
 13 PLN00206 DEAD-box ATP-dependen  82.8    0.54 1.2E-05   43.8   1.0   34  133-166    26-59  (518)
 14 PRK00420 hypothetical protein;  81.0    0.94   2E-05   35.3   1.6   21  136-156    24-50  (112)
 15 TIGR02487 NrdD anaerobic ribon  80.9    0.86 1.9E-05   43.7   1.6   25  131-155   520-547 (579)
 16 PF13248 zf-ribbon_3:  zinc-rib  80.4     0.8 1.7E-05   26.6   0.8   20  136-155     3-25  (26)
 17 PRK14704 anaerobic ribonucleos  79.3    0.94   2E-05   44.1   1.3   24  131-154   555-580 (618)
 18 PF09297 zf-NADH-PPase:  NADH p  78.6    0.86 1.9E-05   27.4   0.5   21  135-155     3-30  (32)
 19 PRK03824 hypA hydrogenase nick  78.5    0.87 1.9E-05   35.9   0.7   12  131-142    66-77  (135)
 20 PRK01343 zinc-binding protein;  77.9     1.5 3.2E-05   30.7   1.6   28  134-165     8-35  (57)
 21 smart00290 ZnF_UBP Ubiquitin C  76.6     1.7 3.8E-05   27.8   1.6   23  137-159     1-24  (50)
 22 PRK12380 hydrogenase nickel in  76.6     1.4 3.1E-05   33.7   1.4   25  131-155    66-95  (113)
 23 smart00661 RPOL9 RNA polymeras  76.3     1.6 3.5E-05   28.1   1.4   19  136-154     1-28  (52)
 24 PRK07111 anaerobic ribonucleos  76.2     1.4 3.1E-05   43.7   1.5   24  131-154   676-701 (735)
 25 PHA00626 hypothetical protein   76.1     1.7 3.6E-05   30.7   1.4   21  136-156    12-33  (59)
 26 PRK09263 anaerobic ribonucleos  75.2     1.5 3.3E-05   43.3   1.5   24  132-155   638-668 (711)
 27 PF10013 DUF2256:  Uncharacteri  74.6    0.51 1.1E-05   31.2  -1.3   30  134-163     7-40  (42)
 28 PF07754 DUF1610:  Domain of un  74.4     2.1 4.5E-05   25.1   1.3   11  144-154    14-24  (24)
 29 COG0675 Transposase and inacti  73.6     2.3   5E-05   35.3   2.0   24  131-154   305-330 (364)
 30 PRK03681 hypA hydrogenase nick  73.0     1.7 3.6E-05   33.4   0.9   25  131-155    66-96  (114)
 31 PRK00762 hypA hydrogenase nick  71.1     1.9 4.2E-05   33.5   0.9   24  131-155    66-101 (124)
 32 smart00154 ZnF_AN1 AN1-like Zi  71.0     2.9 6.2E-05   26.6   1.5   22  138-159     1-25  (39)
 33 PF01155 HypA:  Hydrogenase exp  71.0     1.1 2.3E-05   34.2  -0.5   26  131-156    66-96  (113)
 34 PF03884 DUF329:  Domain of unk  70.5     1.4 3.1E-05   30.6   0.0   10  155-164    22-31  (57)
 35 PF08265 YL1_C:  YL1 nuclear pr  70.4     2.6 5.5E-05   25.8   1.1   28  136-163     1-28  (30)
 36 TIGR02827 RNR_anaer_Bdell anae  69.9     2.4 5.3E-05   41.1   1.5   24  132-155   529-555 (586)
 37 PRK12496 hypothetical protein;  69.2     2.4 5.2E-05   34.5   1.1   21  135-155   127-152 (164)
 38 PRK00432 30S ribosomal protein  69.1     3.1 6.8E-05   27.9   1.5   27  131-157    16-48  (50)
 39 PRK05452 anaerobic nitric oxid  69.1     2.9 6.3E-05   39.1   1.8   29  127-155   417-467 (479)
 40 TIGR01031 rpmF_bact ribosomal   69.0     3.2   7E-05   28.3   1.5   23  132-154    23-47  (55)
 41 PRK13130 H/ACA RNA-protein com  68.6     2.2 4.7E-05   29.6   0.7   23  135-157     5-28  (56)
 42 PF11682 DUF3279:  Protein of u  67.8     4.4 9.5E-05   32.4   2.3   29  128-156    90-120 (128)
 43 PRK14890 putative Zn-ribbon RN  67.4     2.1 4.5E-05   30.2   0.4    9  146-154    48-56  (59)
 44 COG3024 Uncharacterized protei  67.1     2.2 4.8E-05   30.6   0.4   11  155-165    27-37  (65)
 45 TIGR00100 hypA hydrogenase nic  67.1     2.6 5.7E-05   32.3   0.9   26  131-156    66-96  (115)
 46 PF14446 Prok-RING_1:  Prokaryo  67.1     3.5 7.6E-05   28.5   1.4   22  135-156     5-31  (54)
 47 PF13240 zinc_ribbon_2:  zinc-r  66.8     2.7 5.9E-05   24.0   0.7   19  137-155     1-22  (23)
 48 PRK00564 hypA hydrogenase nick  66.7     2.9 6.3E-05   32.2   1.1   25  131-155    67-97  (117)
 49 PF07282 OrfB_Zn_ribbon:  Putat  66.4     3.3 7.2E-05   28.2   1.2   22  134-155    27-55  (69)
 50 PF12172 DUF35_N:  Rubredoxin-l  66.2       2 4.4E-05   26.4   0.1   18  137-154    13-33  (37)
 51 smart00109 C1 Protein kinase C  65.1     3.8 8.3E-05   25.2   1.2   22  133-154     9-35  (49)
 52 PRK00418 DNA gyrase inhibitor;  65.1     4.1   9E-05   28.9   1.5   32  133-164     4-35  (62)
 53 PRK08271 anaerobic ribonucleos  64.6     3.6 7.7E-05   40.3   1.5   24  132-155   563-589 (623)
 54 PF09538 FYDLN_acid:  Protein o  63.6     3.2 6.8E-05   32.0   0.7   24  133-156     7-36  (108)
 55 PRK12495 hypothetical protein;  63.2     4.4 9.5E-05   35.3   1.6   25  132-156    39-68  (226)
 56 PRK08270 anaerobic ribonucleos  63.1     4.1 8.8E-05   40.0   1.6   24  132-155   623-648 (656)
 57 PF09862 DUF2089:  Protein of u  62.6     3.2 6.9E-05   32.5   0.6   19  138-156     1-22  (113)
 58 PRK12286 rpmF 50S ribosomal pr  62.6     5.9 0.00013   27.3   1.9   23  132-154    24-48  (57)
 59 PRK11788 tetratricopeptide rep  61.9     5.3 0.00012   34.0   1.9   25  131-155   350-377 (389)
 60 COG1592 Rubrerythrin [Energy p  61.3     4.5 9.7E-05   33.6   1.3   21  135-155   134-158 (166)
 61 PF11781 RRN7:  RNA polymerase   60.9     4.2 9.2E-05   25.6   0.8   20  135-154     8-33  (36)
 62 cd07160 NR_DBD_LXR DNA-binding  60.8       6 0.00013   30.0   1.8   31  126-156     9-45  (101)
 63 PF08271 TF_Zn_Ribbon:  TFIIB z  60.6     3.7   8E-05   26.1   0.6   18  137-154     2-27  (43)
 64 PHA02942 putative transposase;  60.4     6.2 0.00013   36.1   2.1   22  134-155   324-351 (383)
 65 PF01783 Ribosomal_L32p:  Ribos  59.2     4.6  0.0001   27.4   0.9   20  134-153    25-46  (56)
 66 PF13597 NRDD:  Anaerobic ribon  59.0     3.6 7.9E-05   39.3   0.4   25  132-156   488-514 (546)
 67 PF01428 zf-AN1:  AN1-like Zinc  58.7     5.8 0.00013   25.3   1.2   22  138-159     1-26  (43)
 68 TIGR00269 conserved hypothetic  58.5     4.3 9.2E-05   30.4   0.7   21  134-154    79-100 (104)
 69 cd01675 RNR_III Class III ribo  58.1     5.7 0.00012   38.0   1.6   24  132-156   516-542 (555)
 70 smart00064 FYVE Protein presen  58.0       6 0.00013   26.7   1.3   24  135-158    10-38  (68)
 71 PF13842 Tnp_zf-ribbon_2:  DDE_  57.5     8.9 0.00019   23.4   1.8   24  137-160     2-30  (32)
 72 PF13878 zf-C2H2_3:  zinc-finge  57.1     5.6 0.00012   25.5   0.9   15  144-158    11-25  (41)
 73 cd00065 FYVE FYVE domain; Zinc  56.5     6.7 0.00015   25.5   1.3   26  136-162     3-33  (57)
 74 PLN02294 cytochrome c oxidase   56.4      10 0.00022   31.9   2.6   29  128-156   109-151 (174)
 75 COG4068 Uncharacterized protei  56.2     4.1 8.9E-05   29.0   0.2   28  132-164     5-32  (64)
 76 PRK04023 DNA polymerase II lar  55.8     6.5 0.00014   41.0   1.6    6  137-142   628-633 (1121)
 77 PRK08579 anaerobic ribonucleos  55.4     5.8 0.00013   38.8   1.2   25  131-155   564-591 (625)
 78 cd00029 C1 Protein kinase C co  55.1       7 0.00015   24.3   1.1   22  134-155    10-37  (50)
 79 TIGR01384 TFS_arch transcripti  54.8       7 0.00015   28.7   1.3   21  136-156     1-26  (104)
 80 COG1571 Predicted DNA-binding   54.4     5.9 0.00013   37.3   1.0   25  135-159   350-380 (421)
 81 KOG3612|consensus               53.8     2.9 6.4E-05   40.6  -1.1   31  135-167   527-558 (588)
 82 smart00547 ZnF_RBZ Zinc finger  52.7     6.4 0.00014   22.1   0.6   20  136-155     3-25  (26)
 83 PRK14892 putative transcriptio  52.7     8.2 0.00018   29.5   1.4   25  132-156    18-52  (99)
 84 PRK14714 DNA polymerase II lar  52.6     9.8 0.00021   40.5   2.3   20  136-155   680-701 (1337)
 85 PF01363 FYVE:  FYVE zinc finge  51.6     7.6 0.00016   26.3   1.0   25  135-159     9-38  (69)
 86 PF08792 A2L_zn_ribbon:  A2L zi  50.7      10 0.00022   23.5   1.3   21  135-155     3-30  (33)
 87 COG4338 Uncharacterized protei  50.6     0.9   2E-05   31.2  -3.7   34  131-164     8-45  (54)
 88 PRK00241 nudC NADH pyrophospha  49.6     9.5 0.00021   32.9   1.5   25  132-156    96-127 (256)
 89 PF00096 zf-C2H2:  Zinc finger,  49.4     7.3 0.00016   20.9   0.5   18  147-164     1-18  (23)
 90 PF00641 zf-RanBP:  Zn-finger i  48.8     8.8 0.00019   22.5   0.8   22  134-155     3-27  (30)
 91 COG1645 Uncharacterized Zn-fin  47.6      11 0.00023   30.4   1.3   18  137-154    30-52  (131)
 92 PF14803 Nudix_N_2:  Nudix N-te  47.6     8.1 0.00018   24.1   0.5    6  137-142     2-7   (34)
 93 KOG2807|consensus               47.2      32 0.00068   32.0   4.4   27  134-160   262-290 (378)
 94 PF09889 DUF2116:  Uncharacteri  46.6     7.4 0.00016   27.2   0.3   24  136-164     4-27  (59)
 95 COG2888 Predicted Zn-ribbon RN  46.6     7.2 0.00016   27.7   0.2   12  132-143    24-35  (61)
 96 COG2816 NPY1 NTP pyrophosphohy  45.7      12 0.00026   33.5   1.5   25  132-156   108-139 (279)
 97 PF14949 ARF7EP_C:  ARF7 effect  45.3      11 0.00025   29.0   1.1   16  146-161    74-89  (103)
 98 PF02148 zf-UBP:  Zn-finger in   45.2     9.1  0.0002   26.0   0.5   22  138-159     1-24  (63)
 99 TIGR02098 MJ0042_CXXC MJ0042 f  44.4      12 0.00026   22.7   1.0   11  146-156     2-12  (38)
100 PF03833 PolC_DP2:  DNA polymer  43.6     7.8 0.00017   39.6   0.0   37  135-171   667-705 (900)
101 PF04216 FdhE:  Protein involve  43.2     7.2 0.00016   33.8  -0.2   22   21-42     11-32  (290)
102 COG1545 Predicted nucleic-acid  42.9      13 0.00029   29.4   1.3   20  136-155    30-52  (140)
103 PF13894 zf-C2H2_4:  C2H2-type   42.7     7.5 0.00016   20.2  -0.1   20  147-166     1-20  (24)
104 PRK14891 50S ribosomal protein  42.6     8.4 0.00018   31.1   0.1   42  133-174     2-53  (131)
105 smart00659 RPOLCX RNA polymera  42.6      17 0.00037   23.7   1.5   19  137-155     4-28  (44)
106 COG4888 Uncharacterized Zn rib  41.9      16 0.00036   28.4   1.6   28  129-156    16-56  (104)
107 PF03107 C1_2:  C1 domain;  Int  41.4      18 0.00039   21.4   1.4   17  137-153     2-22  (30)
108 TIGR00622 ssl1 transcription f  41.1      28 0.00061   27.3   2.8   38  118-157    40-92  (112)
109 PF12773 DZR:  Double zinc ribb  41.1      15 0.00033   23.4   1.1   22  133-154    10-37  (50)
110 PF13696 zf-CCHC_2:  Zinc knuck  38.8      24 0.00052   22.0   1.7   21  131-151     4-26  (32)
111 PF00643 zf-B_box:  B-box zinc   38.4      16 0.00034   22.4   0.8   25  135-159     3-28  (42)
112 PRK04023 DNA polymerase II lar  38.1      24 0.00052   37.0   2.4   21  134-154   637-659 (1121)
113 PF14569 zf-UDP:  Zinc-binding   37.7      15 0.00032   27.4   0.7   12  145-156    50-61  (80)
114 PRK01110 rpmF 50S ribosomal pr  37.4      20 0.00044   24.8   1.3   19  135-154    27-47  (60)
115 PF05495 zf-CHY:  CHY zinc fing  37.1      11 0.00024   26.5  -0.0   21  135-155    41-70  (71)
116 PF07975 C1_4:  TFIIH C1-like d  37.1      18 0.00039   24.6   1.0   14  145-158    20-33  (51)
117 PHA00616 hypothetical protein   37.1     5.9 0.00013   26.3  -1.3   15  146-160     1-15  (44)
118 cd07173 NR_DBD_AR DNA-binding   36.7     8.5 0.00019   28.0  -0.7   22  133-154     1-28  (82)
119 PRK00398 rpoP DNA-directed RNA  36.1      19 0.00042   23.0   1.0   11  146-156     3-13  (46)
120 PLN02195 cellulose synthase A   36.0      18 0.00039   37.5   1.2   22  136-157    26-59  (977)
121 smart00647 IBR In Between Ring  35.6      29 0.00062   22.5   1.8   16  146-162    40-55  (64)
122 PF07649 C1_3:  C1-like domain;  35.6      18 0.00039   21.2   0.7   19  136-154     1-23  (30)
123 PF14353 CpXC:  CpXC protein     35.4      23  0.0005   26.9   1.5   15  142-156    34-48  (128)
124 PRK03564 formate dehydrogenase  35.3      19  0.0004   32.6   1.1   23   20-42     27-49  (309)
125 smart00834 CxxC_CXXC_SSSS Puta  35.3      20 0.00043   21.7   0.9   11  146-156     5-15  (41)
126 PF11239 DUF3040:  Protein of u  34.9      16 0.00034   26.2   0.5   18   30-47      7-24  (82)
127 TIGR01562 FdhE formate dehydro  34.3      20 0.00044   32.2   1.2   26   19-44     22-47  (305)
128 PF09855 DUF2082:  Nucleic-acid  34.1      17 0.00037   25.7   0.5   10  147-156     1-10  (64)
129 PLN02189 cellulose synthase     33.9      20 0.00044   37.4   1.2   13  145-157    75-87  (1040)
130 PF10122 Mu-like_Com:  Mu-like   33.8      19 0.00042   24.7   0.7   20  136-155     5-33  (51)
131 TIGR02300 FYDLN_acid conserved  33.4      24 0.00053   28.4   1.3   25  132-156     6-36  (129)
132 smart00531 TFIIE Transcription  33.2      21 0.00045   28.2   0.9   13  145-157    98-110 (147)
133 COG3364 Zn-ribbon containing p  33.2      20 0.00043   28.2   0.8   21  135-155     2-29  (112)
134 COG0333 RpmF Ribosomal protein  32.8      32 0.00069   24.0   1.7   20  135-154    27-48  (57)
135 PF08461 HTH_12:  Ribonuclease   32.8      41 0.00089   23.3   2.3   23   22-44     27-49  (66)
136 PLN02638 cellulose synthase A   32.2      22 0.00048   37.3   1.1   22  136-157    37-70  (1079)
137 PF14753 DUF4475:  Domain of un  32.2      24 0.00052   30.2   1.2   18  138-156   125-143 (196)
138 PLN02436 cellulose synthase A   30.9      24 0.00052   37.0   1.2   11  146-156    78-88  (1094)
139 PF13719 zinc_ribbon_5:  zinc-r  30.5      28  0.0006   21.6   1.0   10  147-156     3-12  (37)
140 cd02334 ZZ_dystrophin Zinc fin  30.4      31 0.00066   23.0   1.3   31  137-167     2-36  (49)
141 TIGR00373 conserved hypothetic  29.8      26 0.00056   28.2   0.9   10  147-156   110-119 (158)
142 PF10571 UPF0547:  Uncharacteri  29.7      30 0.00065   20.3   1.0    6  149-154    17-22  (26)
143 PF04640 PLATZ:  PLATZ transcri  29.6      25 0.00054   25.5   0.8   24  134-162    48-71  (72)
144 PF13717 zinc_ribbon_4:  zinc-r  29.5      29 0.00063   21.5   1.0   10  147-156     3-12  (36)
145 smart00291 ZnF_ZZ Zinc-binding  29.1      37  0.0008   21.6   1.4   29  136-164     5-36  (44)
146 TIGR00627 tfb4 transcription f  29.1      29 0.00062   30.8   1.2   20  137-156   257-279 (279)
147 cd02335 ZZ_ADA2 Zinc finger, Z  29.0      40 0.00086   22.0   1.6   31  137-167     2-36  (49)
148 PRK06266 transcription initiat  28.9      27 0.00058   28.8   0.9   17   28-44     51-67  (178)
149 PF05741 zf-nanos:  Nanos RNA b  28.9      28 0.00061   24.1   0.9   18  134-154    24-41  (55)
150 cd02345 ZZ_dah Zinc finger, ZZ  28.8      31 0.00068   22.7   1.1   31  137-167     2-36  (49)
151 PLN02915 cellulose synthase A   28.4      28 0.00062   36.4   1.2   22  136-157    35-68  (1044)
152 PF03604 DNA_RNApol_7kD:  DNA d  27.9      36 0.00079   20.9   1.2    9  147-155    18-26  (32)
153 PF10083 DUF2321:  Uncharacteri  27.9     9.5 0.00021   31.6  -1.9   25  131-155    24-48  (158)
154 PF00130 C1_1:  Phorbol esters/  27.8      24 0.00052   22.6   0.4   24  132-155     8-37  (53)
155 PF13465 zf-H2C2_2:  Zinc-finge  27.8      25 0.00054   20.0   0.4   11  146-156    14-24  (26)
156 KOG4850|consensus               27.5      29 0.00063   29.3   0.9   16  146-161   149-164 (190)
157 PF02132 RecR:  RecR protein;    27.2      16 0.00035   23.1  -0.5   18  134-151    16-34  (41)
158 KOG1356|consensus               27.1      30 0.00065   35.5   1.1   35  130-165   224-261 (889)
159 COG2260 Predicted Zn-ribbon RN  27.1      28 0.00061   24.6   0.6   20  136-155     6-26  (59)
160 PF14447 Prok-RING_4:  Prokaryo  26.9      35 0.00075   23.8   1.0   20  137-156    29-49  (55)
161 PRK00807 50S ribosomal protein  26.8      31 0.00068   23.2   0.8   39  136-174     2-50  (52)
162 COG4306 Uncharacterized protei  26.4      19  0.0004   29.5  -0.4   21  135-155    28-48  (160)
163 COG1998 RPS31 Ribosomal protei  26.2      40 0.00086   23.2   1.2   24  131-154    15-45  (51)
164 PF03833 PolC_DP2:  DNA polymer  25.8      23 0.00049   36.4   0.0   38  134-171   654-696 (900)
165 PLN02400 cellulose synthase     25.1      34 0.00074   35.9   1.1   11  146-156    78-88  (1085)
166 PF06677 Auto_anti-p27:  Sjogre  24.9      49  0.0011   21.4   1.4    9  145-153    33-41  (41)
167 PF06524 NOA36:  NOA36 protein;  24.8      26 0.00057   31.7   0.2   24  136-159   172-195 (314)
168 PF01412 ArfGap:  Putative GTPa  24.8      21 0.00045   27.1  -0.4   35  132-167    10-45  (116)
169 PF05129 Elf1:  Transcription e  24.7      27 0.00059   25.4   0.2   26  131-156    18-56  (81)
170 COG1885 Uncharacterized protei  24.5      36 0.00077   26.9   0.9   25  115-156    35-59  (115)
171 PF10263 SprT-like:  SprT-like   24.0      40 0.00087   25.9   1.1   10  145-154   142-151 (157)
172 TIGR00155 pqiA_fam integral me  23.7      42  0.0009   31.0   1.3   22  135-156   215-240 (403)
173 PF05715 zf-piccolo:  Piccolo Z  23.6      36 0.00079   24.2   0.7   27  114-145    14-40  (61)
174 TIGR02605 CxxC_CxxC_SSSS putat  23.5      41 0.00088   21.6   0.9   11  146-156     5-15  (52)
175 COG4391 Uncharacterized protei  23.5      73  0.0016   22.7   2.2   27  129-156    32-58  (62)
176 PF00628 PHD:  PHD-finger;  Int  23.5      42 0.00092   21.1   0.9   20  137-156     1-24  (51)
177 KOG2807|consensus               23.1      64  0.0014   30.1   2.3   32  127-158   322-357 (378)
178 KOG1802|consensus               22.9      38 0.00082   34.6   0.9   29  132-160    57-88  (935)
179 PF14392 zf-CCHC_4:  Zinc knuck  22.7      38 0.00082   22.0   0.6   12  135-146    31-42  (49)
180 PF07966 A1_Propeptide:  A1 Pro  22.7      30 0.00066   20.6   0.1   24   87-110     4-27  (29)
181 cd06970 NR_DBD_PNR DNA-binding  22.6      36 0.00078   25.3   0.5   24  133-156     4-33  (92)
182 PLN03119 putative ADP-ribosyla  22.4      48   0.001   32.9   1.4   36  132-168    20-56  (648)
183 TIGR00354 polC DNA polymerase,  21.7      44 0.00094   35.1   1.1   22  134-155   624-646 (1095)
184 PRK05978 hypothetical protein;  21.5      46 0.00099   27.1   1.0   23  134-156    32-62  (148)
185 KOG2907|consensus               21.5      43 0.00092   26.6   0.8   11  146-156   102-112 (116)
186 KOG4602|consensus               21.4      37 0.00081   30.7   0.5   16  145-160   267-290 (318)
187 TIGR00595 priA primosomal prot  21.2      45 0.00098   31.5   1.0   23  133-155   238-262 (505)
188 cd02344 ZZ_HERC2 Zinc finger,   21.2      61  0.0013   21.3   1.3   28  137-164     2-33  (45)
189 PF09723 Zn-ribbon_8:  Zinc rib  21.1      49  0.0011   20.9   0.9   11  146-156     5-15  (42)
190 cd02342 ZZ_UBA_plant Zinc fing  21.1      49  0.0011   21.9   0.9   29  137-165     2-34  (43)
191 PF02318 FYVE_2:  FYVE-type zin  20.9      50  0.0011   25.1   1.0   31  134-165    53-89  (118)
192 PF12855 Ecl1:  Life-span regul  20.6      31 0.00067   22.7  -0.2   30  136-167     7-36  (43)
193 cd06966 NR_DBD_CAR DNA-binding  20.5      44 0.00096   24.8   0.7   20  137-156     2-27  (94)
194 PRK09521 exosome complex RNA-b  20.5      62  0.0013   26.4   1.6   22  135-156   149-176 (189)
195 PF13912 zf-C2H2_6:  C2H2-type   20.5      29 0.00062   19.2  -0.3   24  147-170     2-25  (27)
196 cd02249 ZZ Zinc finger, ZZ typ  20.3      58  0.0013   20.8   1.1   28  137-164     2-32  (46)
197 PRK14714 DNA polymerase II lar  20.2      53  0.0012   35.3   1.3   22  135-156   667-689 (1337)
198 PRK13844 recombination protein  20.2      52  0.0011   28.1   1.1   23  132-154    54-77  (200)

