Query         psy2288
Match_columns 247
No_of_seqs    169 out of 1467
Neff          10.8
Searched_HMMs 46136
Date          Fri Aug 16 20:51:13 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2288.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2288hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus              100.0 9.5E-32 2.1E-36  198.5   6.3  135   91-227   129-266 (279)
  2 KOG2462|consensus              100.0 1.6E-29 3.5E-34  186.7   7.1  134   63-198   129-265 (279)
  3 KOG1074|consensus               99.9 5.6E-29 1.2E-33  207.3   3.4  143   93-235   606-938 (958)
  4 KOG3608|consensus               99.9 3.7E-25 7.9E-30  168.2  12.0  215   13-230   141-378 (467)
  5 KOG3608|consensus               99.9 4.9E-25 1.1E-29  167.6  10.9  207   37-246   135-366 (467)
  6 KOG3623|consensus               99.9 3.7E-26   8E-31  187.9   4.2  103   11-113   213-330 (1007)
  7 KOG1074|consensus               99.9 8.8E-25 1.9E-29  182.5   3.0  142   64-205   605-936 (958)
  8 KOG3623|consensus               99.9 2.7E-23 5.8E-28  171.2   3.9  107   35-141   209-330 (1007)
  9 KOG3576|consensus               99.7 1.4E-18   3E-23  123.0   3.1  114  118-231   115-239 (267)
 10 KOG3576|consensus               99.7 5.5E-17 1.2E-21  114.9   3.5   85   33-117   114-198 (267)
 11 PLN03086 PRLI-interacting fact  99.4 9.2E-13   2E-17  109.8   9.9  144   64-226   407-562 (567)
 12 PLN03086 PRLI-interacting fact  99.4 2.1E-12 4.6E-17  107.7  10.6   86  149-240   454-549 (567)
 13 PHA00733 hypothetical protein   99.3 6.2E-12 1.3E-16   86.0   4.4   94  134-229    26-124 (128)
 14 PHA00733 hypothetical protein   99.1 9.1E-11   2E-15   80.3   4.9   84   31-116    35-123 (128)
 15 PHA02768 hypothetical protein;  99.1 4.5E-11 9.7E-16   67.4   1.8   44  176-221     5-48  (55)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.2E-09 2.7E-14   52.7   2.4   26  191-216     1-26  (26)
 17 PHA02768 hypothetical protein;  98.8 1.3E-09 2.9E-14   61.5   1.7   42  149-192     6-47  (55)
 18 KOG3993|consensus               98.8 7.2E-10 1.6E-14   87.5   0.0  165   36-200   267-482 (500)
 19 KOG3993|consensus               98.8 1.5E-09 3.2E-14   85.7   0.4  165   64-228   267-482 (500)
 20 PHA00616 hypothetical protein   98.7 1.1E-08 2.3E-13   54.9   2.2   34  176-209     1-34  (44)
 21 PHA00616 hypothetical protein   98.7 8.3E-09 1.8E-13   55.4   1.7   34  204-237     1-34  (44)
 22 PF13465 zf-H2C2_2:  Zinc-finge  98.6 3.3E-08 7.1E-13   47.7   2.2   25  163-187     1-25  (26)
 23 PHA00732 hypothetical protein   98.5 1.1E-07 2.4E-12   59.0   2.6   36  177-215     2-38  (79)
 24 PHA00732 hypothetical protein   98.3 6.9E-07 1.5E-11   55.5   2.7   48  148-201     1-49  (79)
 25 PF05605 zf-Di19:  Drought indu  98.3 1.9E-06   4E-11   49.7   4.1   49  177-228     3-53  (54)
 26 PF05605 zf-Di19:  Drought indu  98.2 3.2E-06 6.9E-11   48.7   4.4   49   36-87      2-52  (54)
 27 PF00096 zf-C2H2:  Zinc finger,  98.1 1.7E-06 3.8E-11   40.4   2.1   22  205-226     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   98.0 6.3E-06 1.4E-10   38.8   2.2   24  205-228     1-24  (24)
 29 PF00096 zf-C2H2:  Zinc finger,  97.9 6.3E-06 1.4E-10   38.4   1.7   22  177-198     1-22  (23)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.9 9.7E-06 2.1E-10   53.3   3.0   73  150-227     1-73  (100)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.9 8.7E-06 1.9E-10   39.6   1.8   25  204-228     1-25  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.7 3.5E-05 7.6E-10   36.1   2.2   23  177-199     1-23  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.6 4.2E-05 9.1E-10   50.3   2.7   72   38-114     1-72  (100)
 34 PF13912 zf-C2H2_6:  C2H2-type   97.6 4.1E-05 8.8E-10   37.2   1.7   25  176-200     1-25  (27)
 35 PF09237 GAGA:  GAGA factor;  I  97.4 0.00018   4E-09   39.6   2.8   32  201-232    21-52  (54)
 36 PF13909 zf-H2C2_5:  C2H2-type   97.2 0.00029 6.2E-09   33.0   2.0   23  205-228     1-23  (24)
 37 smart00355 ZnF_C2H2 zinc finge  97.2 0.00032   7E-09   33.3   2.2   23  205-227     1-23  (26)
 38 PF12874 zf-met:  Zinc-finger o  97.1 0.00036 7.8E-09   33.0   1.6   23  205-227     1-23  (25)
 39 PF09237 GAGA:  GAGA factor;  I  97.0 0.00075 1.6E-08   37.2   2.6   32  173-204    21-52  (54)
 40 COG5189 SFP1 Putative transcri  97.0 0.00012 2.6E-09   56.5  -0.7   67  146-224   347-418 (423)
 41 smart00355 ZnF_C2H2 zinc finge  97.0 0.00081 1.8E-08   31.8   2.5   23  177-199     1-23  (26)
 42 PF13909 zf-H2C2_5:  C2H2-type   96.9 0.00068 1.5E-08   31.7   1.7   23  177-200     1-23  (24)
 43 KOG1146|consensus               96.9 0.00026 5.5E-09   64.6   0.1   50  177-226   735-791 (1406)
 44 PRK04860 hypothetical protein;  96.9 0.00063 1.4E-08   48.5   1.9   38  175-216   118-155 (160)
 45 COG5189 SFP1 Putative transcri  96.8 0.00043 9.4E-09   53.5   0.8   68   62-141   347-419 (423)
 46 PF12874 zf-met:  Zinc-finger o  96.6  0.0014   3E-08   31.0   1.4   22  177-198     1-22  (25)
 47 KOG1146|consensus               96.2 0.00049 1.1E-08   62.9  -2.5   28   63-90    464-491 (1406)
