Diaphorina citri psyllid: psy2287

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MPLPGISIGEIGSKLGMNTVNNGYLGFKNVRIPRNNMLMKNAQVLKDGTYVKSKNDKLTYGTMIFVRVSLVKNVAAAFLSKAVTIATRYSAVRRQSEMKPGEREPQILDYKTQQYKLFPAIATSYALRFSADWLWDIYNSVNADLEKGNMGGLPELHAMSCCLKAVSTSDSATFIEVCRRSCGGHGYMNSSNFPNTYGMVTAAETYEGENTVLYLQTARFLIKAWNQLKSGGLLSSTVTYLGKIGAPKSQYVHSLDSLLQAYQQVAAG

ccccccEEccccccccccccccCEEEcccCECccccccccccEEccccCECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccccccccHHHHHHHHHHHHcc

MPLPGISIGEIGSKLGMNTVNNGYLGFKNVRIPRNNMLMKNAQVLKDGTYVKSKNDKLTYGTMIFVRVSLVKNVAAAFLSKAVTIATRYSAVRRQS*****EREPQILDYKTQQYKLFPAIATSYALRFSADWLWDIYNSVNADLEKGNMGGLPELHAMSCCLKAVSTSDSATFIEVCRRSCGGHGYMNSSNFPNTYGMVTAAETYEGENTVLYLQTARFLIKAWNQLKSGGLLSSTVTYLGKIGAPKSQYVHSLDSLLQAYQQVAAG

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peroxisomal acyl-coenzyme A oxidase 1	Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. Isoform 1 shows highest activity against medium-chain fatty acyl-CoAs and activity decreases with increasing chain length. Isoform 2 is active against a much broader range of substrates and shows activity towards very long-chain acyl-CoAs.	confident	Q9R0H0
Probable peroxisomal acyl-coenzyme A oxidase 1		confident	Q7KML2
Peroxisomal acyl-coenzyme A oxidase 1	Catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. Isoform 1 shows highest activity against medium-chain fatty acyl-CoAs and activity decreases with increasing chain length. Isoform 2 is active against a much broader range of substrates and shows activity towards very long-chain acyl-CoAs.	confident	P07872

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005778 [CC]	peroxisomal membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0065007 [BP]	biological regulation	probable	GO:0008150
GO:0006631 [BP]	fatty acid metabolic process	probable	GO:0044238, GO:0044710, GO:0006629, GO:0006082, GO:0009987, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005504 [MF]	fatty acid binding	probable	GO:0043168, GO:0031406, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:0033293
GO:0071949 [MF]	FAD binding	probable	GO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W07, chain A
Confidence level:very confident
Coverage over the Query: 2-267
View the alignment between query and template
View the model in PyMOL