No 1  
>KOG3362|consensus
Probab=100.00  E-value=2e-53  Score=340.32  Aligned_cols=154  Identities=51%  Similarity=0.909  Sum_probs=139.9

Q ss_pred             cccccccccccccccccccCCHHHHHHHHHHHHHhhhCCCCCCCCCccccccccCCcchhhhcccccccccccchhHHHH
Q psy2284           2 TTMANRLSGRIKDANKQRVLDEATRQRRARKALESLESDNFHDDPHADLVMNKKAPKFQETLDAKSGSRKKKSKSAEYYK   81 (175)
Q Consensus         2 ~~~~~R~s~R~k~~~~~rvlD~~~R~rr~~~rLdaLE~DN~~ddp~a~l~~~k~~pkf~d~~~~~~~~kkkk~k~~~~~k   81 (175)
                      +.|..|.|.|+++.+++|+||+++|+++.+++||+||+|||+|||||+|+|.+..|+|.+.+.++ ..+++++.++++++
T Consensus         3 ~~~e~r~s~r~~~~~~rRvlD~~ar~rr~~r~l~~Le~Dn~~ddpha~l~~~k~~p~f~d~l~~G-kr~~~~~~~~~~~~   81 (156)
T KOG3362|consen    3 HSFEERASQRIKDQEQRRVLDLNARQRRDNRNLEALEQDNFHDDPHASLVKPKQLPKFDDDLMGG-KRKKQKSYKSEKFK   81 (156)
T ss_pred             cchHHHHHHHHhhhhhccccchHHHHhhhhhhhHHHhhhccCCCcccccccccccccccHHHhcc-hhhhccccccchhh
Confidence            45678999999999999999999999999999999999999999999999999999999998754 22333445567776


Q ss_pred             hhhhhcccccccchhhhhhccccHHHHHHHhhhccCCCCCccccccCCCCCCCcccceecCCCCceecCCCCCccccccc
Q psy2284          82 LKTMEGLFHKTNQQNYIFRFRKSLAQMIEEDKALNSQGSAYENAEAKPSKFPNRHFCAVCGFPSNYTCVPCGARYCCVRC  161 (175)
Q Consensus        82 ~~~~~~~~~~~~~~~~ilr~rKnf~~lleE~~~~~~~~p~Y~~a~a~ps~~P~r~~C~VCG~~~~YtC~~Cg~ryCS~~C  161 (175)
                      +                 ++||||++||||+.+.-...|+|.++.|+|+.+|.|+||+||||||+|+|++||++|||+.|
T Consensus        82 ~-----------------~~RKnf~~~Ldea~~~~~k~~~Y~~~~a~p~~KP~r~fCaVCG~~S~ysC~~CG~kyCsv~C  144 (156)
T KOG3362|consen   82 L-----------------RFRKNFQALLDEALLNLMKNPNYHTAYAKPSFKPLRKFCAVCGYDSKYSCVNCGTKYCSVRC  144 (156)
T ss_pred             h-----------------hHHHHHHHHHHccchhhhhccchhhcccCCCCCCcchhhhhcCCCchhHHHhcCCceeechh
Confidence            5                 99999999999998744578999999999999999999999999999999999999999999


Q ss_pred             cccccccccccc
Q psy2284         162 LGTHQDTRCLKW  173 (175)
Q Consensus       162 ~~~H~etRC~K~  173 (175)
                      .++|+||||+||
T Consensus       145 ~~~HneTRC~kw  156 (156)
T KOG3362|consen  145 LKTHNETRCMKW  156 (156)
T ss_pred             hhhccccccccC
Confidence            999999999999


No 2  
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=99.22  E-value=1.3e-12  Score=79.81  Aligned_cols=30  Identities=50%  Similarity=1.326  Sum_probs=23.9

Q ss_pred             CcccceecCCCCceecCCCCCccccccccc
Q psy2284         134 NRHFCAVCGFPSNYTCVPCGARYCCVRCLG  163 (175)
Q Consensus       134 ~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~~  163 (175)
                      ++.+|+|||++++|+||+||.+|||+.|++
T Consensus         1 ~~~~C~vC~~~~kY~Cp~C~~~~CSl~C~k   30 (30)
T PF04438_consen    1 PRKLCSVCGNPAKYRCPRCGARYCSLACYK   30 (30)
T ss_dssp             --EEETSSSSEESEE-TTT--EESSHHHHH
T ss_pred             CcCCCccCcCCCEEECCCcCCceeCcEeEC
Confidence            578999999999999999999999999974


No 3  
>COG5195 Uncharacterized conserved protein [Function unknown]
Probab=97.34  E-value=0.00013  Score=56.83  Aligned_cols=57  Identities=39%  Similarity=0.598  Sum_probs=47.2

Q ss_pred             cccHHHHHHHhhhcc-CCCCCccccccCCCCCCCcccceecCCCCceecCCCCCcccc
Q psy2284         102 RKSLAQMIEEDKALN-SQGSAYENAEAKPSKFPNRHFCAVCGFPSNYTCVPCGARYCC  158 (175)
Q Consensus       102 rKnf~~lleE~~~~~-~~~p~Y~~a~a~ps~~P~r~~C~VCG~~~~YtC~~Cg~ryCS  158 (175)
                      -|++.+||..+.+++ +.--+|+.+.||||..|.-++|-|=|-++-||||.=|.||=-
T Consensus        32 ~ktlrQli~~~~i~ne~sk~~Y~sieappSv~P~~KyCDvTGL~a~Yt~P~t~lrYhn   89 (118)
T COG5195          32 FKTLRQLIPRLTIENESSKHRYLSIEAPPSVKPRMKYCDVTGLPAPYTCPNTGLRYHN   89 (118)
T ss_pred             hhhHHHHccccccccccccceeEeecCCCccccccccccccCCcccccCCCcCceecc
Confidence            456667777665543 234589999999999999999999999999999999999843


No 4  
>KOG4137|consensus
Probab=97.30  E-value=0.00026  Score=54.26  Aligned_cols=44  Identities=34%  Similarity=0.611  Sum_probs=40.1

Q ss_pred             CCCCCccccccCCCCCCCcccceecCCCCceecCCCCCcccccc
Q psy2284         117 SQGSAYENAEAKPSKFPNRHFCAVCGFPSNYTCVPCGARYCCVR  160 (175)
Q Consensus       117 ~~~p~Y~~a~a~ps~~P~r~~C~VCG~~~~YtC~~Cg~ryCS~~  160 (175)
                      ..-++|++..||||..|.-+.|-|=|-++-|+||.=|.||=+..
T Consensus        32 ~~k~tYfsi~appSv~PakKycDvTGLpapYtdP~t~Lry~nae   75 (102)
T KOG4137|consen   32 EKKHTYFSIEAPPSVKPAKKYCDVTGLPAPYTDPNTGLRYHNAE   75 (102)
T ss_pred             cccCceEEecCCCccccchhhccccCCcccccCCCccceeccHH
Confidence            45689999999999999999999999999999999999986544


No 5  
>PF01753 zf-MYND:  MYND finger;  InterPro: IPR002893 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MYND-type zinc finger domains. The MYND domain (myeloid, Nervy, and DEAF-1) is present in a large group of proteins that includes RP-8 (PDCD2), Nervy, and predicted proteins from Drosophila, mammals, Caenorhabditis elegans, yeast, and plants [, , ]. The MYND domain consists of a cluster of cysteine and histidine residues, arranged with an invariant spacing to form a potential zinc-binding motif []. Mutating conserved cysteine residues in the DEAF-1 MYND domain does not abolish DNA binding, which suggests that the MYND domain might be involved in protein-protein interactions []. Indeed, the MYND domain of ETO/MTG8 interacts directly with the N-CoR and SMRT co-repressors [, ]. Aberrant recruitment of co-repressor complexes and inappropriate transcriptional repression is believed to be a general mechanism of leukemogenesis caused by the t(8;21) translocations that fuse ETO with the acute myelogenous leukemia 1 (AML1) protein. ETO has been shown to be a co-repressor recruited by the promyelocytic leukemia zinc finger (PLZF) protein []. A divergent MYND domain present in the adenovirus E1A binding protein BS69 was also shown to interact with N-CoR and mediate transcriptional repression []. The current evidence suggests that the MYND motif in mammalian proteins constitutes a protein-protein interaction domain that functions as a co-repressor-recruiting interface. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3QWW_A 3QWV_A 3TG5_A 3S7F_A 3RIB_B 3TG4_A 3S7J_A 3S7D_A 3S7B_A 3RU0_A ....
Probab=95.59  E-value=0.0037  Score=38.78  Aligned_cols=29  Identities=38%  Similarity=0.923  Sum_probs=24.2

Q ss_pred             ceecCCCCceecCCC-CCcccccccccccc
Q psy2284         138 CAVCGFPSNYTCVPC-GARYCCVRCLGTHQ  166 (175)
Q Consensus       138 C~VCG~~~~YtC~~C-g~ryCS~~C~~~H~  166 (175)
                      |.+||..+.-.|++| ...|||..|...|.
T Consensus         1 C~~C~~~~~~~C~~C~~~~YCs~~Cq~~~w   30 (37)
T PF01753_consen    1 CAVCGKPALKRCSRCKSVYYCSEECQRADW   30 (37)
T ss_dssp             -TTTSSCSSEEETTTSSSEESSHHHHHHHH
T ss_pred             CcCCCCCcCCcCCCCCCEEecCHHHHHHHH
Confidence            788998776699999 66899999998775


No 6  
>KOG1710|consensus
Probab=94.41  E-value=0.0072  Score=54.90  Aligned_cols=35  Identities=31%  Similarity=0.821  Sum_probs=29.4

Q ss_pred             CCcccceecCCCC-ceecCCCC-Cccccccccccccc
Q psy2284         133 PNRHFCAVCGFPS-NYTCVPCG-ARYCCVRCLGTHQD  167 (175)
Q Consensus       133 P~r~~C~VCG~~~-~YtC~~Cg-~ryCS~~C~~~H~e  167 (175)
                      ..-.||++||-+| +-+|..|- .-||+..|.+.|.-
T Consensus       317 ~d~~fCstCG~~ga~KrCs~CKav~YCdqeCQk~hWf  353 (396)
T KOG1710|consen  317 ADCQFCSTCGHPGAKKRCSQCKAVAYCDQECQKFHWF  353 (396)
T ss_pred             EecccccccCCCCccchhhhhHHHHHHHHHHHHhhhH
Confidence            3457999999776 66699998 78999999999964


No 7  
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=93.28  E-value=0.045  Score=37.98  Aligned_cols=27  Identities=30%  Similarity=0.759  Sum_probs=22.2

Q ss_pred             cceecCC----CCceecCCCCCc-cccccccc
Q psy2284         137 FCAVCGF----PSNYTCVPCGAR-YCCVRCLG  163 (175)
Q Consensus       137 ~C~VCG~----~~~YtC~~Cg~r-yCS~~C~~  163 (175)
                      +|.||+.    ...|.||.||.+ |||..-..
T Consensus         1 ~Cpv~~~~~~~~v~~~Cp~cGipthcS~ehw~   32 (55)
T PF13824_consen    1 LCPVCKKDLPAHVNFECPDCGIPTHCSEEHWE   32 (55)
T ss_pred             CCCCCccccccccCCcCCCCCCcCccCHHHHH
Confidence            6899998    889999999997 58876543


No 8  
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.41  E-value=0.061  Score=32.91  Aligned_cols=20  Identities=40%  Similarity=1.090  Sum_probs=15.9

Q ss_pred             ccceecCCC-----CceecCCCCCc
Q psy2284         136 HFCAVCGFP-----SNYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG~~-----~~YtC~~Cg~r  155 (175)
                      ..|.||||.     ....||.||..
T Consensus         2 ~~C~~CGy~y~~~~~~~~CP~Cg~~   26 (33)
T cd00350           2 YVCPVCGYIYDGEEAPWVCPVCGAP   26 (33)
T ss_pred             EECCCCCCEECCCcCCCcCcCCCCc
Confidence            579999954     46789999974


No 9  
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=86.85  E-value=0.29  Score=30.36  Aligned_cols=20  Identities=40%  Similarity=0.978  Sum_probs=15.3

Q ss_pred             ccceecCCC--C---ceecCCCCCc
Q psy2284         136 HFCAVCGFP--S---NYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG~~--~---~YtC~~Cg~r  155 (175)
                      ..|.||||.  +   ...||.||..
T Consensus         3 ~~C~~CG~i~~g~~~p~~CP~Cg~~   27 (34)
T cd00729           3 WVCPVCGYIHEGEEAPEKCPICGAP   27 (34)
T ss_pred             EECCCCCCEeECCcCCCcCcCCCCc
Confidence            579999954  3   3689999974


No 10 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=83.33  E-value=0.66  Score=31.28  Aligned_cols=10  Identities=40%  Similarity=1.122  Sum_probs=7.0

Q ss_pred             ceecCCCCCc
Q psy2284         146 NYTCVPCGAR  155 (175)
Q Consensus       146 ~YtC~~Cg~r  155 (175)
                      .++||.||..
T Consensus        34 ~w~CP~C~a~   43 (50)
T cd00730          34 DWVCPVCGAG   43 (50)
T ss_pred             CCCCCCCCCc
Confidence            5678888763


No 11 
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=83.25  E-value=0.62  Score=39.47  Aligned_cols=58  Identities=22%  Similarity=0.247  Sum_probs=40.0

Q ss_pred             HHHHHHHhhhccCCCCCcccc--ccCCCCCCCcccceecC--CCCceecCCCCCcccccccccc
Q psy2284         105 LAQMIEEDKALNSQGSAYENA--EAKPSKFPNRHFCAVCG--FPSNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       105 f~~lleE~~~~~~~~p~Y~~a--~a~ps~~P~r~~C~VCG--~~~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      ...+++|+..  +.-|.-.+.  ++.-+.-+.--+|.||-  .|-.-+||+||..-=++.|.-+
T Consensus       132 v~~Wf~EeEv--yGmpKi~~iika~tLsk~~hcilCtvCe~r~w~g~~CPKCGr~G~pi~CGmt  193 (200)
T PF12387_consen  132 VASWFGEEEV--YGMPKIITIIKAATLSKSKHCILCTVCEGREWKGGNCPKCGRHGKPITCGMT  193 (200)
T ss_pred             HHHHcccccc--cCcchhhhhhhHHhccCCCceEEEeeeecCccCCCCCCcccCCCCCeecccC
Confidence            3467888765  344433332  34556666677999998  8888999999998777777533


No 12 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=83.19  E-value=0.5  Score=31.51  Aligned_cols=12  Identities=42%  Similarity=1.162  Sum_probs=5.8

Q ss_pred             CCceecCCCCCc
Q psy2284         144 PSNYTCVPCGAR  155 (175)
Q Consensus       144 ~~~YtC~~Cg~r  155 (175)
                      +..|+||.||+.
T Consensus        32 p~~w~CP~C~a~   43 (47)
T PF00301_consen   32 PDDWVCPVCGAP   43 (47)
T ss_dssp             -TT-B-TTTSSB
T ss_pred             CCCCcCcCCCCc
Confidence            345677777753


No 13 
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional
Probab=82.81  E-value=0.54  Score=43.79  Aligned_cols=34  Identities=26%  Similarity=0.638  Sum_probs=29.5

Q ss_pred             CCcccceecCCCCceecCCCCCcccccccccccc
Q psy2284         133 PNRHFCAVCGFPSNYTCVPCGARYCCVRCLGTHQ  166 (175)
Q Consensus       133 P~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~H~  166 (175)
                      |.-..|-|||--|.|-|-.=....||++|...|-
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   59 (518)
T PLN00206         26 PGEPKCVVCGRYGEYICDETDDDICSLECKQALL   59 (518)
T ss_pred             CCCceEEEecCccceeccCCCCccccHHHHHHHH
Confidence            3334599999999999999999999999998875


No 14 
>PRK00420 hypothetical protein; Validated
Probab=81.04  E-value=0.94  Score=35.34  Aligned_cols=21  Identities=33%  Similarity=0.855  Sum_probs=16.6

Q ss_pred             ccceecCC------CCceecCCCCCcc
Q psy2284         136 HFCAVCGF------PSNYTCVPCGARY  156 (175)
Q Consensus       136 ~~C~VCG~------~~~YtC~~Cg~ry  156 (175)
                      .-|.+||+      .|.+-||.||..+
T Consensus        24 ~~CP~Cg~pLf~lk~g~~~Cp~Cg~~~   50 (112)
T PRK00420         24 KHCPVCGLPLFELKDGEVVCPVHGKVY   50 (112)
T ss_pred             CCCCCCCCcceecCCCceECCCCCCee
Confidence            56999993      4678899999854


No 15 
>TIGR02487 NrdD anaerobic ribonucleoside-triphosphate reductase. This model represents the oxygen-sensitive (anaerobic, class III) ribonucleotide reductase. The mechanism of the enzyme involves a glycine-centered radical, a C-terminal zinc binding site, and a set of conserved active site cysteines and asparagines. This enzyme requires an activating component, NrdG, a radical-SAM domain containing enzyme (TIGR02491). Together the two form an alpha-2/beta-2 heterodimer.
Probab=80.90  E-value=0.86  Score=43.74  Aligned_cols=25  Identities=28%  Similarity=0.776  Sum_probs=20.8

Q ss_pred             CCCCcccceecCCCCce---ecCCCCCc
Q psy2284         131 KFPNRHFCAVCGFPSNY---TCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~~Y---tC~~Cg~r  155 (175)
                      ..|+...|..|||.+..   .||.||..
T Consensus       520 ~n~~~~~C~~CG~~g~~~~~~CP~Cgs~  547 (579)
T TIGR02487       520 INPPVDVCEDCGYTGEGLNDKCPKCGSH  547 (579)
T ss_pred             eccCCccCCCCCCCCCCCCCcCcCCCCc
Confidence            35778899999998865   79999965


No 16 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=80.37  E-value=0.8  Score=26.57  Aligned_cols=20  Identities=40%  Similarity=1.047  Sum_probs=13.6

Q ss_pred             ccceecCC--CCcee-cCCCCCc
Q psy2284         136 HFCAVCGF--PSNYT-CVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG~--~~~Yt-C~~Cg~r  155 (175)
                      .+|.-||.  ....+ |+.||.+
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~~   25 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGAK   25 (26)
T ss_pred             CCCcccCCcCCcccccChhhCCC
Confidence            57888883  33444 8888875


No 17 
>PRK14704 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=79.29  E-value=0.94  Score=44.07  Aligned_cols=24  Identities=21%  Similarity=0.551  Sum_probs=20.5

Q ss_pred             CCCCcccceecCCCCc--eecCCCCC
Q psy2284         131 KFPNRHFCAVCGFPSN--YTCVPCGA  154 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~~--YtC~~Cg~  154 (175)
                      ..|+...|-.|||.+.  ++||.||.
T Consensus       555 in~~~~~C~~CGy~g~~~~~CP~CG~  580 (618)
T PRK14704        555 INHPVDRCKCCSYHGVIGNECPSCGN  580 (618)
T ss_pred             eCCCCeecCCCCCCCCcCccCcCCCC
Confidence            4688889999999875  68999995


No 18 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=78.60  E-value=0.86  Score=27.42  Aligned_cols=21  Identities=38%  Similarity=1.088  Sum_probs=11.1

Q ss_pred             cccceecCCCC-------ceecCCCCCc
Q psy2284         135 RHFCAVCGFPS-------NYTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG~~~-------~YtC~~Cg~r  155 (175)
                      -.||+.||.+-       .-.|+.||..
T Consensus         3 ~rfC~~CG~~t~~~~~g~~r~C~~Cg~~   30 (32)
T PF09297_consen    3 HRFCGRCGAPTKPAPGGWARRCPSCGHE   30 (32)
T ss_dssp             TSB-TTT--BEEE-SSSS-EEESSSS-E
T ss_pred             CcccCcCCccccCCCCcCEeECCCCcCE
Confidence            36999999432       2348888864


No 19 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=78.49  E-value=0.87  Score=35.95  Aligned_cols=12  Identities=25%  Similarity=0.448  Sum_probs=10.4

Q ss_pred             CCCCcccceecC
Q psy2284         131 KFPNRHFCAVCG  142 (175)
Q Consensus       131 ~~P~r~~C~VCG  142 (175)
                      ..|.+..|..||
T Consensus        66 ~~p~~~~C~~CG   77 (135)
T PRK03824         66 EEEAVLKCRNCG   77 (135)
T ss_pred             ecceEEECCCCC
Confidence            467889999999