 48 PF12171 zf-C2H2_jaz:  Zinc-fin  96.2  0.0014   3E-08   31.7   0.1   22  205-226     2-23  (27)
 49 PRK04860 hypothetical protein;  96.1  0.0031 6.7E-08   45.0   1.8   37  203-243   118-154 (160)
 50 KOG2231|consensus               95.9   0.042 9.1E-07   47.9   7.7  103   95-208   118-240 (669)
 51 KOG2231|consensus               95.9   0.036 7.8E-07   48.3   7.1   47  122-172   184-236 (669)
 52 KOG2785|consensus               95.7   0.053 1.1E-06   43.6   6.9   52  176-227   166-243 (390)
 53 PF12171 zf-C2H2_jaz:  Zinc-fin  95.6  0.0031 6.7E-08   30.4  -0.1   22   37-58      2-23  (27)
 54 KOG2482|consensus               95.5   0.092   2E-06   41.5   7.6   24  204-227   334-357 (423)
 55 PF13913 zf-C2HC_2:  zinc-finge  95.3   0.016 3.5E-07   27.3   1.9   20  205-225     3-22  (25)
 56 COG5236 Uncharacterized conser  95.2   0.042 9.1E-07   43.4   4.8  126   93-228   152-305 (493)
 57 KOG2785|consensus               95.2   0.093   2E-06   42.2   6.8   27  204-230   166-192 (390)
 58 TIGR00622 ssl1 transcription f  94.8   0.062 1.3E-06   35.6   4.1   18  120-137    15-32  (112)
 59 KOG4173|consensus               94.6   0.025 5.3E-07   41.3   2.2   74  148-224    79-166 (253)
 60 KOG2893|consensus               94.6  0.0093   2E-07   44.5  -0.1   45  179-227    13-58  (341)
 61 smart00451 ZnF_U1 U1-like zinc  94.5   0.033 7.1E-07   28.5   1.9   24  204-227     3-26  (35)
 62 PF12013 DUF3505:  Protein of u  93.8    0.13 2.9E-06   34.3   4.4   25  205-229    81-109 (109)
 63 COG5048 FOG: Zn-finger [Genera  93.8   0.011 2.4E-07   49.6  -1.2  147   92-238   289-452 (467)
 64 smart00451 ZnF_U1 U1-like zinc  93.6   0.072 1.6E-06   27.2   2.1   23   36-58      3-25  (35)
 65 TIGR00622 ssl1 transcription f  93.3     0.2 4.3E-06   33.2   4.3  109   65-211     2-110 (112)
 66 KOG2482|consensus               93.3    0.38 8.2E-06   38.2   6.5  134   36-170   144-356 (423)
 67 COG5048 FOG: Zn-finger [Genera  93.1   0.019 4.2E-07   48.1  -0.8  149   64-212   289-454 (467)
 68 COG5236 Uncharacterized conser  92.7    0.22 4.8E-06   39.5   4.5   77   37-115   152-243 (493)
 69 cd00350 rubredoxin_like Rubred  92.6   0.091   2E-06   26.6   1.6    8  148-155    17-24  (33)
 70 KOG2893|consensus               92.4   0.034 7.4E-07   41.5  -0.2   44   37-84     11-54  (341)
 71 PF10571 UPF0547:  Uncharacteri  92.4   0.072 1.6E-06   25.3   0.9    9  178-186    16-24  (26)
 72 PF12013 DUF3505:  Protein of u  92.1    0.33 7.2E-06   32.3   4.3   54  147-201    10-109 (109)
 73 smart00659 RPOLCX RNA polymera  89.5    0.18 3.8E-06   27.5   0.9   11  177-187     3-13  (44)
 74 PHA00626 hypothetical protein   89.5     0.1 2.3E-06   29.4  -0.0   13  203-215    22-34  (59)
 75 COG4049 Uncharacterized protei  89.2    0.16 3.5E-06   28.6   0.6   31   31-61     12-42  (65)
 76 COG4049 Uncharacterized protei  88.0    0.26 5.7E-06   27.8   0.9   24  201-224    14-37  (65)
 77 KOG4173|consensus               87.6    0.28 6.1E-06   36.0   1.2   84   92-196    79-166 (253)
 78 smart00531 TFIIE Transcription  87.6    0.68 1.5E-05   32.7   3.1   12   36-47     99-110 (147)
 79 COG2888 Predicted Zn-ribbon RN  87.5    0.48   1E-05   27.3   1.8   32  176-212    27-58  (61)
 80 cd00729 rubredoxin_SM Rubredox  87.4    0.38 8.3E-06   24.5   1.3   10  203-212    17-26  (34)
 81 PF09538 FYDLN_acid:  Protein o  86.8     0.3 6.4E-06   32.4   0.8   29  178-217    11-39  (108)
 82 TIGR00373 conserved hypothetic  86.7    0.82 1.8E-05   32.7   3.1   35  171-214   104-138 (158)
 83 smart00734 ZnF_Rad18 Rad18-lik  86.6    0.61 1.3E-05   22.1   1.6   20  205-225     2-21  (26)
 84 PF09723 Zn-ribbon_8:  Zinc rib  86.0    0.17 3.8E-06   27.2  -0.5   29  205-240     6-34  (42)
 85 TIGR00373 conserved hypothetic  85.8    0.87 1.9E-05   32.6   2.9   31   34-73    107-137 (158)
 86 PF13717 zinc_ribbon_4:  zinc-r  85.7    0.94   2E-05   23.4   2.2    8   67-74      5-12  (36)
 87 PF13719 zinc_ribbon_5:  zinc-r  85.4    0.89 1.9E-05   23.6   2.1    8   39-46      5-12  (37)
 88 PF06524 NOA36:  NOA36 protein;  85.3     0.4 8.6E-06   36.6   1.0   27  202-228   207-233 (314)
 89 KOG2186|consensus               85.1    0.63 1.4E-05   35.4   1.9   48   92-142     3-50  (276)
 90 COG1996 RPC10 DNA-directed RNA  85.0    0.37 8.1E-06   26.7   0.5   10  177-186     7-16  (49)
 91 PRK14890 putative Zn-ribbon RN  84.7    0.74 1.6E-05   26.6   1.6    9  149-157    26-34  (59)
 92 smart00834 CxxC_CXXC_SSSS Puta  84.6     0.3 6.5E-06   25.9   0.1   11  205-215     6-16  (41)
 93 PRK06266 transcription initiat  84.1     1.1 2.3E-05   32.8   2.8   33  173-214   114-146 (178)
 94 PRK00464 nrdR transcriptional   83.2    0.17 3.7E-06   35.9  -1.6   14  177-190    29-42  (154)
 95 KOG2807|consensus               82.8     1.8   4E-05   34.3   3.6   25  203-227   344-368 (378)
 96 PRK06266 transcription initiat  82.8     1.2 2.6E-05   32.6   2.5   16   36-51    117-132 (178)
 97 TIGR02098 MJ0042_CXXC MJ0042 f  82.3     1.2 2.7E-05   23.1   1.9    8   39-46      5-12  (38)