No 20 
>PRK01343 zinc-binding protein; Provisional
Probab=77.93  E-value=1.5  Score=30.67  Aligned_cols=28  Identities=29%  Similarity=0.654  Sum_probs=20.0

Q ss_pred             CcccceecCCCCceecCCCCCccccccccccc
Q psy2284         134 NRHFCAVCGFPSNYTCVPCGARYCCVRCLGTH  165 (175)
Q Consensus       134 ~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~H  165 (175)
                      +.+.|-|||.+....    ..+|||.+|..+.
T Consensus         8 p~~~CP~C~k~~~~~----~rPFCS~RC~~iD   35 (57)
T PRK01343          8 PTRPCPECGKPSTRE----AYPFCSERCRDID   35 (57)
T ss_pred             CCCcCCCCCCcCcCC----CCcccCHHHhhhh
Confidence            457899999655421    3489999997653


No 21 
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=76.57  E-value=1.7  Score=27.76  Aligned_cols=23  Identities=35%  Similarity=0.940  Sum_probs=19.5

Q ss_pred             cceecC-CCCceecCCCCCccccc
Q psy2284         137 FCAVCG-FPSNYTCVPCGARYCCV  159 (175)
Q Consensus       137 ~C~VCG-~~~~YtC~~Cg~ryCS~  159 (175)
                      .|++|+ ....|.|..|+.-+|..
T Consensus         1 ~C~~C~~~~~l~~CL~C~~~~c~~   24 (50)
T smart00290        1 RCSVCGTIENLWLCLTCGQVGCGR   24 (50)
T ss_pred             CcccCCCcCCeEEecCCCCcccCC
Confidence            499999 55699999999999864


No 22 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=76.57  E-value=1.4  Score=33.71  Aligned_cols=25  Identities=20%  Similarity=0.509  Sum_probs=19.2

Q ss_pred             CCCCcccceecCC-C----CceecCCCCCc
Q psy2284         131 KFPNRHFCAVCGF-P----SNYTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~-~----~~YtC~~Cg~r  155 (175)
                      ..|.+-.|..||. +    ..+.||.||..
T Consensus        66 ~vp~~~~C~~Cg~~~~~~~~~~~CP~Cgs~   95 (113)
T PRK12380         66 YKPAQAWCWDCSQVVEIHQHDAQCPHCHGE   95 (113)
T ss_pred             eeCcEEEcccCCCEEecCCcCccCcCCCCC
Confidence            4788999999993 2    23569999965


No 23 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=76.25  E-value=1.6  Score=28.07  Aligned_cols=19  Identities=42%  Similarity=1.308  Sum_probs=13.0

Q ss_pred             ccceecC---CCC------ceecCCCCC
Q psy2284         136 HFCAVCG---FPS------NYTCVPCGA  154 (175)
Q Consensus       136 ~~C~VCG---~~~------~YtC~~Cg~  154 (175)
                      +||.-||   +..      .|.|+.||-
T Consensus         1 ~FCp~Cg~~l~~~~~~~~~~~vC~~Cg~   28 (52)
T smart00661        1 KFCPKCGNMLIPKEGKEKRRFVCRKCGY   28 (52)
T ss_pred             CCCCCCCCccccccCCCCCEEECCcCCC
Confidence            4788888   222      477888885


No 24 
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=76.16  E-value=1.4  Score=43.66  Aligned_cols=24  Identities=29%  Similarity=0.708  Sum_probs=20.0

Q ss_pred             CCCCcccceecCCCC--ceecCCCCC
Q psy2284         131 KFPNRHFCAVCGFPS--NYTCVPCGA  154 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~--~YtC~~Cg~  154 (175)
                      ..|+..+|.+|||.+  .+.||.||.
T Consensus       676 in~~~~~C~~CG~~~~~~~~CP~CG~  701 (735)
T PRK07111        676 INHPVDRCPVCGYLGVIEDKCPKCGS  701 (735)
T ss_pred             eCCCCeecCCCCCCCCcCccCcCCCC
Confidence            468888999999866  468999995


No 25 
>PHA00626 hypothetical protein
Probab=76.08  E-value=1.7  Score=30.67  Aligned_cols=21  Identities=24%  Similarity=0.268  Sum_probs=16.4

Q ss_pred             ccceecCCCC-ceecCCCCCcc
Q psy2284         136 HFCAVCGFPS-NYTCVPCGARY  156 (175)
Q Consensus       136 ~~C~VCG~~~-~YtC~~Cg~ry  156 (175)
                      ..|.+|-.|+ .|.|+.||-.|
T Consensus        12 vrcg~cr~~snrYkCkdCGY~f   33 (59)
T PHA00626         12 AKEKTMRGWSDDYVCCDCGYND   33 (59)
T ss_pred             eeeceecccCcceEcCCCCCee
Confidence            4677777654 89999999876


No 26 
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=75.21  E-value=1.5  Score=43.29  Aligned_cols=24  Identities=33%  Similarity=0.822  Sum_probs=19.1

Q ss_pred             CCCcccceecCCCCc-------eecCCCCCc
Q psy2284         132 FPNRHFCAVCGFPSN-------YTCVPCGAR  155 (175)
Q Consensus       132 ~P~r~~C~VCG~~~~-------YtC~~Cg~r  155 (175)
                      -|+..+|-+|||.|.       +.||.||..
T Consensus       638 n~~~~~C~~CG~~Ge~~~~~~~~~CP~CG~~  668 (711)
T PRK09263        638 NTPIDECYECGFTGEFECTEKGFTCPKCGNH  668 (711)
T ss_pred             CCCCcccCCCCCCccccCCCCCCcCcCCCCC
Confidence            367789999999753       589999953


No 27 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=74.58  E-value=0.51  Score=31.20  Aligned_cols=30  Identities=33%  Similarity=0.832  Sum_probs=17.8

Q ss_pred             CcccceecCCCC--ceecCCC--CCccccccccc
Q psy2284         134 NRHFCAVCGFPS--NYTCVPC--GARYCCVRCLG  163 (175)
Q Consensus       134 ~r~~C~VCG~~~--~YtC~~C--g~ryCS~~C~~  163 (175)
                      |.++|.|||-+-  .-+=-+|  ...|||-.|..
T Consensus         7 p~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR~   40 (42)
T PF10013_consen    7 PSKICPVCGRPFTWRKKWARCWDEVKYCSDRCRR   40 (42)
T ss_pred             CCCcCcccCCcchHHHHHHHhchhhccHHHHhcc
Confidence            347888888322  2222344  45799999853


No 28 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=74.40  E-value=2.1  Score=25.15  Aligned_cols=11  Identities=27%  Similarity=0.854  Sum_probs=8.7

Q ss_pred             CCceecCCCCC
Q psy2284         144 PSNYTCVPCGA  154 (175)
Q Consensus       144 ~~~YtC~~Cg~  154 (175)
                      -..|.||.||.
T Consensus        14 ~v~f~CPnCG~   24 (24)
T PF07754_consen   14 AVPFPCPNCGF   24 (24)
T ss_pred             CceEeCCCCCC
Confidence            44799999984


No 29 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=73.61  E-value=2.3  Score=35.29  Aligned_cols=24  Identities=25%  Similarity=0.753  Sum_probs=19.1

Q ss_pred             CCCCcccceecCCC--CceecCCCCC
Q psy2284         131 KFPNRHFCAVCGFP--SNYTCVPCGA  154 (175)
Q Consensus       131 ~~P~r~~C~VCG~~--~~YtC~~Cg~  154 (175)
                      ..+.-..|++||++  ..+.|+.||.
T Consensus       305 ~~~tS~~C~~cg~~~~r~~~C~~cg~  330 (364)
T COG0675         305 PYYTSKTCPCCGHLSGRLFKCPRCGF  330 (364)
T ss_pred             CCCCcccccccCCccceeEECCCCCC
Confidence            45666899999964  3688999997


No 30 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=73.02  E-value=1.7  Score=33.41  Aligned_cols=25  Identities=16%  Similarity=0.517  Sum_probs=18.7

Q ss_pred             CCCCcccceecC--CCC---c-eecCCCCCc
Q psy2284         131 KFPNRHFCAVCG--FPS---N-YTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG--~~~---~-YtC~~Cg~r  155 (175)
                      ..|.+-.|.-||  ++.   . +.||.||..
T Consensus        66 ~~p~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         66 EQEAECWCETCQQYVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             eeCcEEEcccCCCeeecCCccCCcCcCcCCC
Confidence            468899999999  322   1 449999965


No 31 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=71.07  E-value=1.9  Score=33.51  Aligned_cols=24  Identities=29%  Similarity=0.794  Sum_probs=17.8

Q ss_pred             CCCCcccceecCCC------C------ceecCCCCCc
Q psy2284         131 KFPNRHFCAVCGFP------S------NYTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~~------~------~YtC~~Cg~r  155 (175)
                      ..|.+-.| -||..      .      .+.||.||..
T Consensus        66 ~vp~~~~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs~  101 (124)
T PRK00762         66 MIPVEIEC-ECGYEGVVDEDEIDHYAAVIECPVCGNK  101 (124)
T ss_pred             ecCeeEEe-eCcCcccccccchhccccCCcCcCCCCC
Confidence            46888999 99933      1      1579999953


No 32 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=71.01  E-value=2.9  Score=26.61  Aligned_cols=22  Identities=27%  Similarity=0.892  Sum_probs=17.7

Q ss_pred             ceecC-CCC--ceecCCCCCccccc
Q psy2284         138 CAVCG-FPS--NYTCVPCGARYCCV  159 (175)
Q Consensus       138 C~VCG-~~~--~YtC~~Cg~ryCS~  159 (175)
                      |.+|+ .++  .++|..|+..||+.
T Consensus         1 C~~C~~~~~l~~f~C~~C~~~FC~~   25 (39)
T smart00154        1 CHFCRKKVGLTGFKCRHCGNLFCGE   25 (39)
T ss_pred             CcccCCcccccCeECCccCCccccc
Confidence            77888 333  68899999999985


No 33 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=70.98  E-value=1.1  Score=34.23  Aligned_cols=26  Identities=31%  Similarity=0.834  Sum_probs=16.3

Q ss_pred             CCCCcccceecCCCC-----ceecCCCCCcc
Q psy2284         131 KFPNRHFCAVCGFPS-----NYTCVPCGARY  156 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~-----~YtC~~Cg~ry  156 (175)
                      ..|.+..|..||+..     .+.||.||...
T Consensus        66 ~~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (113)
T PF01155_consen   66 EVPARARCRDCGHEFEPDEFDFSCPRCGSPD   96 (113)
T ss_dssp             EE--EEEETTTS-EEECHHCCHH-SSSSSS-
T ss_pred             ecCCcEECCCCCCEEecCCCCCCCcCCcCCC
Confidence            468889999999332     35699999863


No 34 
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=70.48  E-value=1.4  Score=30.64  Aligned_cols=10  Identities=30%  Similarity=0.766  Sum_probs=8.0

Q ss_pred             cccccccccc
Q psy2284         155 RYCCVRCLGT  164 (175)
Q Consensus       155 ryCS~~C~~~  164 (175)
                      +|||.+|..+
T Consensus        22 PFCS~RCk~i   31 (57)
T PF03884_consen   22 PFCSERCKLI   31 (57)
T ss_dssp             SSSSHHHHHH
T ss_pred             CcccHhhccc
Confidence            5899999754


No 35 
>PF08265 YL1_C:  YL1 nuclear protein C-terminal domain;  InterPro: IPR013272 This domain is found at the C terminus in proteins of the YL1 family []. These proteins have been shown to be DNA-binding and may be transcription factors []. This domain is also found in proteins that do not belong to the YL1 family.
Probab=70.36  E-value=2.6  Score=25.83  Aligned_cols=28  Identities=21%  Similarity=0.577  Sum_probs=24.6

Q ss_pred             ccceecCCCCceecCCCCCccccccccc
Q psy2284         136 HFCAVCGFPSNYTCVPCGARYCCVRCLG  163 (175)
Q Consensus       136 ~~C~VCG~~~~YtC~~Cg~ryCS~~C~~  163 (175)
                      ++|.|=|.+++|+.|.=|.+|-++.-++
T Consensus         1 k~C~iTglpA~Y~DP~T~l~Y~n~~ayk   28 (30)
T PF08265_consen    1 KYCDITGLPARYRDPKTGLPYANSEAYK   28 (30)
T ss_pred             CcccccCCCccccCCCCCCcccCHHHhh
Confidence            5799999999999999999998876554


No 36 
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=69.91  E-value=2.4  Score=41.14  Aligned_cols=24  Identities=21%  Similarity=0.468  Sum_probs=19.1

Q ss_pred             CCCcccceecCCC-Cc--eecCCCCCc
Q psy2284         132 FPNRHFCAVCGFP-SN--YTCVPCGAR  155 (175)
Q Consensus       132 ~P~r~~C~VCG~~-~~--YtC~~Cg~r  155 (175)
                      -|+-.+|.+|||. +.  +.||.||..
T Consensus       529 n~~~siC~~CGy~~g~~~~~CP~CGs~  555 (586)
T TIGR02827       529 NIKITICNDCHHIDKRTLHRCPVCGSA  555 (586)
T ss_pred             CCCCeecCCCCCcCCCcCCcCcCCCCc
Confidence            4677899999984 52  789999953


No 37 
>PRK12496 hypothetical protein; Provisional
Probab=69.19  E-value=2.4  Score=34.48  Aligned_cols=21  Identities=38%  Similarity=1.140  Sum_probs=16.3

Q ss_pred             cccceecC--CCCcee---cCCCCCc
Q psy2284         135 RHFCAVCG--FPSNYT---CVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG--~~~~Yt---C~~Cg~r  155 (175)
                      +..|.-||  |+..|.   ||.||.+
T Consensus       127 ~~~C~gC~~~~~~~~~~~~C~~CG~~  152 (164)
T PRK12496        127 RKVCKGCKKKYPEDYPDDVCEICGSP  152 (164)
T ss_pred             eEECCCCCccccCCCCCCcCCCCCCh
Confidence            36799999  765554   9999975


No 38 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=69.13  E-value=3.1  Score=27.89  Aligned_cols=27  Identities=26%  Similarity=0.618  Sum_probs=20.4

Q ss_pred             CCCCcccceecCC------CCceecCCCCCccc
Q psy2284         131 KFPNRHFCAVCGF------PSNYTCVPCGARYC  157 (175)
Q Consensus       131 ~~P~r~~C~VCG~------~~~YtC~~Cg~ryC  157 (175)
                      ..+.+.||..||.      ...+.|.+||..+-
T Consensus        16 v~~~~~fCP~Cg~~~m~~~~~r~~C~~Cgyt~~   48 (50)
T PRK00432         16 VKRKNKFCPRCGSGFMAEHLDRWHCGKCGYTEF   48 (50)
T ss_pred             EEEccCcCcCCCcchheccCCcEECCCcCCEEe
Confidence            3466789999996      33788999997653


No 39 
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=69.05  E-value=2.9  Score=39.07  Aligned_cols=29  Identities=24%  Similarity=0.695  Sum_probs=21.9

Q ss_pred             cCCCCCCCcccceecC--CCC--------------------ceecCCCCCc
Q psy2284         127 AKPSKFPNRHFCAVCG--FPS--------------------NYTCVPCGAR  155 (175)
Q Consensus       127 a~ps~~P~r~~C~VCG--~~~--------------------~YtC~~Cg~r  155 (175)
                      ..|+....+..|.+||  |-.                    .++||.||..
T Consensus       417 ~~~~~~~~~~~c~~c~~~yd~~~g~~~~~~~~gt~~~~lp~~~~cp~c~~~  467 (479)
T PRK05452        417 TTTADLGPRMQCSVCQWIYDPAKGEPMQDVAPGTPWSEVPDNFLCPECSLG  467 (479)
T ss_pred             ccccCCCCeEEECCCCeEECCCCCCcccCCCCCCChhhCCCCCcCcCCCCc
Confidence            3455577788999999  443                    5899999974


No 40 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=68.96  E-value=3.2  Score=28.33  Aligned_cols=23  Identities=30%  Similarity=0.719  Sum_probs=17.7

Q ss_pred             CCCcccceecC--CCCceecCCCCC
Q psy2284         132 FPNRHFCAVCG--FPSNYTCVPCGA  154 (175)
Q Consensus       132 ~P~r~~C~VCG--~~~~YtC~~Cg~  154 (175)
                      .|....|..||  ..+..-|+.||.
T Consensus        23 ~p~l~~C~~cG~~~~~H~vc~~cG~   47 (55)
T TIGR01031        23 APTLVVCPNCGEFKLPHRVCPSCGY   47 (55)
T ss_pred             CCcceECCCCCCcccCeeECCccCe
Confidence            35667899999  556777999994


No 41 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=68.62  E-value=2.2  Score=29.59  Aligned_cols=23  Identities=26%  Similarity=0.699  Sum_probs=18.4

Q ss_pred             cccceecC-CCCceecCCCCCccc
Q psy2284         135 RHFCAVCG-FPSNYTCVPCGARYC  157 (175)
Q Consensus       135 r~~C~VCG-~~~~YtC~~Cg~ryC  157 (175)
                      .+.|..|| |--+..||.||..+-
T Consensus         5 mr~C~~CgvYTLk~~CP~CG~~t~   28 (56)
T PRK13130          5 IRKCPKCGVYTLKEICPVCGGKTK   28 (56)
T ss_pred             ceECCCCCCEEccccCcCCCCCCC
Confidence            46799999 666888999998653


No 42 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=67.78  E-value=4.4  Score=32.38  Aligned_cols=29  Identities=24%  Similarity=0.698  Sum_probs=23.8

Q ss_pred             CCCCCCCcccceecC--CCCceecCCCCCcc
Q psy2284         128 KPSKFPNRHFCAVCG--FPSNYTCVPCGARY  156 (175)
Q Consensus       128 ~ps~~P~r~~C~VCG--~~~~YtC~~Cg~ry  156 (175)
                      +|...+...+|.-||  |.|.=-|+.|+.-.
T Consensus        90 ~pv~~~~~W~Cv~C~~~Y~GeK~C~~C~tGi  120 (128)
T PF11682_consen   90 DPVPRKTDWHCVMCGNHYHGEKYCPKCGTGI  120 (128)
T ss_pred             CCCCcCceEEEecCCCccCcCEecCCCCCcc
Confidence            444478888999999  89987799999854


No 43 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=67.37  E-value=2.1  Score=30.17  Aligned_cols=9  Identities=56%  Similarity=1.268  Sum_probs=6.5

Q ss_pred             ceecCCCCC
Q psy2284         146 NYTCVPCGA  154 (175)
Q Consensus       146 ~YtC~~Cg~  154 (175)
                      .|+||.||-
T Consensus        48 ~Y~CP~CGF   56 (59)
T PRK14890         48 PYTCPKCGF   56 (59)
T ss_pred             ceECCCCCC
Confidence            677777774


No 44 
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=67.12  E-value=2.2  Score=30.63  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=9.0

Q ss_pred             ccccccccccc
Q psy2284         155 RYCCVRCLGTH  165 (175)
Q Consensus       155 ryCS~~C~~~H  165 (175)
                      +|||.+|..+.
T Consensus        27 PFCSkRCklID   37 (65)
T COG3024          27 PFCSKRCKLID   37 (65)
T ss_pred             cchhHhhhhcc
Confidence            68999998764


No 45 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=67.12  E-value=2.6  Score=32.32  Aligned_cols=26  Identities=27%  Similarity=0.461  Sum_probs=19.1

Q ss_pred             CCCCcccceecCC-CC----ceecCCCCCcc
Q psy2284         131 KFPNRHFCAVCGF-PS----NYTCVPCGARY  156 (175)
Q Consensus       131 ~~P~r~~C~VCG~-~~----~YtC~~Cg~ry  156 (175)
                      ..|.+-.|..||. ++    .+.||.||..-
T Consensus        66 ~~p~~~~C~~Cg~~~~~~~~~~~CP~Cgs~~   96 (115)
T TIGR00100        66 DEPVECECEDCSEEVSPEIDLYRCPKCHGIM   96 (115)
T ss_pred             eeCcEEEcccCCCEEecCCcCccCcCCcCCC
Confidence            4678899999992 21    34599999753


No 46 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=67.06  E-value=3.5  Score=28.51  Aligned_cols=22  Identities=45%  Similarity=1.004  Sum_probs=16.7

Q ss_pred             cccceecC--C--CC-ceecCCCCCcc
Q psy2284         135 RHFCAVCG--F--PS-NYTCVPCGARY  156 (175)
Q Consensus       135 r~~C~VCG--~--~~-~YtC~~Cg~ry  156 (175)
                      ...|.+||  +  .. ...||-||++|
T Consensus         5 ~~~C~~Cg~~~~~~dDiVvCp~Cgapy   31 (54)
T PF14446_consen    5 GCKCPVCGKKFKDGDDIVVCPECGAPY   31 (54)
T ss_pred             CccChhhCCcccCCCCEEECCCCCCcc
Confidence            35799999  3  22 56699999987


No 47 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=66.76  E-value=2.7  Score=23.99  Aligned_cols=19  Identities=32%  Similarity=0.920  Sum_probs=10.4

Q ss_pred             cceecCC--C-CceecCCCCCc
Q psy2284         137 FCAVCGF--P-SNYTCVPCGAR  155 (175)
Q Consensus       137 ~C~VCG~--~-~~YtC~~Cg~r  155 (175)
                      +|.-||.  . ..--|+.||..
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCCc
Confidence            4667772  1 22237777764


No 48 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=66.71  E-value=2.9  Score=32.19  Aligned_cols=25  Identities=20%  Similarity=0.490  Sum_probs=18.8

Q ss_pred             CCCCcccceecC-CCC----cee-cCCCCCc
Q psy2284         131 KFPNRHFCAVCG-FPS----NYT-CVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG-~~~----~Yt-C~~Cg~r  155 (175)
                      ..|.+-+|..|| .+.    .|. ||.||.+
T Consensus        67 ~vp~~~~C~~Cg~~~~~~~~~~~~CP~Cgs~   97 (117)
T PRK00564         67 DEKVELECKDCSHVFKPNALDYGVCEKCHSK   97 (117)
T ss_pred             ecCCEEEhhhCCCccccCCccCCcCcCCCCC
Confidence            468899999999 332    243 9999975


No 49 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=66.44  E-value=3.3  Score=28.18  Aligned_cols=22  Identities=32%  Similarity=0.871  Sum_probs=15.9

Q ss_pred             CcccceecCCCC-------ceecCCCCCc
Q psy2284         134 NRHFCAVCGFPS-------NYTCVPCGAR  155 (175)
Q Consensus       134 ~r~~C~VCG~~~-------~YtC~~Cg~r  155 (175)
                      .-..|++||...       .+.|+.||..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~   55 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFE   55 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCE
Confidence            456799999433       3679999875


No 50 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=66.19  E-value=2  Score=26.38  Aligned_cols=18  Identities=44%  Similarity=1.163  Sum_probs=9.5

Q ss_pred             cceecC---CCCceecCCCCC
Q psy2284         137 FCAVCG---FPSNYTCVPCGA  154 (175)
Q Consensus       137 ~C~VCG---~~~~YtC~~Cg~  154 (175)
                      .|.-||   |+....|+.||.
T Consensus        13 rC~~Cg~~~~pPr~~Cp~C~s   33 (37)
T PF12172_consen   13 RCRDCGRVQFPPRPVCPHCGS   33 (37)
T ss_dssp             E-TTT--EEES--SEETTTT-
T ss_pred             EcCCCCCEecCCCcCCCCcCc
Confidence            577777   566777888864


No 51 
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=65.15  E-value=3.8  Score=25.21  Aligned_cols=22  Identities=23%  Similarity=0.519  Sum_probs=16.1

Q ss_pred             CCcccceecC--CCC---ceecCCCCC
Q psy2284         133 PNRHFCAVCG--FPS---NYTCVPCGA  154 (175)
Q Consensus       133 P~r~~C~VCG--~~~---~YtC~~Cg~  154 (175)
                      ....+|.+|+  .|+   .|.|..|+.
T Consensus         9 ~~~~~C~~C~~~i~~~~~~~~C~~C~~   35 (49)
T smart00109        9 KKPTKCCVCRKSIWGSFQGLRCSWCKV   35 (49)
T ss_pred             CCCCCccccccccCcCCCCcCCCCCCc
Confidence            4456899998  554   688888865


No 52 
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=65.13  E-value=4.1  Score=28.87  Aligned_cols=32  Identities=22%  Similarity=0.463  Sum_probs=19.4

Q ss_pred             CCcccceecCCCCceecCCCCCcccccccccc
Q psy2284         133 PNRHFCAVCGFPSNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       133 P~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      +....|-+||....+.=..=..+|||.+|..+
T Consensus         4 ~~~v~CP~C~k~~~w~~~~~~rPFCS~RCk~I   35 (62)
T PRK00418          4 TITVNCPTCGKPVEWGEISPFRPFCSKRCQLI   35 (62)
T ss_pred             CccccCCCCCCcccccCCCCcCCcccHHHHhh
Confidence            44567888886543321112347899999765


No 53 
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=64.64  E-value=3.6  Score=40.29  Aligned_cols=24  Identities=21%  Similarity=0.480  Sum_probs=19.3

Q ss_pred             CCCcccceecCCC--C-ceecCCCCCc
Q psy2284         132 FPNRHFCAVCGFP--S-NYTCVPCGAR  155 (175)
Q Consensus       132 ~P~r~~C~VCG~~--~-~YtC~~Cg~r  155 (175)
                      -|+...|.+|||.  + .+.||.||..
T Consensus       563 n~~~~iC~~CG~~~~g~~~~CP~CGs~  589 (623)
T PRK08271        563 NVKITICNDCHHIDKRTGKRCPICGSE  589 (623)
T ss_pred             CCCCccCCCCCCcCCCCCcCCcCCCCc
Confidence            4677899999985  3 6779999964


No 54 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=63.61  E-value=3.2  Score=32.04  Aligned_cols=24  Identities=29%  Similarity=0.902  Sum_probs=12.2

Q ss_pred             CCcccceecC--CCC----ceecCCCCCcc
Q psy2284         133 PNRHFCAVCG--FPS----NYTCVPCGARY  156 (175)
Q Consensus       133 P~r~~C~VCG--~~~----~YtC~~Cg~ry  156 (175)
                      -.-++|--||  |--    ...||.||+-|
T Consensus         7 GtKR~Cp~CG~kFYDLnk~PivCP~CG~~~   36 (108)
T PF09538_consen    7 GTKRTCPSCGAKFYDLNKDPIVCPKCGTEF   36 (108)
T ss_pred             CCcccCCCCcchhccCCCCCccCCCCCCcc
Confidence            3445666666  332    23366666544


No 55 
>PRK12495 hypothetical protein; Provisional
Probab=63.16  E-value=4.4  Score=35.30  Aligned_cols=25  Identities=20%  Similarity=0.483  Sum_probs=18.0

Q ss_pred             CCCcccceecC-----CCCceecCCCCCcc
Q psy2284         132 FPNRHFCAVCG-----FPSNYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG-----~~~~YtC~~Cg~ry  156 (175)
                      .+...+|.+||     ++|...|+.|+..+
T Consensus        39 tmsa~hC~~CG~PIpa~pG~~~Cp~CQ~~~   68 (226)
T PRK12495         39 TMTNAHCDECGDPIFRHDGQEFCPTCQQPV   68 (226)
T ss_pred             ccchhhcccccCcccCCCCeeECCCCCCcc
Confidence            44567899999     45777788887654


No 56 
>PRK08270 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=63.13  E-value=4.1  Score=39.98  Aligned_cols=24  Identities=29%  Similarity=0.664  Sum_probs=18.9

Q ss_pred             CCCcccceecCCCC--ceecCCCCCc
Q psy2284         132 FPNRHFCAVCGFPS--NYTCVPCGAR  155 (175)
Q Consensus       132 ~P~r~~C~VCG~~~--~YtC~~Cg~r  155 (175)
                      -|+-..|..|||..  .+.||.||..
T Consensus       623 n~~~~~C~~CG~~~g~~~~CP~CG~~  648 (656)
T PRK08270        623 TPTFSICPKHGYLSGEHEFCPKCGEE  648 (656)
T ss_pred             CCCCcccCCCCCcCCCCCCCcCCcCc
Confidence            47778999999743  4679999964


No 57 
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=62.60  E-value=3.2  Score=32.48  Aligned_cols=19  Identities=37%  Similarity=1.086  Sum_probs=15.0

Q ss_pred             ceecC---CCCceecCCCCCcc
Q psy2284         138 CAVCG---FPSNYTCVPCGARY  156 (175)
Q Consensus       138 C~VCG---~~~~YtC~~Cg~ry  156 (175)
                      |.|||   ....+.|+.|++-.
T Consensus         1 CPvCg~~l~vt~l~C~~C~t~i   22 (113)
T PF09862_consen    1 CPVCGGELVVTRLKCPSCGTEI   22 (113)
T ss_pred             CCCCCCceEEEEEEcCCCCCEE
Confidence            88999   34578899999853


No 58 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=62.57  E-value=5.9  Score=27.31  Aligned_cols=23  Identities=30%  Similarity=0.660  Sum_probs=16.1

Q ss_pred             CCCcccceecC--CCCceecCCCCC
Q psy2284         132 FPNRHFCAVCG--FPSNYTCVPCGA  154 (175)
Q Consensus       132 ~P~r~~C~VCG--~~~~YtC~~Cg~  154 (175)
                      .|....|.-||  ..+..-|+.||.
T Consensus        24 ~~~l~~C~~CG~~~~~H~vC~~CG~   48 (57)
T PRK12286         24 APGLVECPNCGEPKLPHRVCPSCGY   48 (57)
T ss_pred             CCcceECCCCCCccCCeEECCCCCc
Confidence            45557788888  445666888884


No 59 
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=61.92  E-value=5.3  Score=34.04  Aligned_cols=25  Identities=36%  Similarity=0.753  Sum_probs=18.4

Q ss_pred             CCCCcccceecCCCC---ceecCCCCCc
Q psy2284         131 KFPNRHFCAVCGFPS---NYTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~---~YtC~~Cg~r  155 (175)
                      ...|...|+-||+-+   -+-||+||..
T Consensus       350 ~~~p~~~c~~cg~~~~~~~~~c~~c~~~  377 (389)
T PRK11788        350 KRKPRYRCRNCGFTARTLYWHCPSCKAW  377 (389)
T ss_pred             hCCCCEECCCCCCCCccceeECcCCCCc
Confidence            345568899999655   3459999974


No 60 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=61.35  E-value=4.5  Score=33.56  Aligned_cols=21  Identities=38%  Similarity=0.952  Sum_probs=16.9

Q ss_pred             cccceecCCC----CceecCCCCCc
Q psy2284         135 RHFCAVCGFP----SNYTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG~~----~~YtC~~Cg~r  155 (175)
                      ...|-||||.    +.-.||.||.+
T Consensus       134 ~~vC~vCGy~~~ge~P~~CPiCga~  158 (166)
T COG1592         134 VWVCPVCGYTHEGEAPEVCPICGAP  158 (166)
T ss_pred             EEEcCCCCCcccCCCCCcCCCCCCh
Confidence            7899999964    35569999975


No 61 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=60.94  E-value=4.2  Score=25.55  Aligned_cols=20  Identities=40%  Similarity=0.886  Sum_probs=14.8

Q ss_pred             cccceecC------CCCceecCCCCC
Q psy2284         135 RHFCAVCG------FPSNYTCVPCGA  154 (175)
Q Consensus       135 r~~C~VCG------~~~~YtC~~Cg~  154 (175)
                      +.-|.|||      ..|.|.|.+||.
T Consensus         8 ~~~C~~C~~~~~~~~dG~~yC~~cG~   33 (36)
T PF11781_consen    8 NEPCPVCGSRWFYSDDGFYYCDRCGH   33 (36)
T ss_pred             CCcCCCCCCeEeEccCCEEEhhhCce
Confidence            34599999      236788999985


No 62 
>cd07160 NR_DBD_LXR DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. DNA-binding domain of Liver X receptors (LXRs) family is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. LXR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  LXR operates as cholesterol sensor which protects cells from cholesterol overload by stimulating reverse cholesterol transport from peripheral tissues to the liver and its excretion in the bile. Oxidized cholesterol derivatives or oxysterols were identified as specific ligands for LXRs. LXR functions as a heterodimer with the retinoid X receptor (RXR) which may be activated by either LXR agonist or 9-cis retinoic acid, a specific RXR ligand. The LXR/RXR complex binds to a liver X receptor response element (LXRE) in the promoter region of target genes. The ideal LXRE seq
Probab=60.84  E-value=6  Score=30.04  Aligned_cols=31  Identities=23%  Similarity=0.597  Sum_probs=19.0

Q ss_pred             ccCCCCCCCcccceecCCC------CceecCCCCCcc
Q psy2284         126 EAKPSKFPNRHFCAVCGFP------SNYTCVPCGARY  156 (175)
Q Consensus       126 ~a~ps~~P~r~~C~VCG~~------~~YtC~~Cg~ry  156 (175)
                      ..|++.......|.|||..      |.++|-.|...|
T Consensus         9 ~~~~~~~~~~~~C~VCg~~a~g~hyGv~sC~aCk~FF   45 (101)
T cd07160           9 KGPAPKMLGNEVCSVCGDKASGFHYNVLSCEGCKGFF   45 (101)
T ss_pred             CCCCCcccCCCCCeecCCcCcceEECcceehhhhhhh
Confidence            3445555556789999843      344577776643


No 63 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=60.63  E-value=3.7  Score=26.06  Aligned_cols=18  Identities=33%  Similarity=0.883  Sum_probs=11.1

Q ss_pred             cceecCC--------CCceecCCCCC
Q psy2284         137 FCAVCGF--------PSNYTCVPCGA  154 (175)
Q Consensus       137 ~C~VCG~--------~~~YtC~~Cg~  154 (175)
                      .|..||.        .|.+.|+.||.
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~   27 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGL   27 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-B
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCC
Confidence            4667772        35677888875


No 64 
>PHA02942 putative transposase; Provisional
Probab=60.37  E-value=6.2  Score=36.08  Aligned_cols=22  Identities=27%  Similarity=0.803  Sum_probs=17.0

Q ss_pred             CcccceecCCC------CceecCCCCCc
Q psy2284         134 NRHFCAVCGFP------SNYTCVPCGAR  155 (175)
Q Consensus       134 ~r~~C~VCG~~------~~YtC~~Cg~r  155 (175)
                      .-..|++||..      -.|.|+.||..
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~  351 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYE  351 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCE
Confidence            55899999954      25889999863


No 65 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=59.24  E-value=4.6  Score=27.40  Aligned_cols=20  Identities=35%  Similarity=0.773  Sum_probs=15.5

Q ss_pred             CcccceecC--CCCceecCCCC
Q psy2284         134 NRHFCAVCG--FPSNYTCVPCG  153 (175)
Q Consensus       134 ~r~~C~VCG--~~~~YtC~~Cg  153 (175)
                      ....|..||  ..+.+-|+.||
T Consensus        25 ~l~~c~~cg~~~~~H~vc~~cG   46 (56)
T PF01783_consen   25 NLVKCPNCGEPKLPHRVCPSCG   46 (56)
T ss_dssp             SEEESSSSSSEESTTSBCTTTB
T ss_pred             ceeeeccCCCEecccEeeCCCC
Confidence            447899999  55677899997


No 66 
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=59.00  E-value=3.6  Score=39.27  Aligned_cols=25  Identities=28%  Similarity=0.767  Sum_probs=12.4

Q ss_pred             CCCcccceecCCCC--ceecCCCCCcc
Q psy2284         132 FPNRHFCAVCGFPS--NYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG~~~--~YtC~~Cg~ry  156 (175)
                      -|+...|..|||.+  ...||.||..-
T Consensus       488 n~~~~~C~~CG~~~~~~~~CP~CGs~~  514 (546)
T PF13597_consen  488 NPPIDICPDCGYIGGEGDKCPKCGSEN  514 (546)
T ss_dssp             E--EEEETTT---S--EEE-CCC----
T ss_pred             ecCcccccCCCcCCCCCCCCCCCCCcc
Confidence            46778999999655  46899999864


No 67 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=58.68  E-value=5.8  Score=25.30  Aligned_cols=22  Identities=27%  Similarity=0.857  Sum_probs=12.5

Q ss_pred             cee--cC--CCCceecCCCCCccccc
Q psy2284         138 CAV--CG--FPSNYTCVPCGARYCCV  159 (175)
Q Consensus       138 C~V--CG--~~~~YtC~~Cg~ryCS~  159 (175)
                      |++  |+  -.-.+.|..|+..||..
T Consensus         1 C~~~~C~~~~~~~~~C~~C~~~FC~~   26 (43)
T PF01428_consen    1 CSFPGCKKKDFLPFKCKHCGKSFCLK   26 (43)
T ss_dssp             -SSTTT--BCTSHEE-TTTS-EE-TT
T ss_pred             CccCcCcCccCCCeECCCCCcccCcc
Confidence            556  77  22468899999999974


No 68 
>TIGR00269 conserved hypothetical protein TIGR00269.
Probab=58.51  E-value=4.3  Score=30.39  Aligned_cols=21  Identities=29%  Similarity=0.716  Sum_probs=16.0

Q ss_pred             CcccceecCCCCcee-cCCCCC
Q psy2284         134 NRHFCAVCGFPSNYT-CVPCGA  154 (175)
Q Consensus       134 ~r~~C~VCG~~~~Yt-C~~Cg~  154 (175)
                      ....|.+||+++.-. |.-|-.
T Consensus        79 ~~~~C~~CG~pss~~iC~~C~l  100 (104)
T TIGR00269        79 DLRRCERCGEPTSGRICKACKF  100 (104)
T ss_pred             cCCcCCcCcCcCCccccHhhhh
Confidence            466899999998655 877754


No 69 
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=58.13  E-value=5.7  Score=38.01  Aligned_cols=24  Identities=29%  Similarity=0.890  Sum_probs=18.4

Q ss_pred             CCCcccceecCCCC---ceecCCCCCcc
Q psy2284         132 FPNRHFCAVCGFPS---NYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG~~~---~YtC~~Cg~ry  156 (175)
                      .|.- .|..|||.+   .++||.||..-
T Consensus       516 ~p~~-~C~~CG~~~~~~~~~CP~CGs~~  542 (555)
T cd01675         516 TPID-ICNDCGYIGEGEGFKCPKCGSED  542 (555)
T ss_pred             cCCc-cCCCCCCCCcCCCCCCcCCCCcC
Confidence            3444 999999864   57899999753


No 70 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=57.47  E-value=8.9  Score=23.44  Aligned_cols=24  Identities=29%  Similarity=0.801  Sum_probs=18.8

Q ss_pred             cceecCCC-----CceecCCCCCcccccc
Q psy2284         137 FCAVCGFP-----SNYTCVPCGARYCCVR  160 (175)
Q Consensus       137 ~C~VCG~~-----~~YtC~~Cg~ryCS~~  160 (175)
                      -|.||...     .+|.|..|+...|-..
T Consensus         2 rC~vC~~~k~rk~T~~~C~~C~v~lC~~~   30 (32)
T PF13842_consen    2 RCKVCSKKKRRKDTRYMCSKCDVPLCVEP   30 (32)
T ss_pred             CCeECCcCCccceeEEEccCCCCcccCCC
Confidence            47788754     7899999998887654


No 72 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=57.09  E-value=5.6  Score=25.49  Aligned_cols=15  Identities=33%  Similarity=0.594  Sum_probs=10.7

Q ss_pred             CCceecCCCCCcccc
Q psy2284         144 PSNYTCVPCGARYCC  158 (175)
Q Consensus       144 ~~~YtC~~Cg~ryCS  158 (175)
                      ++..+|+.||+-|-.
T Consensus        11 ~~~~~C~~CgM~Y~~   25 (41)
T PF13878_consen   11 FGATTCPTCGMLYSP   25 (41)
T ss_pred             cCCcCCCCCCCEECC
Confidence            345678888887754


No 73 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=56.48  E-value=6.7  Score=25.46  Aligned_cols=26  Identities=31%  Similarity=0.892  Sum_probs=19.0

Q ss_pred             ccceecC-----CCCceecCCCCCcccccccc
Q psy2284         136 HFCAVCG-----FPSNYTCVPCGARYCCVRCL  162 (175)
Q Consensus       136 ~~C~VCG-----~~~~YtC~~Cg~ryCS~~C~  162 (175)
                      ..|.+|+     +..++.|..||..+|+ .|.
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~-~C~   33 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRIFCS-KCS   33 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCCcCh-HHc
Confidence            4688887     2337789999999987 443


No 74 
>PLN02294 cytochrome c oxidase subunit Vb
Probab=56.44  E-value=10  Score=31.93  Aligned_cols=29  Identities=17%  Similarity=0.334  Sum_probs=22.7

Q ss_pred             CCCCCCCcccceecCCCC--------------ceecCCCCCcc
Q psy2284         128 KPSKFPNRHFCAVCGFPS--------------NYTCVPCGARY  156 (175)
Q Consensus       128 ~ps~~P~r~~C~VCG~~~--------------~YtC~~Cg~ry  156 (175)
                      -||....|...++||+..              .+.|+.||..|
T Consensus       109 VpS~~d~RiVGCtg~~~eDsh~v~Wf~L~kGkp~RCpeCG~~f  151 (174)
T PLN02294        109 VKSYYDKRIVGCPGGEGEDEHDVVWFWLEKGKSFECPVCTQYF  151 (174)
T ss_pred             eccCCCceEEeeCCCCCCCCceeEEEEecCCCceeCCCCCCEE
Confidence            378899999999996432              35699999866


No 75 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=56.24  E-value=4.1  Score=29.02  Aligned_cols=28  Identities=21%  Similarity=0.466  Sum_probs=19.5

Q ss_pred             CCCcccceecCCCCceecCCCCCcccccccccc
Q psy2284         132 FPNRHFCAVCGFPSNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       132 ~P~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      .+|-+-|-|||..=.     =+.++||-+|..+
T Consensus         5 v~PH~HC~VCg~aIp-----~de~~CSe~C~ei   32 (64)
T COG4068           5 VVPHRHCVVCGKAIP-----PDEQVCSEECGEI   32 (64)
T ss_pred             CCCCccccccCCcCC-----CccchHHHHHHHH
Confidence            466677888884321     1678999999754


No 76 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=55.80  E-value=6.5  Score=40.96  Aligned_cols=6  Identities=50%  Similarity=1.420  Sum_probs=2.4

Q ss_pred             cceecC
Q psy2284         137 FCAVCG  142 (175)
Q Consensus       137 ~C~VCG  142 (175)
                      ||.-||
T Consensus       628 fCpsCG  633 (1121)
T PRK04023        628 KCPSCG  633 (1121)
T ss_pred             cCCCCC
Confidence            444444


No 77 
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=55.41  E-value=5.8  Score=38.82  Aligned_cols=25  Identities=28%  Similarity=0.674  Sum_probs=19.5

Q ss_pred             CCCCcccceecCCC--C-ceecCCCCCc
Q psy2284         131 KFPNRHFCAVCGFP--S-NYTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~~--~-~YtC~~Cg~r  155 (175)
                      ..|+..+|..||+.  + ...||.||..
T Consensus       564 inp~~~~C~~CG~~~~g~~~~CP~CGs~  591 (625)
T PRK08579        564 YTPAITVCNKCGRSTTGLYTRCPRCGSE  591 (625)
T ss_pred             eCCCCccCCCCCCccCCCCCcCcCCCCc
Confidence            35788899999972  3 5679999964


No 78 
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=55.08  E-value=7  Score=24.33  Aligned_cols=22  Identities=27%  Similarity=0.709  Sum_probs=16.2

Q ss_pred             CcccceecC--CC----CceecCCCCCc
Q psy2284         134 NRHFCAVCG--FP----SNYTCVPCGAR  155 (175)
Q Consensus       134 ~r~~C~VCG--~~----~~YtC~~Cg~r  155 (175)
                      ...+|.+|+  .|    ..|.|..|+..
T Consensus        10 ~~~~C~~C~~~i~~~~~~~~~C~~C~~~   37 (50)
T cd00029          10 KPTFCDVCRKSIWGLFKQGLRCSWCKVK   37 (50)
T ss_pred             CCCChhhcchhhhccccceeEcCCCCCc
Confidence            456899998  55    56889888653


No 79 
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=54.80  E-value=7  Score=28.74  Aligned_cols=21  Identities=43%  Similarity=1.133  Sum_probs=15.7

Q ss_pred             ccceecC---CC--CceecCCCCCcc
Q psy2284         136 HFCAVCG---FP--SNYTCVPCGARY  156 (175)
Q Consensus       136 ~~C~VCG---~~--~~YtC~~Cg~ry  156 (175)
                      .||..||   ++  +.+.|+.||..+
T Consensus         1 ~fC~~Cg~~l~~~~~~~~C~~C~~~~   26 (104)
T TIGR01384         1 KFCPKCGSLMTPKNGVYVCPSCGYEK   26 (104)
T ss_pred             CCCcccCcccccCCCeEECcCCCCcc
Confidence            3899999   23  478899998653


No 80 
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=54.40  E-value=5.9  Score=37.29  Aligned_cols=25  Identities=28%  Similarity=0.741  Sum_probs=18.8