 98 PF08274 PhnA_Zn_Ribbon:  PhnA   82.1     0.7 1.5E-05   22.8   0.8   25  178-213     4-28  (30)
 99 TIGR02605 CxxC_CxxC_SSSS putat  81.6    0.43 9.3E-06   26.9  -0.1   11  205-215     6-16  (52)
100 KOG2593|consensus               81.6     1.5 3.3E-05   36.2   2.9   37  203-242   127-163 (436)
101 PRK00398 rpoP DNA-directed RNA  81.0       1 2.2E-05   24.7   1.2    8  205-212    22-29  (46)
102 COG1592 Rubrerythrin [Energy p  80.9     1.1 2.3E-05   32.2   1.7   11  173-183   146-156 (166)
103 PF09986 DUF2225:  Uncharacteri  79.5    0.24 5.2E-06   37.4  -2.1   20   34-53      3-22  (214)
104 PF09986 DUF2225:  Uncharacteri  79.5    0.44 9.5E-06   36.0  -0.7   18   62-79      3-20  (214)
105 PF02176 zf-TRAF:  TRAF-type zi  79.4    0.94   2E-05   26.3   0.9   25  190-214    24-52  (60)
106 PF02892 zf-BED:  BED zinc fing  79.2     2.2 4.9E-05   23.0   2.3   25  202-226    14-42  (45)
107 COG1592 Rubrerythrin [Energy p  79.2     1.1 2.5E-05   32.1   1.4   25  175-212   133-157 (166)
108 KOG2186|consensus               78.4       2 4.3E-05   32.8   2.4   49   65-116     4-52  (276)
109 PF03604 DNA_RNApol_7kD:  DNA d  78.3     1.9 4.2E-05   21.6   1.6   10  232-241    17-26  (32)
110 TIGR00595 priA primosomal prot  78.3     1.2 2.7E-05   38.4   1.6    9  150-158   215-223 (505)
111 PF05191 ADK_lid:  Adenylate ki  77.4    0.85 1.9E-05   23.6   0.2   31  205-243     2-32  (36)
112 smart00531 TFIIE Transcription  76.1     7.3 0.00016   27.5   4.8   35   64-102    99-133 (147)
113 COG4896 Uncharacterized protei  76.0     1.2 2.6E-05   25.7   0.6   38  178-215     4-42  (68)
114 PF06524 NOA36:  NOA36 protein;  75.4    0.99 2.2E-05   34.5   0.2   39   61-100   139-179 (314)
115 TIGR02300 FYDLN_acid conserved  74.6     1.5 3.3E-05   29.7   0.9   13  203-215    25-37  (129)
116 KOG2807|consensus               74.1     6.2 0.00013   31.5   4.2   88   91-211   275-374 (378)
117 smart00614 ZnF_BED BED zinc fi  73.8       3 6.5E-05   23.2   1.9   22  204-225    18-44  (50)
118 PF12907 zf-met2:  Zinc-binding  71.1     2.8 6.1E-05   22.2   1.2   27  205-231     2-31  (40)
119 PRK14873 primosome assembly pr  68.5     2.7 5.9E-05   37.6   1.4   11  202-212   408-418 (665)
120 PF07754 DUF1610:  Domain of un  67.5     2.5 5.3E-05   19.6   0.5    8  204-211    16-23  (24)
121 PRK09678 DNA-binding transcrip  67.2     1.1 2.3E-05   27.3  -1.0   19  202-220    25-45  (72)
122 KOG2593|consensus               66.9     7.7 0.00017   32.3   3.5   37   33-72    125-161 (436)
123 PRK14714 DNA polymerase II lar  66.1     7.9 0.00017   36.9   3.8   11  204-214   692-702 (1337)
124 PF05443 ROS_MUCR:  ROS/MUCR tr  65.9     3.9 8.4E-05   28.3   1.4   23  205-230    73-95  (132)
125 COG1198 PriA Primosomal protei  65.5     1.5 3.3E-05   39.4  -0.7   10  149-158   436-445 (730)
126 PF14353 CpXC:  CpXC protein     64.0     6.9 0.00015   26.8   2.4   10   38-47      3-12  (128)
127 PRK04023 DNA polymerase II lar  63.3      10 0.00023   35.3   3.9    9  149-157   627-635 (1121)
128 PRK04023 DNA polymerase II lar  63.1     8.5 0.00019   35.8   3.3    9  121-129   627-635 (1121)
129 PF13878 zf-C2H2_3:  zinc-finge  63.1      10 0.00022   20.2   2.4   25   36-60     13-39  (41)
130 PF15269 zf-C2H2_7:  Zinc-finge  62.7     6.1 0.00013   21.3   1.5   23   64-86     20-42  (54)
131 PF13240 zinc_ribbon_2:  zinc-r  60.8     3.5 7.6E-05   18.8   0.3    6  207-212    16-21  (23)
132 PF05290 Baculo_IE-1:  Baculovi  60.8      11 0.00023   26.0   2.7   57   32-106    76-135 (140)
133 KOG2071|consensus               60.5     7.4 0.00016   33.8   2.4   42  173-214   415-523 (579)
134 KOG4167|consensus               60.3     2.4 5.3E-05   37.5  -0.4   27  204-230   792-818 (907)
135 COG1997 RPL43A Ribosomal prote  60.2     4.5 9.7E-05   25.5   0.8   11  177-187    54-64  (89)
136 PF12760 Zn_Tnp_IS1595:  Transp  59.2     8.8 0.00019   20.9   1.8    8   65-72     19-26  (46)
137 PF07295 DUF1451:  Protein of u  58.2     4.3 9.4E-05   28.6   0.6   33  204-246   112-144 (146)
138 PF13453 zf-TFIIB:  Transcripti  54.1     5.4 0.00012   21.1   0.4   21  202-222    17-37  (41)
139 PF09845 DUF2072:  Zn-ribbon co  53.6     8.5 0.00018   26.4   1.4   14  120-133     1-14  (131)
140 PRK05580 primosome assembly pr  53.4     7.1 0.00015   35.2   1.3    8  150-157   383-390 (679)
141 COG3357 Predicted transcriptio  52.8     8.3 0.00018   24.5   1.1   12  120-131    58-69  (97)
142 COG4530 Uncharacterized protei  51.3     6.4 0.00014   25.9   0.5   12  203-214    25-36  (129)
143 TIGR00686 phnA alkylphosphonat  51.1     7.3 0.00016   25.6   0.7   29  178-217     4-32  (109)
144 KOG3408|consensus               50.9      10 0.00023   25.5   1.4   28   32-59     53-80  (129)
145 PF08271 TF_Zn_Ribbon:  TFIIB z  50.3     3.2   7E-05   22.3  -0.8   29  177-214     1-29  (43)
146 PF12773 DZR:  Double zinc ribb  49.4      10 0.00022   20.9   1.1    8  205-212    30-37  (50)
147 PF04959 ARS2:  Arsenite-resist  48.5      13 0.00028   28.1   1.8   30  145-174    74-103 (214)