Q ss_pred             cccceecC----CCC--ceecCCCCCccccc
Q psy2284         135 RHFCAVCG----FPS--NYTCVPCGARYCCV  159 (175)
Q Consensus       135 r~~C~VCG----~~~--~YtC~~Cg~ryCS~  159 (175)
                      -..|..||    ..|  -|+|++||.++=+.
T Consensus       350 ~p~Cp~Cg~~m~S~G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         350 NPVCPRCGGRMKSAGRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCCCccCCchhhcCCCCcccccccccCCcc
Confidence            34899999    233  58999999987553


No 81 
>KOG3612|consensus
Probab=53.85  E-value=2.9  Score=40.63  Aligned_cols=31  Identities=32%  Similarity=0.859  Sum_probs=27.1

Q ss_pred             cccceecCCCCceecCCC-CCccccccccccccc
Q psy2284         135 RHFCAVCGFPSNYTCVPC-GARYCCVRCLGTHQD  167 (175)
Q Consensus       135 r~~C~VCG~~~~YtC~~C-g~ryCS~~C~~~H~e  167 (175)
                      -..|--|-..+.|-|  | .+-|||+.|...|.-
T Consensus       527 KQWC~nC~~EAiy~C--CWNTSYCsveCQQ~HW~  558 (588)
T KOG3612|consen  527 KQWCYNCLDEAIYHC--CWNTSYCSVECQQGHWP  558 (588)
T ss_pred             HHHHHhhhHHHHHHh--hccccccCcchhhccch
Confidence            348999999999886  5 889999999999975


No 82 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=52.66  E-value=6.4  Score=22.11  Aligned_cols=20  Identities=40%  Similarity=0.951  Sum_probs=14.0

Q ss_pred             ccceecC---CCCceecCCCCCc
Q psy2284         136 HFCAVCG---FPSNYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG---~~~~YtC~~Cg~r  155 (175)
                      ..|..|+   +.....|..|+.+
T Consensus         3 W~C~~C~~~N~~~~~~C~~C~~p   25 (26)
T smart00547        3 WECPACTFLNFASRSKCFACGAP   25 (26)
T ss_pred             ccCCCCCCcChhhhccccccCCc
Confidence            3588887   4456678888864


No 83 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=52.65  E-value=8.2  Score=29.47  Aligned_cols=25  Identities=32%  Similarity=0.632  Sum_probs=16.8

Q ss_pred             CCCcccceecCCC----------CceecCCCCCcc
Q psy2284         132 FPNRHFCAVCGFP----------SNYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG~~----------~~YtC~~Cg~ry  156 (175)
                      .|....|..||..          +...|+.||.+|
T Consensus        18 lpt~f~CP~Cge~~v~v~~~k~~~h~~C~~CG~y~   52 (99)
T PRK14892         18 LPKIFECPRCGKVSISVKIKKNIAIITCGNCGLYT   52 (99)
T ss_pred             CCcEeECCCCCCeEeeeecCCCcceEECCCCCCcc
Confidence            4556678888822          256788888865


No 84 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=52.65  E-value=9.8  Score=40.47  Aligned_cols=20  Identities=40%  Similarity=0.977  Sum_probs=16.5

Q ss_pred             ccceecCCCC--ceecCCCCCc
Q psy2284         136 HFCAVCGFPS--NYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG~~~--~YtC~~Cg~r  155 (175)
                      .||..||.+.  .|.|+.||..
T Consensus       680 ~fCP~CGs~te~vy~CPsCGae  701 (1337)
T PRK14714        680 NRCPDCGTHTEPVYVCPDCGAE  701 (1337)
T ss_pred             ccCcccCCcCCCceeCccCCCc
Confidence            4999999554  8899999985


No 85 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=51.56  E-value=7.6  Score=26.31  Aligned_cols=25  Identities=32%  Similarity=0.871  Sum_probs=13.5

Q ss_pred             cccceecC--C---CCceecCCCCCccccc
Q psy2284         135 RHFCAVCG--F---PSNYTCVPCGARYCCV  159 (175)
Q Consensus       135 r~~C~VCG--~---~~~YtC~~Cg~ryCS~  159 (175)
                      ...|.+|+  |   ..++.|..||.-+|+.
T Consensus         9 ~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~   38 (69)
T PF01363_consen    9 ASNCMICGKKFSLFRRRHHCRNCGRVVCSS   38 (69)
T ss_dssp             -SB-TTT--B-BSSS-EEE-TTT--EEECC
T ss_pred             CCcCcCcCCcCCCceeeEccCCCCCEECCc
Confidence            46799998  2   3377899999999863


No 86 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=50.70  E-value=10  Score=23.48  Aligned_cols=21  Identities=29%  Similarity=0.678  Sum_probs=15.2

Q ss_pred             cccceecCCCCc-------eecCCCCCc
Q psy2284         135 RHFCAVCGFPSN-------YTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG~~~~-------YtC~~Cg~r  155 (175)
                      ...|.+||-.+-       |.|+.||.-
T Consensus         3 ~~~C~~C~~~~i~~~~~~~~~C~~Cg~~   30 (33)
T PF08792_consen    3 LKKCSKCGGNGIVNKEDDYEVCIFCGSS   30 (33)
T ss_pred             ceEcCCCCCCeEEEecCCeEEcccCCcE
Confidence            357999995554       469999864


No 87 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.61  E-value=0.9  Score=31.25  Aligned_cols=34  Identities=26%  Similarity=0.608  Sum_probs=22.4

Q ss_pred             CCCCcccceecCCCC--ceecCCC--CCcccccccccc
Q psy2284         131 KFPNRHFCAVCGFPS--NYTCVPC--GARYCCVRCLGT  164 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~--~YtC~~C--g~ryCS~~C~~~  164 (175)
                      ..-+-++|.|||-+-  .-+=.+|  ...|||-+|...
T Consensus         8 a~lp~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCrr~   45 (54)
T COG4338           8 ATLPDKICPVCQRPFSWRKKWARCWDEVKYCSERCRRL   45 (54)
T ss_pred             cccchhhhhhhcCchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            355678999999443  2234445  457999999743


No 88 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=49.62  E-value=9.5  Score=32.95  Aligned_cols=25  Identities=36%  Similarity=1.023  Sum_probs=17.6

Q ss_pred             CCCcccceecCCCCce-------ecCCCCCcc
Q psy2284         132 FPNRHFCAVCGFPSNY-------TCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG~~~~Y-------tC~~Cg~ry  156 (175)
                      .-.-+||+.||.+-..       .|+.||..+
T Consensus        96 ~~~~~fC~~CG~~~~~~~~~~~~~C~~c~~~~  127 (256)
T PRK00241         96 YRSHRFCGYCGHPMHPSKTEWAMLCPHCRERY  127 (256)
T ss_pred             hhcCccccccCCCCeecCCceeEECCCCCCEE
Confidence            3456799999965332       399998765


No 89 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=49.35  E-value=7.3  Score=20.87  Aligned_cols=18  Identities=28%  Similarity=0.682  Sum_probs=11.9

Q ss_pred             eecCCCCCcccccccccc
Q psy2284         147 YTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       147 YtC~~Cg~ryCS~~C~~~  164 (175)
                      |.|+.||..|=+..=+..
T Consensus         1 y~C~~C~~~f~~~~~l~~   18 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKR   18 (23)
T ss_dssp             EEETTTTEEESSHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHH
Confidence            789999887755443333


No 90 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=48.80  E-value=8.8  Score=22.49  Aligned_cols=22  Identities=36%  Similarity=0.745  Sum_probs=13.5

Q ss_pred             CcccceecC---CCCceecCCCCCc
Q psy2284         134 NRHFCAVCG---FPSNYTCVPCGAR  155 (175)
Q Consensus       134 ~r~~C~VCG---~~~~YtC~~Cg~r  155 (175)
                      ..-.|.+|+   +...-.|..||..
T Consensus         3 g~W~C~~C~~~N~~~~~~C~~C~~~   27 (30)
T PF00641_consen    3 GDWKCPSCTFMNPASRSKCVACGAP   27 (30)
T ss_dssp             SSEEETTTTEEEESSSSB-TTT--B
T ss_pred             cCccCCCCcCCchHHhhhhhCcCCC
Confidence            345788998   4556679999864


No 91 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=47.57  E-value=11  Score=30.42  Aligned_cols=18  Identities=33%  Similarity=0.850  Sum_probs=11.0

Q ss_pred             cceecC-----CCCceecCCCCC
Q psy2284         137 FCAVCG-----FPSNYTCVPCGA  154 (175)
Q Consensus       137 ~C~VCG-----~~~~YtC~~Cg~  154 (175)
                      -|.+||     +.|..-||.||.
T Consensus        30 hCp~Cg~PLF~KdG~v~CPvC~~   52 (131)
T COG1645          30 HCPKCGTPLFRKDGEVFCPVCGY   52 (131)
T ss_pred             hCcccCCcceeeCCeEECCCCCc
Confidence            466676     345566777764


No 92 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=47.56  E-value=8.1  Score=24.12  Aligned_cols=6  Identities=67%  Similarity=1.962  Sum_probs=2.2

Q ss_pred             cceecC
Q psy2284         137 FCAVCG  142 (175)
Q Consensus       137 ~C~VCG  142 (175)
                      ||..||
T Consensus         2 fC~~CG    7 (34)
T PF14803_consen    2 FCPQCG    7 (34)
T ss_dssp             B-TTT-
T ss_pred             cccccc
Confidence            555555


No 93 
>KOG2807|consensus
Probab=47.19  E-value=32  Score=32.01  Aligned_cols=27  Identities=30%  Similarity=0.714  Sum_probs=20.1

Q ss_pred             CcccceecC--CCCceecCCCCCcccccc
Q psy2284         134 NRHFCAVCG--FPSNYTCVPCGARYCCVR  160 (175)
Q Consensus       134 ~r~~C~VCG--~~~~YtC~~Cg~ryCS~~  160 (175)
                      .+.||+-=+  .-+.|-||+|++++||+.
T Consensus       262 ~ps~C~CH~~~~~~Gy~CP~CkakvCsLP  290 (378)
T KOG2807|consen  262 TPSFCACHSELSGGGYFCPQCKAKVCSLP  290 (378)
T ss_pred             CcchheeccccccCceeCCcccCeeecCC
Confidence            346775333  456899999999999964


No 94 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=46.60  E-value=7.4  Score=27.21  Aligned_cols=24  Identities=29%  Similarity=0.808  Sum_probs=14.5

Q ss_pred             ccceecCCCCceecCCCCCcccccccccc
Q psy2284         136 HFCAVCGFPSNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       136 ~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      +-|-|||.+=.-     ...|||-.|.+.
T Consensus         4 kHC~~CG~~Ip~-----~~~fCS~~C~~~   27 (59)
T PF09889_consen    4 KHCPVCGKPIPP-----DESFCSPKCREE   27 (59)
T ss_pred             CcCCcCCCcCCc-----chhhhCHHHHHH
Confidence            446666633221     357999999654


No 95 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=46.56  E-value=7.2  Score=27.71  Aligned_cols=12  Identities=25%  Similarity=0.514  Sum_probs=6.8

Q ss_pred             CCCcccceecCC
Q psy2284         132 FPNRHFCAVCGF  143 (175)
Q Consensus       132 ~P~r~~C~VCG~  143 (175)
                      .-....|--||.
T Consensus        24 ~~v~F~CPnCGe   35 (61)
T COG2888          24 TAVKFPCPNCGE   35 (61)
T ss_pred             ceeEeeCCCCCc
Confidence            344456667773


No 96 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=45.73  E-value=12  Score=33.50  Aligned_cols=25  Identities=28%  Similarity=0.820  Sum_probs=18.0

Q ss_pred             CCCcccceecCCC-----C--ceecCCCCCcc
Q psy2284         132 FPNRHFCAVCGFP-----S--NYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG~~-----~--~YtC~~Cg~ry  156 (175)
                      .-.-+||+-||..     +  ++-|+.||..+
T Consensus       108 ~~~~RFCg~CG~~~~~~~~g~~~~C~~cg~~~  139 (279)
T COG2816         108 YRSHRFCGRCGTKTYPREGGWARVCPKCGHEH  139 (279)
T ss_pred             HhhCcCCCCCCCcCccccCceeeeCCCCCCcc
Confidence            3456799999932     2  44599999865


No 97 
>PF14949 ARF7EP_C:  ARF7 effector protein C-terminus
Probab=45.31  E-value=11  Score=29.01  Aligned_cols=16  Identities=44%  Similarity=1.240  Sum_probs=15.0

Q ss_pred             ceecCCCCCccccccc
Q psy2284         146 NYTCVPCGARYCCVRC  161 (175)
Q Consensus       146 ~YtC~~Cg~ryCS~~C  161 (175)
                      .|-|++||.+-|+..|
T Consensus        74 ~~PC~~C~S~KCG~~C   89 (103)
T PF14949_consen   74 HYPCPKCGSRKCGPEC   89 (103)
T ss_pred             cccCCCCCCCccChhh
Confidence            6779999999999999


No 98 
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=45.16  E-value=9.1  Score=26.01  Aligned_cols=22  Identities=36%  Similarity=0.966  Sum_probs=17.0

Q ss_pred             ceecC-C-CCceecCCCCCccccc
Q psy2284         138 CAVCG-F-PSNYTCVPCGARYCCV  159 (175)
Q Consensus       138 C~VCG-~-~~~YtC~~Cg~ryCS~  159 (175)
                      |++|+ . ...|.|..||.-.|..
T Consensus         1 C~~C~~~~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGSTNSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTCSSSEEEETTTS-EEETT
T ss_pred             CCCCCCcCCceEEeCCCCcccccC
Confidence            78888 4 5689999999999985


No 99 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=44.42  E-value=12  Score=22.74  Aligned_cols=11  Identities=18%  Similarity=0.736  Sum_probs=8.2

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      +++||.||+.|
T Consensus         2 ~~~CP~C~~~~   12 (38)
T TIGR02098         2 RIQCPNCKTSF   12 (38)
T ss_pred             EEECCCCCCEE
Confidence            36789998865


No 100
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=43.56  E-value=7.8  Score=39.63  Aligned_cols=37  Identities=24%  Similarity=0.507  Sum_probs=0.0

Q ss_pred             cccceecCCC--CceecCCCCCccccccccccccccccc
Q psy2284         135 RHFCAVCGFP--SNYTCVPCGARYCCVRCLGTHQDTRCL  171 (175)
Q Consensus       135 r~~C~VCG~~--~~YtC~~Cg~ryCS~~C~~~H~etRC~  171 (175)
                      ...|..||.+  ..|.|+.||..+=.-.|-+-..++.|.
T Consensus       667 ~~~Cp~CG~~T~~~~~Cp~C~~~~~~~~C~~C~~~~~~~  705 (900)
T PF03833_consen  667 YNRCPECGSHTEPVYVCPDCGIEVEEDECPKCGRETTSY  705 (900)
T ss_dssp             ---------------------------------------
T ss_pred             hhcCcccCCccccceeccccccccCccccccccccCccc
Confidence            3456666633  456666666665444554444444443


No 101
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=43.23  E-value=7.2  Score=33.83  Aligned_cols=22  Identities=27%  Similarity=0.200  Sum_probs=13.6

Q ss_pred             CCHHHHHHHHHHHHHhhhCCCC
Q psy2284          21 LDEATRQRRARKALESLESDNF   42 (175)
Q Consensus        21 lD~~~R~rr~~~rLdaLE~DN~   42 (175)
                      -|.++.-.+..+||.+|.+++.
T Consensus        11 ~~~~~~~~~ra~rl~~La~~~p   32 (290)
T PF04216_consen   11 PDPATLFARRAERLRALAEKHP   32 (290)
T ss_dssp             ---TTHHHHHHHHHHHHHTT-T
T ss_pred             CCHhhHHHHHHHHHHHHHHhCC
Confidence            3566666666778888888866


No 102
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=42.87  E-value=13  Score=29.38  Aligned_cols=20  Identities=40%  Similarity=1.062  Sum_probs=12.7

Q ss_pred             ccceecC---CCCceecCCCCCc
Q psy2284         136 HFCAVCG---FPSNYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG---~~~~YtC~~Cg~r  155 (175)
                      .-|..||   |+..--|+.||.+
T Consensus        30 ~kC~~CG~v~~PPr~~Cp~C~~~   52 (140)
T COG1545          30 TKCKKCGRVYFPPRAYCPKCGSE   52 (140)
T ss_pred             EEcCCCCeEEcCCcccCCCCCCC
Confidence            3566777   5566667777655


No 103
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=42.70  E-value=7.5  Score=20.22  Aligned_cols=20  Identities=25%  Similarity=0.597  Sum_probs=11.4

Q ss_pred             eecCCCCCcccccccccccc
Q psy2284         147 YTCVPCGARYCCVRCLGTHQ  166 (175)
Q Consensus       147 YtC~~Cg~ryCS~~C~~~H~  166 (175)
                      |.|+-||..|=+..-+..|.
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHH
Confidence            56777877776655555543


No 104
>PRK14891 50S ribosomal protein L24e/unknown domain fusion protein; Provisional
Probab=42.62  E-value=8.4  Score=31.07  Aligned_cols=42  Identities=21%  Similarity=0.343  Sum_probs=25.6

Q ss_pred             CCcccceecC---CCCceec--CCC--CCcccccccccccc---cccccccc
Q psy2284         133 PNRHFCAVCG---FPSNYTC--VPC--GARYCCVRCLGTHQ---DTRCLKWT  174 (175)
Q Consensus       133 P~r~~C~VCG---~~~~YtC--~~C--g~ryCS~~C~~~H~---etRC~K~~  174 (175)
                      +....|+.||   |||.-+-  .+=  -.+|||.+|.+.+.   .-|=++||
T Consensus         2 m~~e~CsFcG~kIyPG~G~~fVR~DGkvf~FcssKC~k~f~~kRnPRKlkWT   53 (131)
T PRK14891          2 VETRTCDYTGEEIEPGTGTMFVRKDGTVLHFVDSKCEKNYDLGREARDLEWT   53 (131)
T ss_pred             CceeeecCcCCcccCCCCcEEEecCCCEEEEecHHHHHHHHccCCCccchhH
Confidence            3456899999   6664221  111  23689999986553   35666665


No 105
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=42.61  E-value=17  Score=23.72  Aligned_cols=19  Identities=37%  Similarity=0.912  Sum_probs=12.7

Q ss_pred             cceecCC------CCceecCCCCCc
Q psy2284         137 FCAVCGF------PSNYTCVPCGAR  155 (175)
Q Consensus       137 ~C~VCG~------~~~YtC~~Cg~r  155 (175)
                      .|+-||.      .....|+.||-+
T Consensus         4 ~C~~Cg~~~~~~~~~~irC~~CG~r   28 (44)
T smart00659        4 ICGECGRENEIKSKDVVRCRECGYR   28 (44)
T ss_pred             ECCCCCCEeecCCCCceECCCCCce
Confidence            5777872      234668888865


No 106
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=41.90  E-value=16  Score=28.37  Aligned_cols=28  Identities=29%  Similarity=0.819  Sum_probs=19.6

Q ss_pred             CCCCCCcccceecCCCC-------------ceecCCCCCcc
Q psy2284         129 PSKFPNRHFCAVCGFPS-------------NYTCVPCGARY  156 (175)
Q Consensus       129 ps~~P~r~~C~VCG~~~-------------~YtC~~Cg~ry  156 (175)
                      |+.+|...-|-+||...             ...|-.||++|
T Consensus        16 ~~~L~k~FtCp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~   56 (104)
T COG4888          16 PQVLPKTFTCPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSF   56 (104)
T ss_pred             CccCCceEecCccCCeeeeEEEEEecCceeEEEcccCcceE
Confidence            45577888888888432             23588888875


No 107
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=41.43  E-value=18  Score=21.40  Aligned_cols=17  Identities=35%  Similarity=0.856  Sum_probs=12.2

Q ss_pred             cceecC---CCC-ceecCCCC
Q psy2284         137 FCAVCG---FPS-NYTCVPCG  153 (175)
Q Consensus       137 ~C~VCG---~~~-~YtC~~Cg  153 (175)
                      .|.||+   .+. -|+|..|+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCC
Confidence            589998   333 68887776


No 108
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=41.10  E-value=28  Score=27.27  Aligned_cols=38  Identities=24%  Similarity=0.682  Sum_probs=24.7

Q ss_pred             CCCCccccccCCCCCCCcccceecCC--C-------------CceecCCCCCccc
Q psy2284         118 QGSAYENAEAKPSKFPNRHFCAVCGF--P-------------SNYTCVPCGARYC  157 (175)
Q Consensus       118 ~~p~Y~~a~a~ps~~P~r~~C~VCG~--~-------------~~YtC~~Cg~ryC  157 (175)
                      +.++|.....  +....-..|-.|+.  +             +.|.|++|..-||
T Consensus        40 Pl~~f~ev~~--~~~~~~~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC   92 (112)
T TIGR00622        40 PLKAFQEIPL--EEYNGSRFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFC   92 (112)
T ss_pred             CCcccccccc--cccCCCCcccCcCCCCCCcccccccccccccceeCCCCCCccc
Confidence            5566655422  12222356999983  3             4699999999998


No 109
>PF12773 DZR:  Double zinc ribbon
Probab=41.06  E-value=15  Score=23.42  Aligned_cols=22  Identities=41%  Similarity=1.016  Sum_probs=13.3

Q ss_pred             CCcccceecCCCC------ceecCCCCC
Q psy2284         133 PNRHFCAVCGFPS------NYTCVPCGA  154 (175)
Q Consensus       133 P~r~~C~VCG~~~------~YtC~~Cg~  154 (175)
                      +...||.-||..-      ...|+.||.
T Consensus        10 ~~~~fC~~CG~~l~~~~~~~~~C~~Cg~   37 (50)
T PF12773_consen   10 DDAKFCPHCGTPLPPPDQSKKICPNCGA   37 (50)
T ss_pred             ccccCChhhcCChhhccCCCCCCcCCcC
Confidence            3456777777322      245777776


No 110
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=38.79  E-value=24  Score=21.98  Aligned_cols=21  Identities=29%  Similarity=0.659  Sum_probs=15.8

Q ss_pred             CCCCcccceecCCCCcee--cCC
Q psy2284         131 KFPNRHFCAVCGFPSNYT--CVP  151 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~~Yt--C~~  151 (175)
                      ..|+-..|-+|+..|.|.  ||.
T Consensus         4 ~pP~~Y~C~~C~~~GH~i~dCP~   26 (32)
T PF13696_consen    4 KPPPGYVCHRCGQKGHWIQDCPT   26 (32)
T ss_pred             CCCCCCEeecCCCCCccHhHCCC
Confidence            356667899999888776  764