148 KOG4167|consensus               47.7     5.5 0.00012   35.4  -0.3   27   63-89    791-817 (907)
149 PRK03824 hypA hydrogenase nick  47.7     8.8 0.00019   26.7   0.8   11  177-187    71-81  (135)
150 COG3677 Transposase and inacti  46.7     5.8 0.00013   27.4  -0.2   15  174-188    51-65  (129)
151 KOG1280|consensus               46.5      20 0.00044   29.0   2.7   37   35-71     78-116 (381)
152 PF04959 ARS2:  Arsenite-resist  46.5      17 0.00037   27.5   2.2   26   36-61     77-102 (214)
153 PF07975 C1_4:  TFIIH C1-like d  46.4     8.9 0.00019   21.6   0.5   20  176-195    21-40  (51)
154 PRK10220 hypothetical protein;  46.3      11 0.00024   24.9   1.0   29  178-217     5-33  (111)
155 COG5151 SSL1 RNA polymerase II  46.0      11 0.00024   29.9   1.2   78  147-227   321-411 (421)
156 PF09963 DUF2197:  Uncharacteri  45.1      11 0.00024   21.7   0.7   14  201-214    28-41  (56)
157 PF13248 zf-ribbon_3:  zinc-rib  45.1      11 0.00023   17.7   0.6    7  150-156     4-10  (26)
158 KOG3408|consensus               44.9      15 0.00033   24.7   1.5   27  173-199    54-80  (129)
159 PF01363 FYVE:  FYVE zinc finge  44.1      11 0.00023   22.5   0.7    9  150-158    11-19  (69)
160 KOG1701|consensus               44.0     6.6 0.00014   32.6  -0.3   42  122-163   276-317 (468)
161 KOG1280|consensus               43.6      24 0.00052   28.6   2.6   40  173-212    76-117 (381)
162 COG4957 Predicted transcriptio  42.2      18 0.00038   24.9   1.5   23  205-230    77-99  (148)
163 smart00154 ZnF_AN1 AN1-like Zi  42.0      13 0.00029   19.5   0.8   12  204-215    12-23  (39)
164 PF13451 zf-trcl:  Probable zin  41.7      21 0.00045   19.9   1.5   38   34-71      2-40  (49)
165 PF01780 Ribosomal_L37ae:  Ribo  39.4     9.3  0.0002   24.4  -0.1    9  149-157    36-44  (90)
166 COG1675 TFA1 Transcription ini  39.4      35 0.00075   25.0   2.8   33  172-213   109-141 (176)
167 PF14446 Prok-RING_1:  Prokaryo  38.8      12 0.00025   21.4   0.2    9   66-74      7-15  (54)
168 PRK00432 30S ribosomal protein  38.3      14 0.00031   20.6   0.5   10  204-213    37-46  (50)
169 TIGR00100 hypA hydrogenase nic  38.0      19  0.0004   24.3   1.2   11  177-187    71-81  (115)
170 PRK12380 hydrogenase nickel in  37.5      21 0.00046   23.9   1.4   11  177-187    71-81  (113)
171 PF15135 UPF0515:  Uncharacteri  37.3      19 0.00042   27.6   1.2   58  119-189   111-168 (278)
172 PF03811 Zn_Tnp_IS1:  InsA N-te  36.9     5.3 0.00011   20.6  -1.2   11  200-210    25-35  (36)
173 PF07800 DUF1644:  Protein of u  36.5 1.6E+02  0.0035   21.1   5.9   49  148-198    80-130 (162)
174 PF01155 HypA:  Hydrogenase exp  36.2      16 0.00034   24.5   0.6   11  205-215    71-81  (113)
175 PF14311 DUF4379:  Domain of un  36.0      23 0.00051   20.0   1.2   10  149-158    29-38  (55)
176 PF10276 zf-CHCC:  Zinc-finger   35.3      14 0.00031   19.6   0.2   12   35-46     28-39  (40)
177 PTZ00255 60S ribosomal protein  35.2      17 0.00036   23.3   0.5   12  176-187    54-65  (90)
178 PF08209 Sgf11:  Sgf11 (transcr  35.1      36 0.00077   17.2   1.6   22  205-227     5-26  (33)
179 PF05495 zf-CHY:  CHY zinc fing  35.0     6.7 0.00014   23.8  -1.2    9   93-101    42-50  (71)
180 PF01428 zf-AN1:  AN1-like Zinc  34.7      14  0.0003   19.8   0.1   13  203-215    12-24  (43)
181 KOG3214|consensus               34.5      11 0.00024   24.4  -0.4   14  204-217    47-60  (109)
182 cd00924 Cyt_c_Oxidase_Vb Cytoc  34.5      21 0.00046   23.2   0.9   16  199-215    75-90  (97)
183 PF14369 zf-RING_3:  zinc-finge  34.3      25 0.00054   18.0   1.0    8   67-74     24-31  (35)
184 PF04780 DUF629:  Protein of un  33.2      32 0.00068   29.4   2.0   26  203-228    56-81  (466)
185 KOG2907|consensus               33.1      20 0.00042   23.9   0.6   12   92-103   102-113 (116)
186 KOG2636|consensus               32.9      37 0.00081   28.6   2.3   29  197-225   394-423 (497)
187 cd00065 FYVE FYVE domain; Zinc  32.7      24 0.00052   19.9   0.9    9  151-159     5-13  (57)
188 PF06220 zf-U1:  U1 zinc finger  32.6      35 0.00077   17.7   1.4   12   35-46      2-13  (38)
189 PRK00564 hypA hydrogenase nick  32.5      25 0.00053   23.8   1.1   10  177-186    72-81  (117)
190 PRK04351 hypothetical protein;  32.4      17 0.00037   25.8   0.3   33  175-215   111-143 (149)
191 TIGR00280 L37a ribosomal prote  32.0      17 0.00036   23.3   0.2   11  177-187    54-64  (91)
192 PF04423 Rad50_zn_hook:  Rad50   31.8      43 0.00093   18.9   1.9   12   38-49     22-33  (54)
193 COG4391 Uncharacterized protei  31.5      25 0.00054   20.5   0.8   15   33-47     45-59  (62)
194 COG2879 Uncharacterized small   31.3      63  0.0014   19.0   2.4   20  215-234    23-42  (65)
195 COG1773 Rubredoxin [Energy pro  30.6      23 0.00051   20.2   0.6   14  204-217     3-16  (55)
196 COG2331 Uncharacterized protei  30.6      17 0.00038   22.2   0.1   32  176-214    12-43  (82)
197 PF07282 OrfB_Zn_ribbon:  Putat  30.5      64  0.0014   19.1   2.6    6   94-99     48-53  (69)