No 111
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=38.43  E-value=16  Score=22.43  Aligned_cols=25  Identities=16%  Similarity=0.332  Sum_probs=20.1

Q ss_pred             cccceecCCC-CceecCCCCCccccc
Q psy2284         135 RHFCAVCGFP-SNYTCVPCGARYCCV  159 (175)
Q Consensus       135 r~~C~VCG~~-~~YtC~~Cg~ryCS~  159 (175)
                      ..+|..|+.. ..|-|..|+..+|+.
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~   28 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSE   28 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHH
T ss_pred             CccCccCCccceEEEecCCCCccCcc
Confidence            4689999966 899999999988864


No 112
>PRK04023 DNA polymerase II large subunit; Validated
Probab=38.06  E-value=24  Score=37.02  Aligned_cols=21  Identities=33%  Similarity=0.811  Sum_probs=11.7

Q ss_pred             CcccceecCCC--CceecCCCCC
Q psy2284         134 NRHFCAVCGFP--SNYTCVPCGA  154 (175)
Q Consensus       134 ~r~~C~VCG~~--~~YtC~~Cg~  154 (175)
                      ...+|..||..  ..|.|+.||.
T Consensus       637 ~~frCP~CG~~Te~i~fCP~CG~  659 (1121)
T PRK04023        637 FYRRCPFCGTHTEPVYRCPRCGI  659 (1121)
T ss_pred             CcccCCCCCCCCCcceeCccccC
Confidence            34566666633  4555666655


No 113
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=37.72  E-value=15  Score=27.40  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=4.2

Q ss_pred             CceecCCCCCcc
Q psy2284         145 SNYTCVPCGARY  156 (175)
Q Consensus       145 ~~YtC~~Cg~ry  156 (175)
                      +.-.|++|+++|
T Consensus        50 g~q~CpqCkt~y   61 (80)
T PF14569_consen   50 GNQVCPQCKTRY   61 (80)
T ss_dssp             S-SB-TTT--B-
T ss_pred             CcccccccCCCc
Confidence            444566776666


No 114
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=37.43  E-value=20  Score=24.85  Aligned_cols=19  Identities=11%  Similarity=-0.048  Sum_probs=10.0

Q ss_pred             cccceecC--CCCceecCCCCC
Q psy2284         135 RHFCAVCG--FPSNYTCVPCGA  154 (175)
Q Consensus       135 r~~C~VCG--~~~~YtC~~Cg~  154 (175)
                      ...|.-||  ......|+ ||.
T Consensus        27 ~~~c~~cg~~~~pH~vc~-cG~   47 (60)
T PRK01110         27 LSVDKTTGEYHLPHHVSP-KGY   47 (60)
T ss_pred             eeEcCCCCceeccceecC-Ccc
Confidence            35566666  33344566 653


No 115
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=37.14  E-value=11  Score=26.54  Aligned_cols=21  Identities=33%  Similarity=0.781  Sum_probs=13.4

Q ss_pred             cccceecC---CC------CceecCCCCCc
Q psy2284         135 RHFCAVCG---FP------SNYTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG---~~------~~YtC~~Cg~r  155 (175)
                      +.+|++|+   ..      +.|.|+.|+..
T Consensus        41 ~v~Cg~C~~~~~~~~~~c~~~~~C~~C~~~   70 (71)
T PF05495_consen   41 RVICGKCRTEQPIDEYSCGADYFCPICGLY   70 (71)
T ss_dssp             EEEETTT--EEES-SBTT--SEEETTTTEE
T ss_pred             CeECCCCCCccChhhhhcCCCccCcCcCCC
Confidence            78999998   23      34677777654


No 116
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=37.11  E-value=18  Score=24.60  Aligned_cols=14  Identities=36%  Similarity=1.080  Sum_probs=7.4

Q ss_pred             CceecCCCCCcccc
Q psy2284         145 SNYTCVPCGARYCC  158 (175)
Q Consensus       145 ~~YtC~~Cg~ryCS  158 (175)
                      +.|.|++|+.-||-
T Consensus        20 ~~y~C~~C~~~FC~   33 (51)
T PF07975_consen   20 SRYRCPKCKNHFCI   33 (51)
T ss_dssp             EEE--TTTT--B-H
T ss_pred             CeEECCCCCCcccc
Confidence            57999999999973


No 117
>PHA00616 hypothetical protein
Probab=37.09  E-value=5.9  Score=26.28  Aligned_cols=15  Identities=27%  Similarity=0.784  Sum_probs=11.7

Q ss_pred             ceecCCCCCcccccc
Q psy2284         146 NYTCVPCGARYCCVR  160 (175)
Q Consensus       146 ~YtC~~Cg~ryCS~~  160 (175)
                      .|.|++||..+.-..
T Consensus         1 pYqC~~CG~~F~~~s   15 (44)
T PHA00616          1 MYQCLRCGGIFRKKK   15 (44)
T ss_pred             CCccchhhHHHhhHH
Confidence            389999999876544


No 118
>cd07173 NR_DBD_AR DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. DNA-binding domain of androgen receptor (AR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. To regulate gene expression, AR interacts with a palindrome of the core sequence 5'-TGTTCT-3' with a 3-bp spacer. It also binds to the direct repeat  5'-TGTTCT-3' hexamer in some androgen controlled genes. AR is activated by the androgenic hormones, testosterone or dihydrotestosterone, which are responsible for primary and for secondary male characteristics, respectively. The primary mechanism of action of ARs is by direct regulation of gene transcription. The binding of androgen results in a conformational change in the androgen receptor which causes its transport from the cytosol into the cell nucleus, and dimerization. The receptor dimer binds to a hormone response element of AR regulated genes and modul
Probab=36.68  E-value=8.5  Score=28.02  Aligned_cols=22  Identities=32%  Similarity=0.840  Sum_probs=14.3

Q ss_pred             CCcccceecCCCC------ceecCCCCC
Q psy2284         133 PNRHFCAVCGFPS------NYTCVPCGA  154 (175)
Q Consensus       133 P~r~~C~VCG~~~------~YtC~~Cg~  154 (175)
                      |++..|.|||..+      .++|-.|.+
T Consensus         1 ~~~~~C~VCg~~a~g~hyGv~sC~aCk~   28 (82)
T cd07173           1 PPQKTCLICGDEASGCHYGALTCGSCKV   28 (82)
T ss_pred             CCCCCCeecCCcCcceEECcchhhhHHH
Confidence            5677899998433      334666655


No 119
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=36.11  E-value=19  Score=22.98  Aligned_cols=11  Identities=36%  Similarity=1.099  Sum_probs=8.2

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      .|.|++||..+
T Consensus         3 ~y~C~~CG~~~   13 (46)
T PRK00398          3 EYKCARCGREV   13 (46)
T ss_pred             EEECCCCCCEE
Confidence            48888888753


No 120
>PLN02195 cellulose synthase A
Probab=35.99  E-value=18  Score=37.53  Aligned_cols=22  Identities=32%  Similarity=0.945  Sum_probs=16.6

Q ss_pred             ccceecCCC------------CceecCCCCCccc
Q psy2284         136 HFCAVCGFP------------SNYTCVPCGARYC  157 (175)
Q Consensus       136 ~~C~VCG~~------------~~YtC~~Cg~ryC  157 (175)
                      .-|.+|||+            |+-.||.|++||=
T Consensus        26 vaC~eC~~pvCrpCyeyer~eg~q~CpqCkt~Yk   59 (977)
T PLN02195         26 VACHECSYPLCKACLEYEIKEGRKVCLRCGGPYD   59 (977)
T ss_pred             EEeccCCCccccchhhhhhhcCCccCCccCCccc
Confidence            458888765            5667999998884


No 121
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=35.64  E-value=29  Score=22.48  Aligned_cols=16  Identities=44%  Similarity=1.190  Sum_probs=9.8

Q ss_pred             ceecCCCCCcccccccc
Q psy2284         146 NYTCVPCGARYCCVRCL  162 (175)
Q Consensus       146 ~YtC~~Cg~ryCS~~C~  162 (175)
                      ..+|+.||..|| ..|.
T Consensus        40 ~v~C~~C~~~fC-~~C~   55 (64)
T smart00647       40 RVTCPKCGFSFC-FRCK   55 (64)
T ss_pred             eeECCCCCCeEC-CCCC
Confidence            455777777776 4443


No 122
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=35.55  E-value=18  Score=21.18  Aligned_cols=19  Identities=37%  Similarity=0.892  Sum_probs=8.9

Q ss_pred             ccceecCCC----CceecCCCCC
Q psy2284         136 HFCAVCGFP----SNYTCVPCGA  154 (175)
Q Consensus       136 ~~C~VCG~~----~~YtC~~Cg~  154 (175)
                      +.|.+||..    ..|.|..|.-
T Consensus         1 ~~C~~C~~~~~~~~~Y~C~~Cdf   23 (30)
T PF07649_consen    1 FRCDACGKPIDGGWFYRCSECDF   23 (30)
T ss_dssp             ---TTTS----S--EEE-TTT--
T ss_pred             CcCCcCCCcCCCCceEECccCCC
Confidence            368999933    3788998863


No 123
>PF14353 CpXC:  CpXC protein
Probab=35.42  E-value=23  Score=26.87  Aligned_cols=15  Identities=33%  Similarity=0.941  Sum_probs=10.6

Q ss_pred             CCCCceecCCCCCcc
Q psy2284         142 GFPSNYTCVPCGARY  156 (175)
Q Consensus       142 G~~~~YtC~~Cg~ry  156 (175)
                      |..-.|+||.||..+
T Consensus        34 g~l~~~~CP~Cg~~~   48 (128)
T PF14353_consen   34 GSLFSFTCPSCGHKF   48 (128)
T ss_pred             CCcCEEECCCCCCce
Confidence            345578899998753


No 124
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=35.34  E-value=19  Score=32.59  Aligned_cols=23  Identities=17%  Similarity=0.145  Sum_probs=15.2

Q ss_pred             cCCHHHHHHHHHHHHHhhhCCCC
Q psy2284          20 VLDEATRQRRARKALESLESDNF   42 (175)
Q Consensus        20 vlD~~~R~rr~~~rLdaLE~DN~   42 (175)
                      ..|..+--.+..+||..|=.+|.
T Consensus        27 ~p~~~~lf~~RA~Rl~~LA~~~p   49 (309)
T PRK03564         27 FANLKNLYNRRAERLRQLAENNP   49 (309)
T ss_pred             cCCcccHHHHHHHHHHHHHhcCC
Confidence            34666666677777777776654


No 125
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=35.29  E-value=20  Score=21.69  Aligned_cols=11  Identities=36%  Similarity=1.198  Sum_probs=8.6

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      .|.|+.||..|
T Consensus         5 ~y~C~~Cg~~f   15 (41)
T smart00834        5 EYRCEDCGHTF   15 (41)
T ss_pred             EEEcCCCCCEE
Confidence            47899999865


No 126
>PF11239 DUF3040:  Protein of unknown function (DUF3040);  InterPro: IPR021401  Some members in this family of proteins with unknown function are annotated as membrane proteins however this cannot be confirmed. 
Probab=34.92  E-value=16  Score=26.23  Aligned_cols=18  Identities=33%  Similarity=0.540  Sum_probs=14.7

Q ss_pred             HHHHHHhhhCCCCCCCCC
Q psy2284          30 ARKALESLESDNFHDDPH   47 (175)
Q Consensus        30 ~~~rLdaLE~DN~~ddp~   47 (175)
                      -+++|++||+.=+.|||+
T Consensus         7 E~r~L~eiEr~L~~~DP~   24 (82)
T PF11239_consen    7 EQRRLEEIERQLRADDPR   24 (82)
T ss_pred             HHHHHHHHHHHHHhcCcH
Confidence            456899999998888874


No 127
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=34.29  E-value=20  Score=32.22  Aligned_cols=26  Identities=12%  Similarity=-0.121  Sum_probs=19.2

Q ss_pred             ccCCHHHHHHHHHHHHHhhhCCCCCC
Q psy2284          19 RVLDEATRQRRARKALESLESDNFHD   44 (175)
Q Consensus        19 rvlD~~~R~rr~~~rLdaLE~DN~~d   44 (175)
                      ...|..+--.+..+||..|-++|+..
T Consensus        22 ~~p~~~~lf~~RA~RL~~LA~~~pl~   47 (305)
T TIGR01562        22 LHPPLRDLFNRRAERLLQLAEGHPLG   47 (305)
T ss_pred             ecCChhhHHHHHHHHHHHHhccCCHH
Confidence            34577777778888888888777764


No 128
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=34.14  E-value=17  Score=25.67  Aligned_cols=10  Identities=40%  Similarity=1.082  Sum_probs=7.9

Q ss_pred             eecCCCCCcc
Q psy2284         147 YTCVPCGARY  156 (175)
Q Consensus       147 YtC~~Cg~ry  156 (175)
                      |.||+||..-
T Consensus         1 y~C~KCg~~~   10 (64)
T PF09855_consen    1 YKCPKCGNEE   10 (64)
T ss_pred             CCCCCCCCcc
Confidence            7899998753


No 129
>PLN02189 cellulose synthase
Probab=33.89  E-value=20  Score=37.38  Aligned_cols=13  Identities=31%  Similarity=0.767  Sum_probs=7.5

Q ss_pred             CceecCCCCCccc
Q psy2284         145 SNYTCVPCGARYC  157 (175)
Q Consensus       145 ~~YtC~~Cg~ryC  157 (175)
                      |+-.||+|+++|=
T Consensus        75 g~q~CpqCkt~Y~   87 (1040)
T PLN02189         75 GTQNCPQCKTRYK   87 (1040)
T ss_pred             CCccCcccCCchh
Confidence            4445666666664


No 130
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=33.81  E-value=19  Score=24.68  Aligned_cols=20  Identities=20%  Similarity=0.487  Sum_probs=12.7

Q ss_pred             ccceecC---CC------CceecCCCCCc
Q psy2284         136 HFCAVCG---FP------SNYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG---~~------~~YtC~~Cg~r  155 (175)
                      .-|..|+   ..      -..+||+||+-
T Consensus         5 iRC~~CnklLa~~g~~~~leIKCpRC~ti   33 (51)
T PF10122_consen    5 IRCGHCNKLLAKAGEVIELEIKCPRCKTI   33 (51)
T ss_pred             eeccchhHHHhhhcCccEEEEECCCCCcc
Confidence            3577776   22      24569999873


No 131
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=33.37  E-value=24  Score=28.39  Aligned_cols=25  Identities=16%  Similarity=0.422  Sum_probs=15.3

Q ss_pred             CCCcccceecC--C----CCceecCCCCCcc
Q psy2284         132 FPNRHFCAVCG--F----PSNYTCVPCGARY  156 (175)
Q Consensus       132 ~P~r~~C~VCG--~----~~~YtC~~Cg~ry  156 (175)
                      .-..+.|-.||  |    .....||.||.-|
T Consensus         6 lGtKr~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         6 LGTKRICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             hCccccCCCcCccccccCCCCccCCCcCCcc
Confidence            34456777777  2    2345577777755


No 132
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=33.18  E-value=21  Score=28.17  Aligned_cols=13  Identities=31%  Similarity=0.973  Sum_probs=9.9

Q ss_pred             CceecCCCCCccc
Q psy2284         145 SNYTCVPCGARYC  157 (175)
Q Consensus       145 ~~YtC~~Cg~ryC  157 (175)
                      ..|.||.||.+|=
T Consensus        98 ~~Y~Cp~C~~~y~  110 (147)
T smart00531       98 AYYKCPNCQSKYT  110 (147)
T ss_pred             cEEECcCCCCEee
Confidence            4688999988763


No 133
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=33.16  E-value=20  Score=28.17  Aligned_cols=21  Identities=38%  Similarity=0.944  Sum_probs=15.1

Q ss_pred             cccceecC--CCC-----ceecCCCCCc
Q psy2284         135 RHFCAVCG--FPS-----NYTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG--~~~-----~YtC~~Cg~r  155 (175)
                      .|.|.-||  |..     ---||.||-+
T Consensus         2 pH~CtrCG~vf~~g~~~il~GCp~CG~n   29 (112)
T COG3364           2 PHQCTRCGEVFDDGSEEILSGCPKCGCN   29 (112)
T ss_pred             CceecccccccccccHHHHccCccccch
Confidence            47899999  444     1349999865


No 134
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=32.78  E-value=32  Score=23.98  Aligned_cols=20  Identities=30%  Similarity=0.803  Sum_probs=10.8

Q ss_pred             cccceecC--CCCceecCCCCC
Q psy2284         135 RHFCAVCG--FPSNYTCVPCGA  154 (175)
Q Consensus       135 r~~C~VCG--~~~~YtC~~Cg~  154 (175)
                      -..|..||  ..+.-.|+.||.
T Consensus        27 ~~~c~~cG~~~l~Hrvc~~cg~   48 (57)
T COG0333          27 LSVCPNCGEYKLPHRVCLKCGY   48 (57)
T ss_pred             ceeccCCCCcccCceEcCCCCC
Confidence            44566666  334455666663


No 135
>PF08461 HTH_12:  Ribonuclease R winged-helix domain;  InterPro: IPR013668 This domain is found at the amino terminus of Ribonuclease R and a number of presumed transcriptional regulatory proteins from archaea. 
Probab=32.75  E-value=41  Score=23.32  Aligned_cols=23  Identities=22%  Similarity=0.419  Sum_probs=19.0

Q ss_pred             CHHHHHHHHHHHHHhhhCCCCCC
Q psy2284          22 DEATRQRRARKALESLESDNFHD   44 (175)
Q Consensus        22 D~~~R~rr~~~rLdaLE~DN~~d   44 (175)
                      +.+.-.+..+++|.+||+|.|..
T Consensus        27 g~~~se~avRrrLr~me~~Glt~   49 (66)
T PF08461_consen   27 GEELSEEAVRRRLRAMERDGLTR   49 (66)
T ss_pred             ChhhhHHHHHHHHHHHHHCCCcc
Confidence            55566788999999999999765


No 136
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=32.23  E-value=22  Score=37.26  Aligned_cols=22  Identities=41%  Similarity=1.046  Sum_probs=18.0

Q ss_pred             ccceecCCC------------CceecCCCCCccc
Q psy2284         136 HFCAVCGFP------------SNYTCVPCGARYC  157 (175)
Q Consensus       136 ~~C~VCG~~------------~~YtC~~Cg~ryC  157 (175)
                      .-|..|||+            |+-.||.|++||=
T Consensus        37 VAC~eC~FPVCrpCYEYEr~eG~q~CPqCktrYk   70 (1079)
T PLN02638         37 VACDVCAFPVCRPCYEYERKDGNQSCPQCKTKYK   70 (1079)
T ss_pred             EEeccCCCccccchhhhhhhcCCccCCccCCchh
Confidence            568888876            6678999999995


No 137
>PF14753 DUF4475:  Domain of unknown function (DUF4475)
Probab=32.19  E-value=24  Score=30.18  Aligned_cols=18  Identities=33%  Similarity=1.113  Sum_probs=14.4

Q ss_pred             ceecC-CCCceecCCCCCcc
Q psy2284         138 CAVCG-FPSNYTCVPCGARY  156 (175)
Q Consensus       138 C~VCG-~~~~YtC~~Cg~ry  156 (175)
                      |+.|+ |.+.|+|. ||.++
T Consensus       125 ~~~C~~F~S~f~C~-Cd~~~  143 (196)
T PF14753_consen  125 CCGCSGFESSFLCA-CDQPW  143 (196)
T ss_pred             CCCCCCCCCCceec-CcCch
Confidence            45777 99999995 99764


No 138
>PLN02436 cellulose synthase A
Probab=30.94  E-value=24  Score=37.01  Aligned_cols=11  Identities=45%  Similarity=1.081  Sum_probs=5.5

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      +-.||+|+++|
T Consensus        78 ~~~Cpqckt~Y   88 (1094)
T PLN02436         78 NQACPQCKTRY   88 (1094)
T ss_pred             CccCcccCCch
Confidence            33455555555


No 139
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=30.46  E-value=28  Score=21.61  Aligned_cols=10  Identities=40%  Similarity=1.049  Sum_probs=7.5

Q ss_pred             eecCCCCCcc
Q psy2284         147 YTCVPCGARY  156 (175)
Q Consensus       147 YtC~~Cg~ry  156 (175)
                      .+||.|+..|
T Consensus         3 i~CP~C~~~f   12 (37)
T PF13719_consen    3 ITCPNCQTRF   12 (37)
T ss_pred             EECCCCCceE
Confidence            4688888766


No 140
>cd02334 ZZ_dystrophin Zinc finger, ZZ type. Zinc finger present in dystrophin and dystrobrevin. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dystrophin attaches actin filaments to an integral membrane glycoprotein complex in muscle cells. The ZZ domain in dystrophin has been shown to be essential for binding to the membrane protein beta-dystroglycan.
Probab=30.45  E-value=31  Score=23.02  Aligned_cols=31  Identities=23%  Similarity=0.626  Sum_probs=22.5

Q ss_pred             cceecCC---CC-ceecCCCCCccccccccccccc
Q psy2284         137 FCAVCGF---PS-NYTCVPCGARYCCVRCLGTHQD  167 (175)
Q Consensus       137 ~C~VCG~---~~-~YtC~~Cg~ryCS~~C~~~H~e  167 (175)
                      .|.+|+.   .| .|+|..|-...-...|+....+
T Consensus         2 ~Cd~C~~~pi~g~RykC~~C~d~DLC~~Cf~~g~~   36 (49)
T cd02334           2 KCNICKEFPITGFRYRCLKCFNYDLCQSCFFSGRT   36 (49)
T ss_pred             CCCCCCCCCceeeeEECCCCCCcCchHHHHhCCCc
Confidence            4888882   33 8999999888777788754433


No 141
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=29.77  E-value=26  Score=28.24  Aligned_cols=10  Identities=20%  Similarity=0.677  Sum_probs=5.2

Q ss_pred             eecCCCCCcc
Q psy2284         147 YTCVPCGARY  156 (175)
Q Consensus       147 YtC~~Cg~ry  156 (175)
                      |.||.|+.+|
T Consensus       110 Y~Cp~c~~r~  119 (158)
T TIGR00373       110 FICPNMCVRF  119 (158)
T ss_pred             EECCCCCcEe
Confidence            4555555544


No 142
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=29.71  E-value=30  Score=20.31  Aligned_cols=6  Identities=50%  Similarity=1.359  Sum_probs=3.6

Q ss_pred             cCCCCC
Q psy2284         149 CVPCGA  154 (175)
Q Consensus       149 C~~Cg~  154 (175)
                      ||.||-
T Consensus        17 Cp~CG~   22 (26)
T PF10571_consen   17 CPHCGY   22 (26)
T ss_pred             CCCCCC
Confidence            666664


No 143
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=29.60  E-value=25  Score=25.48  Aligned_cols=24  Identities=21%  Similarity=0.629  Sum_probs=14.8

Q ss_pred             CcccceecCCCCceecCCCCCcccccccc
Q psy2284         134 NRHFCAVCGFPSNYTCVPCGARYCCVRCL  162 (175)
Q Consensus       134 ~r~~C~VCG~~~~YtC~~Cg~ryCS~~C~  162 (175)
                      .-..|.+|+-+=.-     ..+|||+.|-
T Consensus        48 ~~~~C~~C~R~L~d-----~~~fCSl~CK   71 (72)
T PF04640_consen   48 SGNICETCHRSLQD-----PYRFCSLSCK   71 (72)
T ss_pred             CCCccCCCCCCCCC-----CCeEEeeeEE
Confidence            44577777732221     1589999994


No 144
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=29.53  E-value=29  Score=21.50  Aligned_cols=10  Identities=50%  Similarity=1.132  Sum_probs=7.6

Q ss_pred             eecCCCCCcc
Q psy2284         147 YTCVPCGARY  156 (175)
Q Consensus       147 YtC~~Cg~ry  156 (175)
                      .+|++|++.|
T Consensus         3 i~Cp~C~~~y   12 (36)
T PF13717_consen    3 ITCPNCQAKY   12 (36)
T ss_pred             EECCCCCCEE
Confidence            4688888876


No 145
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=29.11  E-value=37  Score=21.58  Aligned_cols=29  Identities=28%  Similarity=0.787  Sum_probs=21.8

Q ss_pred             ccceecC---CCCceecCCCCCcccccccccc
Q psy2284         136 HFCAVCG---FPSNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       136 ~~C~VCG---~~~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      ..|.+||   ....|+|..|....=...|+..
T Consensus         5 ~~C~~C~~~i~g~ry~C~~C~d~dlC~~Cf~~   36 (44)
T smart00291        5 YSCDTCGKPIVGVRYHCLVCPDYDLCQSCFAK   36 (44)
T ss_pred             cCCCCCCCCCcCCEEECCCCCCccchHHHHhC
Confidence            4588998   3348999999887777777754


No 146
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.08  E-value=29  Score=30.84  Aligned_cols=20  Identities=35%  Similarity=0.957  Sum_probs=0.0

Q ss_pred             cceecC-CCCcee--cCCCCCcc
Q psy2284         137 FCAVCG-FPSNYT--CVPCGARY  156 (175)
Q Consensus       137 ~C~VCG-~~~~Yt--C~~Cg~ry  156 (175)
                      +|+||. ....+.  |+.||.+|
T Consensus       257 vCs~Clsi~C~~p~~C~~Cgt~f  279 (279)
T TIGR00627       257 VCSVCLSVLCQYTPICKTCKTAF  279 (279)
T ss_pred             ECCCccCCcCCCCCCCCCCCCCC


No 147
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=29.02  E-value=40  Score=21.98  Aligned_cols=31  Identities=19%  Similarity=0.594  Sum_probs=23.0

Q ss_pred             cceecC-CC---CceecCCCCCccccccccccccc
Q psy2284         137 FCAVCG-FP---SNYTCVPCGARYCCVRCLGTHQD  167 (175)
Q Consensus       137 ~C~VCG-~~---~~YtC~~Cg~ryCS~~C~~~H~e  167 (175)
                      -|.+|+ ..   -.|.|..|....-...|+....+
T Consensus         2 ~Cd~C~~~~~~g~r~~C~~C~d~dLC~~Cf~~g~~   36 (49)
T cd02335           2 HCDYCSKDITGTIRIKCAECPDFDLCLECFSAGAE   36 (49)
T ss_pred             CCCCcCCCCCCCcEEECCCCCCcchhHHhhhCcCC
Confidence            388888 22   25899999888777888876655


No 148
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=28.86  E-value=27  Score=28.79  Aligned_cols=17  Identities=29%  Similarity=0.323  Sum_probs=10.8

Q ss_pred             HHHHHHHHhhhCCCCCC
Q psy2284          28 RRARKALESLESDNFHD   44 (175)
Q Consensus        28 rr~~~rLdaLE~DN~~d   44 (175)
                      ...|+.|-.|+.|+...
T Consensus        51 ~~VRk~L~~L~e~gLv~   67 (178)
T PRK06266         51 NTVRKILYKLYDARLAD   67 (178)
T ss_pred             HHHHHHHHHHHHCCCeE
Confidence            45667777777776533


No 149
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=28.86  E-value=28  Score=24.07  Aligned_cols=18  Identities=44%  Similarity=0.922  Sum_probs=7.1

Q ss_pred             CcccceecCCCCceecCCCCC
Q psy2284         134 NRHFCAVCGFPSNYTCVPCGA  154 (175)
Q Consensus       134 ~r~~C~VCG~~~~YtC~~Cg~  154 (175)
                      .+..|.|   --.|+|+-||+
T Consensus        24 G~v~CPv---Lr~y~Cp~CgA   41 (55)
T PF05741_consen   24 GRVTCPV---LRKYVCPICGA   41 (55)
T ss_dssp             S-B--TT---GGG---TTT--
T ss_pred             CCEeCHH---HhcCcCCCCcC
Confidence            3444544   78899999987


No 150
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=28.76  E-value=31  Score=22.67  Aligned_cols=31  Identities=19%  Similarity=0.669  Sum_probs=23.5

Q ss_pred             cceecCC---CC-ceecCCCCCccccccccccccc
Q psy2284         137 FCAVCGF---PS-NYTCVPCGARYCCVRCLGTHQD  167 (175)
Q Consensus       137 ~C~VCG~---~~-~YtC~~Cg~ryCS~~C~~~H~e  167 (175)
                      .|++|+.   .+ .|+|..|....-...|+....+
T Consensus         2 ~C~~C~~~~i~g~R~~C~~C~dydLC~~Cf~~~~~   36 (49)
T cd02345           2 SCSACRKQDISGIRFPCQVCRDYSLCLGCYTKGRE   36 (49)
T ss_pred             cCCCCCCCCceEeeEECCCCCCcCchHHHHhCCCc
Confidence            4788884   23 7899999988888889876644


No 151
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=28.44  E-value=28  Score=36.36  Aligned_cols=22  Identities=50%  Similarity=1.153  Sum_probs=17.6

Q ss_pred             ccceecCCC------------CceecCCCCCccc
Q psy2284         136 HFCAVCGFP------------SNYTCVPCGARYC  157 (175)
Q Consensus       136 ~~C~VCG~~------------~~YtC~~Cg~ryC  157 (175)
                      .-|.+|||+            |+-.||+|+++|=
T Consensus        35 VAC~eC~fpvCr~cyeye~~~g~~~cp~c~t~y~   68 (1044)
T PLN02915         35 VACHVCGFPVCKPCYEYERSEGNQCCPQCNTRYK   68 (1044)
T ss_pred             EEeccCCCccccchhhhhhhcCCccCCccCCchh
Confidence            568888775            5667999999995


No 152
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=27.95  E-value=36  Score=20.93  Aligned_cols=9  Identities=44%  Similarity=1.121  Sum_probs=5.1

Q ss_pred             eecCCCCCc
Q psy2284         147 YTCVPCGAR  155 (175)
Q Consensus       147 YtC~~Cg~r  155 (175)
                      ..|+.||-|
T Consensus        18 irC~~CG~R   26 (32)
T PF03604_consen   18 IRCPECGHR   26 (32)
T ss_dssp             SSBSSSS-S
T ss_pred             EECCcCCCe
Confidence            457777755


No 153
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=27.86  E-value=9.5  Score=31.65  Aligned_cols=25  Identities=24%  Similarity=0.618  Sum_probs=20.3

Q ss_pred             CCCCcccceecCCCCceecCCCCCc
Q psy2284         131 KFPNRHFCAVCGFPSNYTCVPCGAR  155 (175)
Q Consensus       131 ~~P~r~~C~VCG~~~~YtC~~Cg~r  155 (175)
                      .-+...||+-||..-.-.||.|+..
T Consensus        24 p~~~~~fC~kCG~~tI~~Cp~C~~~   48 (158)
T PF10083_consen   24 PELREKFCSKCGAKTITSCPNCSTP   48 (158)
T ss_pred             chHHHHHHHHhhHHHHHHCcCCCCC
Confidence            3456679999998888899999764


No 154
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=27.81  E-value=24  Score=22.57  Aligned_cols=24  Identities=38%  Similarity=0.963  Sum_probs=16.1

Q ss_pred             CCCcccceecC--CC----CceecCCCCCc
Q psy2284         132 FPNRHFCAVCG--FP----SNYTCVPCGAR  155 (175)
Q Consensus       132 ~P~r~~C~VCG--~~----~~YtC~~Cg~r  155 (175)
                      +....+|.+|+  .|    ..|.|..|+..
T Consensus         8 ~~~~~~C~~C~~~i~g~~~~g~~C~~C~~~   37 (53)
T PF00130_consen    8 FSKPTYCDVCGKFIWGLGKQGYRCSWCGLV   37 (53)
T ss_dssp             SSSTEB-TTSSSBECSSSSCEEEETTTT-E
T ss_pred             CCCCCCCcccCcccCCCCCCeEEECCCCCh
Confidence            46677999999  32    27889988863


No 155
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=27.80  E-value=25  Score=19.98  Aligned_cols=11  Identities=36%  Similarity=1.096  Sum_probs=7.1

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      .|.|+.|+..|
T Consensus        14 ~~~C~~C~k~F   24 (26)
T PF13465_consen   14 PYKCPYCGKSF   24 (26)
T ss_dssp             SEEESSSSEEE
T ss_pred             CCCCCCCcCee
Confidence            37777777554


No 156
>KOG4850|consensus
Probab=27.50  E-value=29  Score=29.32  Aligned_cols=16  Identities=38%  Similarity=1.221  Sum_probs=15.2

Q ss_pred             ceecCCCCCccccccc
Q psy2284         146 NYTCVPCGARYCCVRC  161 (175)
Q Consensus       146 ~YtC~~Cg~ryCS~~C  161 (175)
                      -|.|+.||.--|...|
T Consensus       149 ~Y~C~~CGSTkCG~~C  164 (190)
T KOG4850|consen  149 HYPCKQCGSTKCGIGC  164 (190)
T ss_pred             eecccccccccccccc
Confidence            6899999999999999


No 157
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=27.22  E-value=16  Score=23.12  Aligned_cols=18  Identities=39%  Similarity=0.829  Sum_probs=8.2

Q ss_pred             CcccceecCCCCc-eecCC
Q psy2284         134 NRHFCAVCGFPSN-YTCVP  151 (175)
Q Consensus       134 ~r~~C~VCG~~~~-YtC~~  151 (175)
                      ..++|.+||+++. -.|.=
T Consensus        16 ~i~~C~~C~nlse~~~C~I   34 (41)
T PF02132_consen   16 NIKFCSICGNLSEEDPCEI   34 (41)
T ss_dssp             H-EE-SSS--EESSSS-HH
T ss_pred             cCCccCCCCCcCCCCcCcC
Confidence            3579999997663 33543


No 158
>KOG1356|consensus
Probab=27.13  E-value=30  Score=35.50  Aligned_cols=35  Identities=26%  Similarity=0.695  Sum_probs=26.7

Q ss_pred             CCCCCcccceecC---CCCceecCCCCCccccccccccc
Q psy2284         130 SKFPNRHFCAVCG---FPSNYTCVPCGARYCCVRCLGTH  165 (175)
Q Consensus       130 s~~P~r~~C~VCG---~~~~YtC~~Cg~ryCS~~C~~~H  165 (175)
                      +.+-.+..|.+|.   |.-...|++||.+|| +.|++.-
T Consensus       224 a~~g~~~mC~~C~~tlfn~hw~C~~C~~~~C-l~C~r~~  261 (889)
T KOG1356|consen  224 AVKGIREMCDRCETTLFNIHWRCPRCGFGVC-LDCYRKW  261 (889)
T ss_pred             cccCcchhhhhhcccccceeEEccccCCeee-ecchhhc
Confidence            4467788999999   333567999999977 6777654


No 159
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=27.07  E-value=28  Score=24.59  Aligned_cols=20  Identities=30%  Similarity=0.883  Sum_probs=14.5

Q ss_pred             ccceecC-CCCceecCCCCCc
Q psy2284         136 HFCAVCG-FPSNYTCVPCGAR  155 (175)
Q Consensus       136 ~~C~VCG-~~~~YtC~~Cg~r  155 (175)
                      ..|.-|| |.=+-+||.||..
T Consensus         6 rkC~~cg~YTLke~Cp~CG~~   26 (59)
T COG2260           6 RKCPKCGRYTLKEKCPVCGGD   26 (59)
T ss_pred             hcCcCCCceeecccCCCCCCc
Confidence            4577788 6666778888864


No 160
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=26.87  E-value=35  Score=23.75  Aligned_cols=20  Identities=30%  Similarity=0.808  Sum_probs=13.5

Q ss_pred             cceecCCCCcee-cCCCCCcc
Q psy2284         137 FCAVCGFPSNYT-CVPCGARY  156 (175)
Q Consensus       137 ~C~VCG~~~~Yt-C~~Cg~ry  156 (175)
                      +|--|=--.+|. ||=||.++
T Consensus        29 I~~~~f~~~rYngCPfC~~~~   49 (55)
T PF14447_consen   29 ICDNCFPGERYNGCPFCGTPF   49 (55)
T ss_pred             eeccccChhhccCCCCCCCcc
Confidence            444443444888 99999875


No 161
>PRK00807 50S ribosomal protein L24e; Validated
Probab=26.84  E-value=31  Score=23.20  Aligned_cols=39  Identities=28%  Similarity=0.562  Sum_probs=21.8

Q ss_pred             ccceecC---CCCcee--cCCC--CCccccccccccc---ccccccccc
Q psy2284         136 HFCAVCG---FPSNYT--CVPC--GARYCCVRCLGTH---QDTRCLKWT  174 (175)
Q Consensus       136 ~~C~VCG---~~~~Yt--C~~C--g~ryCS~~C~~~H---~etRC~K~~  174 (175)
                      +.|++||   ++|.-.  =..=  -.+|||.+|...+   ..-|=++||
T Consensus         2 ~~C~fcG~~I~pg~G~~~vr~Dgkv~~Fcs~KC~~~f~~~~nprk~~WT   50 (52)
T PRK00807          2 RTCSFCGKEIEPGTGKMYVKKDGTILYFCSSKCEKNYKLGRVPRKLKWT   50 (52)
T ss_pred             cccCCCCCeEcCCCCeEEEEeCCcEEEEeCHHHHHHHHccCCCCccccc
Confidence            5799999   544311  1111  1257999998743   335555554


No 162
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.38  E-value=19  Score=29.50  Aligned_cols=21  Identities=33%  Similarity=0.793  Sum_probs=17.1

Q ss_pred             cccceecCCCCceecCCCCCc
Q psy2284         135 RHFCAVCGFPSNYTCVPCGAR  155 (175)
Q Consensus       135 r~~C~VCG~~~~YtC~~Cg~r  155 (175)
                      -.||+-||..-.-.||.|.+.
T Consensus        28 eafcskcgeati~qcp~csas   48 (160)
T COG4306          28 EAFCSKCGEATITQCPICSAS   48 (160)
T ss_pred             HHHHhhhchHHHhcCCccCCc
Confidence            459999998888889999763


No 163
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=26.21  E-value=40  Score=23.22  Aligned_cols=24  Identities=33%  Similarity=0.892  Sum_probs=16.3

Q ss_pred             CCCCcccceecC---CC----CceecCCCCC
Q psy2284         131 KFPNRHFCAVCG---FP----SNYTCVPCGA  154 (175)
Q Consensus       131 ~~P~r~~C~VCG---~~----~~YtC~~Cg~  154 (175)
                      ..-..+||.-||   |-    -.|.|-+||-
T Consensus        15 v~rk~~~CPrCG~gvfmA~H~dR~~CGkCgy   45 (51)
T COG1998          15 VKRKNRFCPRCGPGVFMADHKDRWACGKCGY   45 (51)
T ss_pred             EEEccccCCCCCCcchhhhcCceeEeccccc
Confidence            345667888888   22    2677888874


No 164
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=25.81  E-value=23  Score=36.42  Aligned_cols=38  Identities=32%  Similarity=0.827  Sum_probs=0.0

Q ss_pred             CcccceecCCCCcee-cCCCCCc----cccccccccccccccc
Q psy2284         134 NRHFCAVCGFPSNYT-CVPCGAR----YCCVRCLGTHQDTRCL  171 (175)
Q Consensus       134 ~r~~C~VCG~~~~Yt-C~~Cg~r----yCS~~C~~~H~etRC~  171 (175)
                      .+..|.-||..+-+. |+.||.+    |=+-.|.....+..|.
T Consensus       654 ~~r~Cp~Cg~~t~~~~Cp~CG~~T~~~~~Cp~C~~~~~~~~C~  696 (900)
T PF03833_consen  654 GRRRCPKCGKETFYNRCPECGSHTEPVYVCPDCGIEVEEDECP  696 (900)
T ss_dssp             -------------------------------------------
T ss_pred             ecccCcccCCcchhhcCcccCCccccceeccccccccCccccc
Confidence            466899999777554 9999986    3334576665555554


No 165
>PLN02400 cellulose synthase
Probab=25.13  E-value=34  Score=35.94  Aligned_cols=11  Identities=36%  Similarity=0.948  Sum_probs=5.6

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      +-.||.|.+||
T Consensus        78 nq~CPQCkTrY   88 (1085)
T PLN02400         78 TQCCPQCKTRY   88 (1085)
T ss_pred             CccCcccCCcc
Confidence            33455555555


No 166
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=24.89  E-value=49  Score=21.40  Aligned_cols=9  Identities=44%  Similarity=1.184  Sum_probs=4.4

Q ss_pred             CceecCCCC
Q psy2284         145 SNYTCVPCG  153 (175)
Q Consensus       145 ~~YtC~~Cg  153 (175)
                      ++..|+.|+
T Consensus        33 g~~~Cv~C~   41 (41)
T PF06677_consen   33 GKIYCVSCG   41 (41)
T ss_pred             CCEECCCCC
Confidence            344455553


No 167
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=24.77  E-value=26  Score=31.69  Aligned_cols=24  Identities=25%  Similarity=0.750  Sum_probs=20.3

Q ss_pred             ccceecCCCCceecCCCCCccccc
Q psy2284         136 HFCAVCGFPSNYTCVPCGARYCCV  159 (175)
Q Consensus       136 ~~C~VCG~~~~YtC~~Cg~ryCS~  159 (175)
                      .-|..|+..|.|+|.+|-+-||--
T Consensus       172 ~KC~SCNrlGq~sCLRCK~cfCdd  195 (314)
T PF06524_consen  172 FKCQSCNRLGQYSCLRCKICFCDD  195 (314)
T ss_pred             ccccccccccchhhhheeeeehhh
Confidence            358889999999999999988853


No 168
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=24.75  E-value=21  Score=27.06  Aligned_cols=35  Identities=29%  Similarity=0.731  Sum_probs=22.6

Q ss_pred             CCCcccceecC-CCCceecCCCCCccccccccccccc
Q psy2284         132 FPNRHFCAVCG-FPSNYTCVPCGARYCCVRCLGTHQD  167 (175)
Q Consensus       132 ~P~r~~C~VCG-~~~~YtC~~Cg~ryCS~~C~~~H~e  167 (175)
                      .|.-+.|.-|| ..+.|.|+.=|...| ..|-.+|+.
T Consensus        10 ~~~N~~CaDCg~~~p~w~s~~~GiflC-~~Cag~HR~   45 (116)
T PF01412_consen   10 KPGNKVCADCGAPNPTWASLNYGIFLC-LECAGIHRS   45 (116)
T ss_dssp             STTCTB-TTT-SBS--EEETTTTEEE--HHHHHHHHH
T ss_pred             CcCcCcCCCCCCCCCCEEEeecChhhh-HHHHHHHHH
Confidence            46678999999 445888888776655 578888876


No 169
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=24.68  E-value=27  Score=25.44  Aligned_cols=26  Identities=27%  Similarity=0.677  Sum_probs=10.7

Q ss_pred             CCCCcccceecC-------------CCCceecCCCCCcc
Q psy2284         131 KFPNRHFCAVCG-------------FPSNYTCVPCGARY  156 (175)
Q Consensus       131 ~~P~r~~C~VCG-------------~~~~YtC~~Cg~ry  156 (175)
                      .+|...-|-.||             ..|..+|-.||..|
T Consensus        18 ~l~~~F~CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~   56 (81)
T PF05129_consen   18 KLPKVFDCPFCNHEKSVSVKIDKKEGIGILSCRVCGESF   56 (81)
T ss_dssp             --SS----TTT--SS-EEEEEETTTTEEEEEESSS--EE
T ss_pred             CCCceEcCCcCCCCCeEEEEEEccCCEEEEEecCCCCeE
Confidence            355566677777             23456677777765


No 170
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=24.52  E-value=36  Score=26.86  Aligned_cols=25  Identities=28%  Similarity=0.632  Sum_probs=18.4

Q ss_pred             ccCCCCCccccccCCCCCCCcccceecCCCCceecCCCCCcc
Q psy2284         115 LNSQGSAYENAEAKPSKFPNRHFCAVCGFPSNYTCVPCGARY  156 (175)
Q Consensus       115 ~~~~~p~Y~~a~a~ps~~P~r~~C~VCG~~~~YtC~~Cg~ry  156 (175)
                      +|.+..+|.....                 |.+.||.||..+
T Consensus        35 Ln~~~LdyV~ie~-----------------G~t~CP~Cg~~~   59 (115)
T COG1885          35 LNKPDLDYVEIEV-----------------GSTSCPKCGEPF   59 (115)
T ss_pred             hccCCCCeEEEec-----------------ccccCCCCCCcc
Confidence            5667788988873                 556788888765


No 171
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=23.97  E-value=40  Score=25.86  Aligned_cols=10  Identities=40%  Similarity=1.129  Sum_probs=5.9

Q ss_pred             CceecCCCCC
Q psy2284         145 SNYTCVPCGA  154 (175)
Q Consensus       145 ~~YtC~~Cg~  154 (175)
                      ..|.|+.||.
T Consensus       142 ~~~~C~~C~~  151 (157)
T PF10263_consen  142 KRYRCGRCGG  151 (157)
T ss_pred             hhEECCCCCC
Confidence            3566666664


No 172
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=23.72  E-value=42  Score=31.04  Aligned_cols=22  Identities=18%  Similarity=0.529  Sum_probs=15.9

Q ss_pred             cccceecCC----CCceecCCCCCcc
Q psy2284         135 RHFCAVCGF----PSNYTCVPCGARY  156 (175)
Q Consensus       135 r~~C~VCG~----~~~YtC~~Cg~ry  156 (175)
                      ...|..||.    .....|||||...
T Consensus       215 ~~~C~~Cd~~~~~~~~a~CpRC~~~L  240 (403)
T TIGR00155       215 LRSCSACHTTILPAQEPVCPRCSTPL  240 (403)
T ss_pred             CCcCCCCCCccCCCCCcCCcCCCCcc
Confidence            445999995    2355699999864