198 COG3091 SprT Zn-dependent meta  30.1      20 0.00043   25.3   0.3   35  174-213   115-149 (156)
199 PF13824 zf-Mss51:  Zinc-finger  29.9      45 0.00097   19.1   1.6    7  177-183    15-21  (55)
200 COG1198 PriA Primosomal protei  29.8      31 0.00067   31.5   1.5   13  173-185   472-484 (730)
201 COG1327 Predicted transcriptio  29.5      10 0.00022   26.7  -1.2   14  177-190    29-42  (156)
202 PF00301 Rubredoxin:  Rubredoxi  29.1      25 0.00054   19.4   0.5   36  205-240     2-42  (47)
203 smart00064 FYVE Protein presen  28.7      31 0.00068   20.4   1.0   10  150-159    12-21  (68)
204 PF10263 SprT-like:  SprT-like   28.5      16 0.00035   25.9  -0.4   10  205-214   144-153 (157)
205 PF14255 Cys_rich_CPXG:  Cystei  28.4      23  0.0005   20.0   0.3   11  205-215     1-11  (52)
206 KOG2272|consensus               28.3      41 0.00088   26.0   1.7   19  142-160   215-233 (332)
207 COG1655 Uncharacterized protei  28.3      12 0.00027   28.3  -1.0    8  178-185    64-71  (267)
208 COG4888 Uncharacterized Zn rib  28.2      10 0.00022   24.6  -1.2   11  148-158    22-32  (104)
209 COG1571 Predicted DNA-binding   27.5      38 0.00082   28.5   1.5   29  150-189   352-380 (421)
210 KOG0717|consensus               27.4      40 0.00086   28.7   1.6   22   65-86    293-314 (508)
211 PLN02294 cytochrome c oxidase   27.2      33 0.00072   24.8   1.0   14  202-215   139-152 (174)
212 KOG0717|consensus               27.1      36 0.00077   28.9   1.3   22  177-198   293-314 (508)
213 KOG4118|consensus               26.4      34 0.00073   20.2   0.8   26   37-62     39-64  (74)
214 PF08790 zf-LYAR:  LYAR-type C2  26.1      15 0.00033   17.7  -0.6    9  122-130     2-10  (28)
215 PRK03976 rpl37ae 50S ribosomal  25.9      24 0.00051   22.6   0.1   11  177-187    55-65  (90)
216 COG3364 Zn-ribbon containing p  25.8      35 0.00075   22.3   0.8   13  204-216     2-14  (112)
217 PRK00420 hypothetical protein;  25.6      42  0.0009   22.5   1.2    9  177-185    41-49  (112)
218 smart00440 ZnF_C2C2 C2C2 Zinc   25.5     5.1 0.00011   21.2  -2.5    7   65-71     29-35  (40)
219 cd00730 rubredoxin Rubredoxin;  24.9      29 0.00063   19.4   0.3   36  205-240     2-42  (50)
220 PF04780 DUF629:  Protein of un  24.9      68  0.0015   27.5   2.6   21   65-85     58-78  (466)
221 COG1326 Uncharacterized archae  24.9      82  0.0018   23.4   2.7   11   64-74     30-40  (201)
222 KOG0978|consensus               24.9      27 0.00058   31.4   0.3   10   65-74    644-653 (698)
223 PRK03681 hypA hydrogenase nick  24.7      32 0.00069   23.1   0.5   10  177-186    71-80  (114)
224 PF02591 DUF164:  Putative zinc  24.5      64  0.0014   18.3   1.7   31   38-72     24-54  (56)
225 COG5188 PRP9 Splicing factor 3  24.5      57  0.0012   26.6   1.9   30  197-226   367-397 (470)
226 PRK12496 hypothetical protein;  24.4      47   0.001   24.0   1.4    9  150-158   129-137 (164)
227 COG1594 RPB9 DNA-directed RNA   24.3      15 0.00033   24.6  -1.0    9  177-185   101-109 (113)
228 TIGR01206 lysW lysine biosynth  24.0      32 0.00068   19.7   0.4   30  204-241     2-31  (54)
229 PRK11032 hypothetical protein;  23.6      33 0.00072   24.6   0.5   34  203-246   123-156 (160)
230 PRK14559 putative protein seri  23.3      49  0.0011   29.8   1.5   13  205-217    42-54  (645)
231 cd01410 SIRT7 SIRT7: Eukaryoti  23.1 1.1E+02  0.0025   22.9   3.3   12  176-187    95-106 (206)
232 PRK14138 NAD-dependent deacety  23.0      86  0.0019   24.3   2.7   10  232-241   143-152 (244)
233 PRK00481 NAD-dependent deacety  23.0      77  0.0017   24.5   2.5    9  233-241   143-151 (242)
234 KOG1842|consensus               23.0      48   0.001   28.0   1.3   24   37-60     16-39  (505)
235 PF11789 zf-Nse:  Zinc-finger o  22.9      57  0.0012   18.8   1.3   12   35-46     23-34  (57)
236 smart00661 RPOL9 RNA polymeras  22.4      74  0.0016   17.4   1.7    6   94-99     22-27  (52)
237 PF14205 Cys_rich_KTR:  Cystein  22.2      28 0.00062   19.8  -0.1    9  147-155    27-35  (55)
238 PF08792 A2L_zn_ribbon:  A2L zi  22.2      44 0.00096   16.8   0.6   10  205-214    22-31  (33)
239 PF11023 DUF2614:  Protein of u  21.9      59  0.0013   21.7   1.3   12  175-186    68-79  (114)
240 KOG2636|consensus               21.0      70  0.0015   27.1   1.9   27  170-196   395-422 (497)
241 KOG1842|consensus               20.8      63  0.0014   27.3   1.6   22  149-170    16-37  (505)
242 PF04216 FdhE:  Protein involve  20.6     9.1  0.0002   30.5  -3.2   14  145-158   194-207 (290)
243 COG0068 HypF Hydrogenase matur  20.6      18 0.00039   32.4  -1.5   29  178-212   153-181 (750)
244 TIGR00627 tfb4 transcription f  20.5      60  0.0013   25.8   1.4   11  205-215   256-266 (279)
245 cd01413 SIR2_Af2 SIR2_Af2: Arc  20.4 1.2E+02  0.0025   23.2   2.9   11  177-187   114-124 (222)
246 KOG4377|consensus               20.4      45 0.00096   27.8   0.7   25   65-89    272-298 (480)
247 COG5112 UFD2 U1-like Zn-finger  20.2      51  0.0011   21.6   0.8   25   34-58     53-77  (126)