No 173
>PF05715 zf-piccolo:  Piccolo Zn-finger;  InterPro: IPR008899 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This (predicted) zinc finger is found in the bassoon and piccolo proteins, both of which are components of the presynaptic cytoskeletal matrix (PCM) assembled at the active zone of neurotransmitter release, where Piccolo plays a role in the trafficking of synaptic vesicles (SVs) [, , ]. The Piccolo zinc fingers were found to interact with the dual prenylated rab3A and VAMP2/Synaptobrevin II receptor PRA1. There are eight conserved cysteines in Piccolo-type zinc fingers, suggesting that they coordinates two zinc ligands. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding, 0045202 synapse
Probab=23.59  E-value=36  Score=24.19  Aligned_cols=27  Identities=19%  Similarity=0.472  Sum_probs=18.2

Q ss_pred             hccCCCCCccccccCCCCCCCcccceecCCCC
Q psy2284         114 ALNSQGSAYENAEAKPSKFPNRHFCAVCGFPS  145 (175)
Q Consensus       114 ~~~~~~p~Y~~a~a~ps~~P~r~~C~VCG~~~  145 (175)
                      ....+.|||.+..     -=....|..|||..
T Consensus        14 ~gsk~~pNyntCT-----~Ck~~VCnlCGFNP   40 (61)
T PF05715_consen   14 VGSKDPPNYNTCT-----ECKSQVCNLCGFNP   40 (61)
T ss_pred             cCCCCCCCccHHH-----HHhhhhhcccCCCC
Confidence            3445778998876     23445789999654


No 174
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=23.50  E-value=41  Score=21.60  Aligned_cols=11  Identities=45%  Similarity=1.434  Sum_probs=8.4

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      .|.|..||..|
T Consensus         5 ey~C~~Cg~~f   15 (52)
T TIGR02605         5 EYRCTACGHRF   15 (52)
T ss_pred             EEEeCCCCCEe
Confidence            47888898854


No 175
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.48  E-value=73  Score=22.71  Aligned_cols=27  Identities=30%  Similarity=0.559  Sum_probs=22.7

Q ss_pred             CCCCCCcccceecCCCCceecCCCCCcc
Q psy2284         129 PSKFPNRHFCAVCGFPSNYTCVPCGARY  156 (175)
Q Consensus       129 ps~~P~r~~C~VCG~~~~YtC~~Cg~ry  156 (175)
                      ++.--+|.|=.+ |..+...||=||++|
T Consensus        32 ~p~~HPrV~L~m-g~~gev~CPYC~t~y   58 (62)
T COG4391          32 PPNDHPRVFLDM-GDEGEVVCPYCSTRY   58 (62)
T ss_pred             CCCCCCEEEEEc-CCCCcEecCccccEE
Confidence            336678888888 999999999999987


No 176
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=23.47  E-value=42  Score=21.13  Aligned_cols=20  Identities=35%  Similarity=1.004  Sum_probs=11.0

Q ss_pred             cceecCCCC----ceecCCCCCcc
Q psy2284         137 FCAVCGFPS----NYTCVPCGARY  156 (175)
Q Consensus       137 ~C~VCG~~~----~YtC~~Cg~ry  156 (175)
                      +|.|||...    -..|-.|+..|
T Consensus         1 ~C~vC~~~~~~~~~i~C~~C~~~~   24 (51)
T PF00628_consen    1 YCPVCGQSDDDGDMIQCDSCNRWY   24 (51)
T ss_dssp             EBTTTTSSCTTSSEEEBSTTSCEE
T ss_pred             eCcCCCCcCCCCCeEEcCCCChhh
Confidence            477777421    33377776543


No 177
>KOG2807|consensus
Probab=23.07  E-value=64  Score=30.08  Aligned_cols=32  Identities=22%  Similarity=0.747  Sum_probs=26.2

Q ss_pred             cCCCCCCCcccceecC----CCCceecCCCCCcccc
Q psy2284         127 AKPSKFPNRHFCAVCG----FPSNYTCVPCGARYCC  158 (175)
Q Consensus       127 a~ps~~P~r~~C~VCG----~~~~YtC~~Cg~ryCS  158 (175)
                      .|...++.-.+|-+|+    -.+.|+|..|-.-||.
T Consensus       322 ip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~~FCl  357 (378)
T KOG2807|consen  322 IPETEYNGSRFCFACQGELLSSGRYRCESCKNVFCL  357 (378)
T ss_pred             ccccccCCCcceeeeccccCCCCcEEchhccceeec
Confidence            4566788888999993    5569999999999885


No 178
>KOG1802|consensus
Probab=22.87  E-value=38  Score=34.57  Aligned_cols=29  Identities=34%  Similarity=0.764  Sum_probs=22.8

Q ss_pred             CCCcccceecC-CC--CceecCCCCCcccccc
Q psy2284         132 FPNRHFCAVCG-FP--SNYTCVPCGARYCCVR  160 (175)
Q Consensus       132 ~P~r~~C~VCG-~~--~~YtC~~Cg~ryCS~~  160 (175)
                      .-+++.|.-|| ..  ....|+.||.++|-.+
T Consensus        57 ~~~~~~c~Ycgi~~p~~v~kc~~c~Kwfcn~r   88 (935)
T KOG1802|consen   57 KLPEHACAYCGISEPACVIKCNTCGKWFCNSR   88 (935)
T ss_pred             ccchhhhhhccCCCchheeeccccCceeecCC
Confidence            56789999999 33  3556999999999654


No 179
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=22.73  E-value=38  Score=22.04  Aligned_cols=12  Identities=33%  Similarity=0.772  Sum_probs=9.3

Q ss_pred             cccceecCCCCc
Q psy2284         135 RHFCAVCGFPSN  146 (175)
Q Consensus       135 r~~C~VCG~~~~  146 (175)
                      ..||..||..|.
T Consensus        31 p~~C~~C~~~gH   42 (49)
T PF14392_consen   31 PRFCFHCGRIGH   42 (49)
T ss_pred             ChhhcCCCCcCc
Confidence            468999997764


No 180
>PF07966 A1_Propeptide:  A1 Propeptide ;  InterPro: IPR012848 Most eukaryotic endopeptidases (MEROPS peptidase family A1) are synthesised with signal and propeptides. The animal pepsin-like endopeptidase propeptides form a distinct family of propeptides, which contain a conserved motif approximately 30 residues long. In pepsinogen A, the first 11 residues of the mature pepsin sequence are displaced by residues of the propeptide. The propeptide contains two helices that block the active site cleft, in particular the conserved Asp11 residue, in pepsin, hydrogen bonds to a conserved Arg residue in the propeptide. This hydrogen bond stabilises the propeptide conformation and is probably responsible for triggering the conversion of pepsinogen to pepsin under acidic conditions [, ]. ; GO: 0004190 aspartic-type endopeptidase activity, 0006508 proteolysis; PDB: 1AVF_Q 1HTR_P 3PSG_A 2PSG_A 3VCM_Q 1TZS_P.
Probab=22.69  E-value=30  Score=20.60  Aligned_cols=24  Identities=13%  Similarity=0.155  Sum_probs=14.7

Q ss_pred             cccccccchhhhhhccccHHHHHH
Q psy2284          87 GLFHKTNQQNYIFRFRKSLAQMIE  110 (175)
Q Consensus        87 ~~~~~~~~~~~ilr~rKnf~~lle  110 (175)
                      =+||+.+|-|..|+..-.+..+|.
T Consensus         4 IPL~K~kS~R~~L~e~g~~~~flk   27 (29)
T PF07966_consen    4 IPLKKFKSMRETLREKGTLEEFLK   27 (29)
T ss_dssp             EEEEE---HHHHHHHTT-HHHHHC
T ss_pred             EeccCCchHHHHHHHcCchHHHHH
Confidence            368888888888887777766654


No 181
>cd06970 NR_DBD_PNR DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. DNA-binding domain of the photoreceptor cell-specific nuclear receptor (PNR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. PNR interacts with specific DNA sites upstream of the target gene and modulates the rate of transcriptional initiation.  PNR is a member of the nuclear receptor superfamily of the ligand-activated transcription factors. PNR is expressed only in the outer layer of retinal photoreceptor cells. It may be involved in the signaling pathway regulating photoreceptor differentiation and/or maintenance. It most likely binds to DNA as a homodimer. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, PNR  has  a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hing
Probab=22.57  E-value=36  Score=25.30  Aligned_cols=24  Identities=29%  Similarity=0.740  Sum_probs=15.3

Q ss_pred             CCcccceecCCC------CceecCCCCCcc
Q psy2284         133 PNRHFCAVCGFP------SNYTCVPCGARY  156 (175)
Q Consensus       133 P~r~~C~VCG~~------~~YtC~~Cg~ry  156 (175)
                      +|...|.|||.+      |.++|-.|...|
T Consensus         4 ~p~~~C~VCg~~a~g~hyGv~sC~aCk~FF   33 (92)
T cd06970           4 NPGLLCRVCGDTSSGKHYGIYACNGCSGFF   33 (92)
T ss_pred             CCCCCCeecCCcCcccEECccEEeeeeeEe
Confidence            445579999843      344577776643


No 182
>PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional
Probab=22.41  E-value=48  Score=32.94  Aligned_cols=36  Identities=25%  Similarity=0.695  Sum_probs=29.6

Q ss_pred             CCCcccceecC-CCCceecCCCCCcccccccccccccc
Q psy2284         132 FPNRHFCAVCG-FPSNYTCVPCGARYCCVRCLGTHQDT  168 (175)
Q Consensus       132 ~P~r~~C~VCG-~~~~YtC~~Cg~ryCS~~C~~~H~et  168 (175)
                      .|.-+.|.-|| ....|.|...|...| +.|-.+|+..
T Consensus        20 lPgNk~CADCgs~~P~WASiNlGIFIC-i~CSGIHRsL   56 (648)
T PLN03119         20 LPPNRRCINCNSLGPQYVCTTFWTFVC-MACSGIHREF   56 (648)
T ss_pred             CcCCCccccCCCCCCCceeeccceEEe-ccchhhhccC
Confidence            56678999999 556899999999888 5899999873


No 183
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=21.65  E-value=44  Score=35.06  Aligned_cols=22  Identities=27%  Similarity=0.561  Sum_probs=17.6

Q ss_pred             CcccceecC-CCCceecCCCCCc
Q psy2284         134 NRHFCAVCG-FPSNYTCVPCGAR  155 (175)
Q Consensus       134 ~r~~C~VCG-~~~~YtC~~Cg~r  155 (175)
                      .++.|.-|| +--...||.||.+
T Consensus       624 ~~RKCPkCG~yTlk~rCP~CG~~  646 (1095)
T TIGR00354       624 AIRKCPQCGKESFWLKCPVCGEL  646 (1095)
T ss_pred             EEEECCCCCcccccccCCCCCCc
Confidence            457899999 5557779999986


No 184
>PRK05978 hypothetical protein; Provisional
Probab=21.54  E-value=46  Score=27.13  Aligned_cols=23  Identities=30%  Similarity=0.765  Sum_probs=15.4

Q ss_pred             CcccceecCC----CC----ceecCCCCCcc
Q psy2284         134 NRHFCAVCGF----PS----NYTCVPCGARY  156 (175)
Q Consensus       134 ~r~~C~VCG~----~~----~YtC~~Cg~ry  156 (175)
                      -+..|-.||.    .+    +-+|+.||..|
T Consensus        32 l~grCP~CG~G~LF~g~Lkv~~~C~~CG~~~   62 (148)
T PRK05978         32 FRGRCPACGEGKLFRAFLKPVDHCAACGEDF   62 (148)
T ss_pred             HcCcCCCCCCCcccccccccCCCccccCCcc
Confidence            3567888882    22    33599998876


No 185
>KOG2907|consensus
Probab=21.45  E-value=43  Score=26.58  Aligned_cols=11  Identities=36%  Similarity=0.978  Sum_probs=8.8

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      -|+|++|+-++
T Consensus       102 FYTC~kC~~k~  112 (116)
T KOG2907|consen  102 FYTCPKCKYKF  112 (116)
T ss_pred             EEEcCccceee
Confidence            48999998764


No 186
>KOG4602|consensus
Probab=21.35  E-value=37  Score=30.70  Aligned_cols=16  Identities=44%  Similarity=1.169  Sum_probs=12.5

Q ss_pred             CceecCCCCC--------cccccc
Q psy2284         145 SNYTCVPCGA--------RYCCVR  160 (175)
Q Consensus       145 ~~YtC~~Cg~--------ryCS~~  160 (175)
                      -.|.||-||+        +||.+.
T Consensus       267 R~YVCPiCGATgDnAHTiKyCPl~  290 (318)
T KOG4602|consen  267 RSYVCPICGATGDNAHTIKYCPLA  290 (318)
T ss_pred             hhhcCccccccCCcccceeccccc
Confidence            3589999997        688765


No 187
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.25  E-value=45  Score=31.47  Aligned_cols=23  Identities=30%  Similarity=0.853  Sum_probs=14.8

Q ss_pred             CCcccceecCCCC--ceecCCCCCc
Q psy2284         133 PNRHFCAVCGFPS--NYTCVPCGAR  155 (175)
Q Consensus       133 P~r~~C~VCG~~~--~YtC~~Cg~r  155 (175)
                      ...-.|.-||+..  ...||.||..
T Consensus       238 ~~~l~Ch~Cg~~~~~~~~Cp~C~s~  262 (505)
T TIGR00595       238 EGKLRCHYCGYQEPIPKTCPQCGSE  262 (505)
T ss_pred             CCeEEcCCCcCcCCCCCCCCCCCCC
Confidence            3455788888554  3458888763


No 188
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=21.18  E-value=61  Score=21.35  Aligned_cols=28  Identities=25%  Similarity=0.715  Sum_probs=20.6

Q ss_pred             cceecC---CC-CceecCCCCCcccccccccc
Q psy2284         137 FCAVCG---FP-SNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       137 ~C~VCG---~~-~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      .|..|+   .. ..|+|..|.-..-...|+..
T Consensus         2 ~Cd~C~~~pI~G~RykC~~C~dyDLC~~Cf~~   33 (45)
T cd02344           2 TCDGCQMFPINGPRFKCRNCDDFDFCENCFKT   33 (45)
T ss_pred             CCCCCCCCCCccCeEECCCCCCccchHHhhCC
Confidence            477787   33 38999999887777777754


No 189
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=21.14  E-value=49  Score=20.94  Aligned_cols=11  Identities=36%  Similarity=1.222  Sum_probs=8.3

Q ss_pred             ceecCCCCCcc
Q psy2284         146 NYTCVPCGARY  156 (175)
Q Consensus       146 ~YtC~~Cg~ry  156 (175)
                      .|.|..||..+
T Consensus         5 ey~C~~Cg~~f   15 (42)
T PF09723_consen    5 EYRCEECGHEF   15 (42)
T ss_pred             EEEeCCCCCEE
Confidence            47899999654


No 190
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=21.10  E-value=49  Score=21.95  Aligned_cols=29  Identities=21%  Similarity=0.464  Sum_probs=19.0

Q ss_pred             cceecCC---CC-ceecCCCCCccccccccccc
Q psy2284         137 FCAVCGF---PS-NYTCVPCGARYCCVRCLGTH  165 (175)
Q Consensus       137 ~C~VCG~---~~-~YtC~~Cg~ryCS~~C~~~H  165 (175)
                      .|-.||.   .| .|+|..|.-..-...|+.-+
T Consensus         2 ~CDgCg~~PI~G~RykC~~C~dyDLC~~C~~~~   34 (43)
T cd02342           2 QCDGCGVLPITGPRYKSKVKEDYDLCTICFSRM   34 (43)
T ss_pred             CCCCCCCCcccccceEeCCCCCCccHHHHhhhh
Confidence            4778882   23 88899887765555565443


No 191
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=20.89  E-value=50  Score=25.10  Aligned_cols=31  Identities=32%  Similarity=0.648  Sum_probs=21.1

Q ss_pred             CcccceecCC----C--CceecCCCCCccccccccccc
Q psy2284         134 NRHFCAVCGF----P--SNYTCVPCGARYCCVRCLGTH  165 (175)
Q Consensus       134 ~r~~C~VCG~----~--~~YtC~~Cg~ryCS~~C~~~H  165 (175)
                      ..+.|..|+.    .  ..-.|..|+.+.|+. |...+
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~-C~~~~   89 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKK-CGVYS   89 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETT-SEEET
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCc-cCCcC
Confidence            4558999972    2  356699999999976 65543


No 192
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=20.57  E-value=31  Score=22.65  Aligned_cols=30  Identities=27%  Similarity=0.595  Sum_probs=19.1

Q ss_pred             ccceecCCCCceecCCCCCccccccccccccc
Q psy2284         136 HFCAVCGFPSNYTCVPCGARYCCVRCLGTHQD  167 (175)
Q Consensus       136 ~~C~VCG~~~~YtC~~Cg~ryCS~~C~~~H~e  167 (175)
                      -||.||+..-.-  +.=+.-|||-.|.....+
T Consensus         7 ~yC~~Cdk~~~~--~~~~~lYCSe~Cr~~D~~   36 (43)
T PF12855_consen    7 DYCIVCDKQIDP--PDDGSLYCSEECRLKDQE   36 (43)
T ss_pred             hHHHHhhccccC--CCCCccccCHHHHhHhhh
Confidence            488999832211  222678999999765443


No 193
>cd06966 NR_DBD_CAR DNA-binding domain of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. DNA-binding domain (DBD) of constitutive androstane receptor (CAR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. CAR DBD interacts with CAR response element, a perfect repeat of two AGTTCA motifs with a 4 bp spacer upstream of the target gene, and modulates the rate of transcriptional initiation. The constitutive androstane receptor (CAR) is a ligand-regulated transcription factor that responds to a diverse array of chemically distinct ligands, including many endogenous compounds and clinical drugs. It functions as a heterodimer with RXR. The CAR/RXR heterodimer binds many common response elements in the promoter regions of a diverse set of target genes involved in the metabolism, transport, and ultimately, elimination of these molecules from the body. CAR is a closest mammalian 
Probab=20.52  E-value=44  Score=24.82  Aligned_cols=20  Identities=40%  Similarity=0.941  Sum_probs=12.5

Q ss_pred             cceecCCC------CceecCCCCCcc
Q psy2284         137 FCAVCGFP------SNYTCVPCGARY  156 (175)
Q Consensus       137 ~C~VCG~~------~~YtC~~Cg~ry  156 (175)
                      .|.|||.+      |-++|-.|.+.|
T Consensus         2 ~C~VCg~~a~g~hyGv~sC~aC~~FF   27 (94)
T cd06966           2 ICGVCGDKALGYNFNAITCESCKAFF   27 (94)
T ss_pred             CCeeCCCcCcceEECcceeeeehhee
Confidence            58899843      234577776643


No 194
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=20.50  E-value=62  Score=26.37  Aligned_cols=22  Identities=23%  Similarity=0.619  Sum_probs=17.2

Q ss_pred             cccceecCC------CCceecCCCCCcc
Q psy2284         135 RHFCAVCGF------PSNYTCVPCGARY  156 (175)
Q Consensus       135 r~~C~VCG~------~~~YtC~~Cg~ry  156 (175)
                      ..+|..||-      |..-.|+.||.++
T Consensus       149 ~a~~~~~g~~~~~~~~~~~~c~~~~~~e  176 (189)
T PRK09521        149 YAMCSRCRTPLVKKGENELKCPNCGNIE  176 (189)
T ss_pred             EEEccccCCceEECCCCEEECCCCCCEE
Confidence            347999994      6677899999865


No 195
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=20.47  E-value=29  Score=19.19  Aligned_cols=24  Identities=25%  Similarity=0.856  Sum_probs=16.7

Q ss_pred             eecCCCCCcccccccccccccccc
Q psy2284         147 YTCVPCGARYCCVRCLGTHQDTRC  170 (175)
Q Consensus       147 YtC~~Cg~ryCS~~C~~~H~etRC  170 (175)
                      |.|..|+..|-+..=+..|..+-|
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCccCCccCChhHHHHHhHHhc
Confidence            788888888877666655554433


No 196
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=20.27  E-value=58  Score=20.75  Aligned_cols=28  Identities=25%  Similarity=0.655  Sum_probs=19.0

Q ss_pred             cceecC--CC-CceecCCCCCcccccccccc
Q psy2284         137 FCAVCG--FP-SNYTCVPCGARYCCVRCLGT  164 (175)
Q Consensus       137 ~C~VCG--~~-~~YtC~~Cg~ryCS~~C~~~  164 (175)
                      .|.+|+  .+ -.|.|..|....-...|+..
T Consensus         2 ~C~~C~~~i~g~r~~C~~C~d~dLC~~Cf~~   32 (46)
T cd02249           2 SCDGCLKPIVGVRYHCLVCEDFDLCSSCYAK   32 (46)
T ss_pred             CCcCCCCCCcCCEEECCCCCCCcCHHHHHCc
Confidence            478888  23 37889999876655666543


No 197
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=20.20  E-value=53  Score=35.27  Aligned_cols=22  Identities=32%  Similarity=0.841  Sum_probs=14.1

Q ss_pred             cccceecCCCC-ceecCCCCCcc
Q psy2284         135 RHFCAVCGFPS-NYTCVPCGARY  156 (175)
Q Consensus       135 r~~C~VCG~~~-~YtC~~Cg~ry  156 (175)
                      +..|.-||... ...|+.||.+.
T Consensus       667 ~rkCPkCG~~t~~~fCP~CGs~t  689 (1337)
T PRK14714        667 RRRCPSCGTETYENRCPDCGTHT  689 (1337)
T ss_pred             EEECCCCCCccccccCcccCCcC
Confidence            56788888332 33688888663


No 198
>PRK13844 recombination protein RecR; Provisional
Probab=20.20  E-value=52  Score=28.11  Aligned_cols=23  Identities=22%  Similarity=0.470  Sum_probs=16.2

Q ss_pred             CCCcccceecCCCC-ceecCCCCC
Q psy2284         132 FPNRHFCAVCGFPS-NYTCVPCGA  154 (175)
Q Consensus       132 ~P~r~~C~VCG~~~-~YtC~~Cg~  154 (175)
                      .-..++|++||+.+ .-.|+=|.-
T Consensus        54 ~~~i~~C~~C~~lte~~~C~IC~d   77 (200)
T PRK13844         54 TANIKKCVYCQALTEDDVCNICSN   77 (200)
T ss_pred             HHhCCcCCCCCCCCCCCCCCCCCC
Confidence            34567999999666 445887753


Done!