No 1  
>KOG2462|consensus
Probab=99.97  E-value=9.5e-32  Score=198.51  Aligned_cols=135  Identities=34%  Similarity=0.662  Sum_probs=125.2

Q ss_pred             CCeeCCCCCcccCChhHHHHHHHHhc---CCCCeecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHHHHHH
Q psy2288          91 KPFRCSVCGKSFSQRGILSSHLAVHA---GVKPHICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRH  167 (247)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~~~---~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H  167 (247)
                      ..|.|+.|++.+.+..+|.+|.++|-   ..+.+.|.+|++.+.+...|.+|+++|.  -+.+|.+||+.|...+.|+.|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc
Confidence            35889999999999999999988774   3677899999999999999999999986  689999999999999999999


Q ss_pred             HHHhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHHHHHHhc
Q psy2288         168 QRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       168 ~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      +++|+|||||.|+.|+++|.++++|+.||++|.+.++|+|..|++.|..++-|.+|..+-
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES~  266 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSESA  266 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhhc
Confidence            999999999999999999999999999999999999999999999999999999998764


No 2  
>KOG2462|consensus
Probab=99.96  E-value=1.6e-29  Score=186.74  Aligned_cols=134  Identities=29%  Similarity=0.640  Sum_probs=123.8

Q ss_pred             CceeccccccccCChHHHHHHHhhccC---CCCeeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHH
Q psy2288          63 GKFTCTVCKKVFNNIKSLKTHSRIHTG---EKPFRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLH  139 (247)
Q Consensus        63 ~~~~C~~C~~~f~~~~~l~~H~~~~~~---~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h  139 (247)
                      ..|+|+.|++.+.+...|.+|.++|-.   .+.+.|++|++.+.+...|..|+++|+  .+++|.+||+.|...+.|.-|
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGH  206 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcc
Confidence            458999999999999999999988854   466889999999999999999999985  678999999999999999999


Q ss_pred             HHHhCCCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHh
Q psy2288         140 EMRHGNIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNR  198 (247)
Q Consensus       140 ~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  198 (247)
                      +++|++|+||.|+.|+++|++.++|+.|+++|.+.++|+|..|++.|...+.|.+|...
T Consensus       207 iRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             cccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999999999999999999999999999999999999999999765


No 3  
>KOG1074|consensus
Probab=99.95  E-value=5.6e-29  Score=207.25  Aligned_cols=143  Identities=31%  Similarity=0.624  Sum_probs=125.2

Q ss_pred             eeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHHhCCCC----ccccC---CCccccCChHHHH
Q psy2288          93 FRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMRHGNIR----HFACN---VCPFKFTTKSDLQ  165 (247)
Q Consensus        93 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~----~~~C~---~C~~~~~~~~~l~  165 (247)
                      -.|-+|.+..+-.+.|+.|.++|++++||+|.+|++.|..+.+|+.|+..|....    .+.|+   +|.+.|.+.-.|.
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~lp  685 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTLP  685 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccccc
Confidence            5899999999999999999999999999999999999999999999998876543    36688   8888888888888


Q ss_pred             HHHHHhCCC-CC--------------------------------------------------------------------
Q psy2288         166 RHQRSHEGV-KP--------------------------------------------------------------------  176 (247)
Q Consensus       166 ~H~~~h~~~-~~--------------------------------------------------------------------  176 (247)
                      .|+++|.+. .+                                                                    
T Consensus       686 QhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~~  765 (958)
T KOG1074|consen  686 QHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCGR  765 (958)
T ss_pred             ceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCcccccccc
Confidence            888776521 00                                                                    


Q ss_pred             --------------------------------------------------------------------------------
Q psy2288         177 --------------------------------------------------------------------------------  176 (247)
Q Consensus       177 --------------------------------------------------------------------------------  176 (247)
                                                                                                      
T Consensus       766 ~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~~  845 (958)
T KOG1074|consen  766 ELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATKT  845 (958)
T ss_pred             ccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhccccccccccccccc
Confidence                                                                                            


Q ss_pred             ----------------------------------cccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHHH
Q psy2288         177 ----------------------------------FRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLNK  222 (247)
Q Consensus       177 ----------------------------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~  222 (247)
                                                        ..|.+|++.|...++|..|+++|++++||.|-+|++.|.++..|..
T Consensus       846 n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKv  925 (958)
T KOG1074|consen  846 NEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKV  925 (958)
T ss_pred             ccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhh
Confidence                                              6799999999999999999999999999999999999999999999


Q ss_pred             HHHhccCCCCCCC
Q psy2288         223 HKLSHKTSADPIS  235 (247)
Q Consensus       223 H~~~h~~~~~~~c  235 (247)
                      ||.+|+...++.=
T Consensus       926 HMgtH~w~q~~sr  938 (958)
T KOG1074|consen  926 HMGTHMWVQPPSR  938 (958)
T ss_pred             hhccccccCCCcc
Confidence            9999988766543


No 4  
>KOG3608|consensus
Probab=99.93  E-value=3.7e-25  Score=168.25  Aligned_cols=215  Identities=25%  Similarity=0.491  Sum_probs=180.0

Q ss_pred             CcccchhHHHHHhhhhhhhh------------cCC-ceecc--cccccccCHHHHHHHHHHhCCCCceeccccccccCCh
Q psy2288          13 DPVENASKILALCMRKETEA------------QQK-SLACN--ICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKVFNNI   77 (247)
Q Consensus        13 ~~~~~~~~~~~l~~~~~~~~------------~~~-~~~C~--~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~   77 (247)
                      ++...|.+...+..|...|.            +++ .+.|.  -|-.++.+...|+.|++.|.+++...|+.|+..|.+.
T Consensus       141 dCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg~~F~~~  220 (467)
T KOG3608|consen  141 DCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCGELFRTK  220 (467)
T ss_pred             hcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHHHHhccc
Confidence            45555566655555554432            232 25565  4889999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcc--CCCCeeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHH-hCCCCccccCCC
Q psy2288          78 KSLKTHSRIHT--GEKPFRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMR-HGNIRHFACNVC  154 (247)
Q Consensus        78 ~~l~~H~~~~~--~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~-~~~~~~~~C~~C  154 (247)
                      ..|-.|++.-+  ...+|.|..|.+.|..+..|..|+..|-  .-|+|+.|+-+....+.|..|++. |...+||+|..|
T Consensus       221 tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~C  298 (467)
T KOG3608|consen  221 TKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDEC  298 (467)
T ss_pred             cHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCCccccch
Confidence            99999986533  3458999999999999999999999884  458999999999999999999984 778899999999


Q ss_pred             ccccCChHHHHHHHHHhCCCCCcccCc--CchhcccHHHHHHHHHhcC-CCC--CeecccccccccChHHHHHHHHhccC
Q psy2288         155 PFKFTTKSDLQRHQRSHEGVKPFRCEY--CDKTFTRQIIMKEHLNRHK-GVQ--PYSCSHCDKTFFDAQSLNKHKLSHKT  229 (247)
Q Consensus       155 ~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~-~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~  229 (247)
                      ++.+.+.+.|.+|..+|. +-.|+|..  |..++.+..+|++|++.++ |..  +|.|-.|.+.|.+-.+|.+|+...|+
T Consensus       299 d~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~~L~~HL~kkH~  377 (467)
T KOG3608|consen  299 DTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGKSLSAHLMKKHG  377 (467)
T ss_pred             hhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccchhHHHHHHHhhc
Confidence            999999999999999888 77799977  9999999999999997654 554  59999999999999999999866544


Q ss_pred             C
Q psy2288         230 S  230 (247)
Q Consensus       230 ~  230 (247)
                      =
T Consensus       378 f  378 (467)
T KOG3608|consen  378 F  378 (467)
T ss_pred             c
Confidence            3


No 5  
>KOG3608|consensus
Probab=99.92  E-value=4.9e-25  Score=167.56  Aligned_cols=207  Identities=26%  Similarity=0.513  Sum_probs=182.1

Q ss_pred             eecc--cccccccCHHHHHHHHHHhCC-----------CC-c-eecc--ccccccCChHHHHHHHhhccCCCCeeCCCCC
Q psy2288          37 LACN--ICSMVFCDEIVLNKHVEEHST-----------LG-K-FTCT--VCKKVFNNIKSLKTHSRIHTGEKPFRCSVCG   99 (247)
Q Consensus        37 ~~C~--~C~~~~~~~~~l~~H~~~~~~-----------~~-~-~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~   99 (247)
                      +.|.  .|++.|.+...|..|+..|.-           ++ | +.|.  -|.+++.++..|++|++.|.+++...|+.|+
T Consensus       135 f~C~WedCe~~F~s~~ef~dHV~~H~l~ceyd~~~~~~D~~pv~~C~W~~Ct~~~~~k~~LreH~r~Hs~eKvvACp~Cg  214 (467)
T KOG3608|consen  135 FRCGWEDCEREFVSIVEFQDHVVKHALFCEYDIQKTPEDERPVTMCNWAMCTKHMGNKYRLREHIRTHSNEKVVACPHCG  214 (467)
T ss_pred             hccChhhcCCcccCHHHHHHHHHHhhhhhhhhhhhCCCCCCceeeccchhhhhhhccHHHHHHHHHhcCCCeEEecchHH
Confidence            5565  599999999999999877631           11 2 4454  4899999999999999999999999999999


Q ss_pred             cccCChhHHHHHHHHhc--CCCCeecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHHHHHHHHH-hCCCCC
Q psy2288         100 KSFSQRGILSSHLAVHA--GVKPHICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRHQRS-HEGVKP  176 (247)
Q Consensus       100 ~~f~~~~~l~~H~~~~~--~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~  176 (247)
                      ..|++...|-.|++..+  ...+|.|..|.+.|..+..|..|+..|.  ..|+|+.|+-.....++|.+|++. |...+|
T Consensus       215 ~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv--n~ykCplCdmtc~~~ssL~~H~r~rHs~dkp  292 (467)
T KOG3608|consen  215 ELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV--NCYKCPLCDMTCSSASSLTTHIRYRHSKDKP  292 (467)
T ss_pred             HHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh--hcccccccccCCCChHHHHHHHHhhhccCCC
Confidence            99999999999976543  4578999999999999999999999875  679999999999999999999875 677899


Q ss_pred             cccCcCchhcccHHHHHHHHHhcCCCCCeeccc--ccccccChHHHHHHHHhcc---CCCCCCCccccCCCcCCC
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSH--CDKTFFDAQSLNKHKLSHK---TSADPISSAKGSKLFGGI  246 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~---~~~~~~c~~c~~~~~~~~  246 (247)
                      |+|..|.+.|.+.+.|.+|+.+|. +-.|+|..  |.++|.+..++.+|++.++   ++-+|.|..|+--+++|.
T Consensus       293 fKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~~~H~~evhEg~np~~Y~CH~Cdr~ft~G~  366 (467)
T KOG3608|consen  293 FKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQMRRHFLEVHEGNNPILYACHCCDRFFTSGK  366 (467)
T ss_pred             ccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHHHHHHHHhccCCCCCceeeecchhhhccch
Confidence            999999999999999999999887 66799977  9999999999999998876   558899999988777774


No 6  
>KOG3623|consensus
Probab=99.92  E-value=3.7e-26  Score=187.91  Aligned_cols=103  Identities=35%  Similarity=0.632  Sum_probs=74.5

Q ss_pred             CCCcccchhHHHHHhhhhhhhh--cCCceecccccccccCHHHHHHHHHHhCC-------------CCceeccccccccC
Q psy2288          11 TNDPVENASKILALCMRKETEA--QQKSLACNICSMVFCDEIVLNKHVEEHST-------------LGKFTCTVCKKVFN   75 (247)
Q Consensus        11 ~~~~~~~~~~~~~l~~~~~~~~--~~~~~~C~~C~~~~~~~~~l~~H~~~~~~-------------~~~~~C~~C~~~f~   75 (247)
                      +..++..+.....|.+|.+...  .+..+.|..|..+|.....|.+||.+|..             ...|+|..|++.|+
T Consensus       213 cpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFK  292 (1007)
T KOG3623|consen  213 CPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFK  292 (1007)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhh
Confidence            4455566666667777765432  34457788888888888888888877642             12478888888888


Q ss_pred             ChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHH
Q psy2288          76 NIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLA  113 (247)
Q Consensus        76 ~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~  113 (247)
                      .+..|..|+++|.+++||.|+.|++.|+....+..||.
T Consensus       293 fKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  293 FKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            88888888888888888888888888888777777764


No 7  
>KOG1074|consensus
Probab=99.90  E-value=8.8e-25  Score=182.46  Aligned_cols=142  Identities=36%  Similarity=0.729  Sum_probs=123.3

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHHHhcCC----CCeecC---cCcccccChhHH
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLAVHAGV----KPHICK---QCGHAFTQKSQL  136 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~----~~~~C~---~C~~~f~~~~~l  136 (247)
                      +.+|.+|.++..-.+.|+.|+++|++++||+|.+|++.|..+.+|+.|+.+|...    ..+.|+   +|-+.|.+...|
T Consensus       605 PNqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~l  684 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVTL  684 (958)
T ss_pred             ccceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhcccccccccc
Confidence            4679999999999999999999999999999999999999999999999888543    346788   888888887777


Q ss_pred             HHHHHHhCCC-Cc-------------------------------------------------------------------
Q psy2288         137 RLHEMRHGNI-RH-------------------------------------------------------------------  148 (247)
Q Consensus       137 ~~h~~~~~~~-~~-------------------------------------------------------------------  148 (247)
                      ..|++.|.+. .+                                                                   
T Consensus       685 pQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~t~~~~~tp~~~e~~~~  764 (958)
T KOG1074|consen  685 PQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTETEELDVTPPPPENSCG  764 (958)
T ss_pred             cceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCcccccccccccccccCCCccccccc
Confidence            7776665210 00                                                                   


Q ss_pred             --------------------------------------------------------------------------------
Q psy2288         149 --------------------------------------------------------------------------------  148 (247)
Q Consensus       149 --------------------------------------------------------------------------------  148 (247)
                                                                                                      
T Consensus       765 ~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~eg~~t~  844 (958)
T KOG1074|consen  765 RELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLNEGLATK  844 (958)
T ss_pred             cccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccccccccc
Confidence                                                                                            


Q ss_pred             -----------------------------------cccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHH
Q psy2288         149 -----------------------------------FACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMK  193 (247)
Q Consensus       149 -----------------------------------~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  193 (247)
                                                         ..|..|++.|.+.+.|..|+++|.+++||.|..|++.|..+..|+
T Consensus       845 ~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLK  924 (958)
T KOG1074|consen  845 TNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLK  924 (958)
T ss_pred             cccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhh
Confidence                                               569999999999999999999999999999999999999999999


Q ss_pred             HHHHhcCCCCCe
Q psy2288         194 EHLNRHKGVQPY  205 (247)
Q Consensus       194 ~H~~~h~~~~~~  205 (247)
                      .||.+|....++
T Consensus       925 vHMgtH~w~q~~  936 (958)
T KOG1074|consen  925 VHMGTHMWVQPP  936 (958)
T ss_pred             hhhccccccCCC
Confidence            999999876543


No 8  
>KOG3623|consensus
Probab=99.87  E-value=2.7e-23  Score=171.25  Aligned_cols=107  Identities=27%  Similarity=0.619  Sum_probs=95.7

Q ss_pred             CceecccccccccCHHHHHHHHHHhCC--CCceeccccccccCChHHHHHHHhhccCC-------------CCeeCCCCC
Q psy2288          35 KSLACNICSMVFCDEIVLNKHVEEHST--LGKFTCTVCKKVFNNIKSLKTHSRIHTGE-------------KPFRCSVCG   99 (247)
Q Consensus        35 ~~~~C~~C~~~~~~~~~l~~H~~~~~~--~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-------------~~~~C~~C~   99 (247)
                      ....|++|++.+.....|+.|++.-+.  +..|.|+.|..+|.....|.+||..|...             +-|+|.+|+
T Consensus       209 qlltcpycdrgykrltslkeHikyrhekne~nfsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECg  288 (1007)
T KOG3623|consen  209 QLLTCPYCDRGYKRLTSLKEHIKYRHEKNEPNFSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECG  288 (1007)
T ss_pred             hhhcchhHHHHHHHHHHHHHHHHHHHhhCCCCCcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccc
Confidence            347899999999999999999887443  44599999999999999999999988543             349999999


Q ss_pred             cccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHH
Q psy2288         100 KSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEM  141 (247)
Q Consensus       100 ~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  141 (247)
                      +.|..+..|+.|+++|.|++||.|+.|++.|.....+..|+.
T Consensus       289 KAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFSHSGSySSHmS  330 (1007)
T KOG3623|consen  289 KAFKFKHHLKEHLRIHSGEKPFECPNCKKRFSHSGSYSSHMS  330 (1007)
T ss_pred             hhhhhHHHHHhhheeecCCCCcCCcccccccccCCccccccc
Confidence            999999999999999999999999999999999999999974


No 9  
>KOG3576|consensus
Probab=99.73  E-value=1.4e-18  Score=122.95  Aligned_cols=114  Identities=30%  Similarity=0.656  Sum_probs=99.9

Q ss_pred             CCCeecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHH
Q psy2288         118 VKPHICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLN  197 (247)
Q Consensus       118 ~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~  197 (247)
                      ...|.|.+|++.|....-|.+|++-|...+.+.|..||+.|.+...|.+|.++|+|.+||+|..|+++|+++-+|..|++
T Consensus       115 ~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  115 QDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             CCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHH
Confidence            45588999999999998999999988888899999999999999999999999999999999999999999999999987


Q ss_pred             hcCCC-----------CCeecccccccccChHHHHHHHHhccCCC
Q psy2288         198 RHKGV-----------QPYSCSHCDKTFFDAQSLNKHKLSHKTSA  231 (247)
Q Consensus       198 ~h~~~-----------~~~~C~~C~~~f~~~~~l~~H~~~h~~~~  231 (247)
                      ..+|.           +.|.|..||.+-.....+..|+..|+..-
T Consensus       195 kvhgv~~~yaykerr~kl~vcedcg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCEDCGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecccCCCCCChhHHHHHHHhcCCCC
Confidence            76653           57999999999988889999998886543


No 10 
>KOG3576|consensus
Probab=99.66  E-value=5.5e-17  Score=114.88  Aligned_cols=85  Identities=42%  Similarity=0.807  Sum_probs=74.6

Q ss_pred             cCCceecccccccccCHHHHHHHHHHhCCCCceeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHH
Q psy2288          33 QQKSLACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHL  112 (247)
Q Consensus        33 ~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~  112 (247)
                      ++..+.|..|++.|.-+..|.+|++-|...+.+.|..|++.|.+..+|.+|+++|++.+||+|..|++.|...-+|..|+
T Consensus       114 d~d~ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl  193 (267)
T KOG3576|consen  114 DQDSFTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHL  193 (267)
T ss_pred             CCCeeeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHH
Confidence            45568899999999989999999999988888999999999999999999999999999999999999999999999998


Q ss_pred             HHhcC
Q psy2288         113 AVHAG  117 (247)
Q Consensus       113 ~~~~~  117 (247)
                      +..++
T Consensus       194 ~kvhg  198 (267)
T KOG3576|consen  194 KKVHG  198 (267)
T ss_pred             HHHcC
Confidence            65544


No 11 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.43  E-value=9.2e-13  Score=109.77  Aligned_cols=144  Identities=21%  Similarity=0.480  Sum_probs=92.8

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCeeCCC--CCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHH
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSV--CGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEM  141 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~  141 (247)
                      ...|+.|.+... ...|..|... .......|+.  |+..|.. ..+         +..+.|+.|++.|. ...|..|+.
T Consensus       407 ~V~C~NC~~~i~-l~~l~lHe~~-C~r~~V~Cp~~~Cg~v~~r-~el---------~~H~~C~~Cgk~f~-~s~LekH~~  473 (567)
T PLN03086        407 TVECRNCKHYIP-SRSIALHEAY-CSRHNVVCPHDGCGIVLRV-EEA---------KNHVHCEKCGQAFQ-QGEMEKHMK  473 (567)
T ss_pred             eEECCCCCCccc-hhHHHHHHhh-CCCcceeCCcccccceeec-ccc---------ccCccCCCCCCccc-hHHHHHHHH
Confidence            356777776533 3445566543 2334456764  7776632 212         23346777877775 466777777


Q ss_pred             HhCCCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcc----------cHHHHHHHHHhcCCCCCeeccccc
Q psy2288         142 RHGNIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFT----------RQIIMKEHLNRHKGVQPYSCSHCD  211 (247)
Q Consensus       142 ~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~~l~~H~~~h~~~~~~~C~~C~  211 (247)
                      .++  .++.|+ |+..+ ....|..|+.+|.+.+++.|+.|+..+.          ....|..|.... |.+++.|..||
T Consensus       474 ~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cg  548 (567)
T PLN03086        474 VFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCG  548 (567)
T ss_pred             hcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccC
Confidence            764  677787 87544 4577777877777888888888887774          234777887774 77788888888


Q ss_pred             ccccChHHHHHHHHh
Q psy2288         212 KTFFDAQSLNKHKLS  226 (247)
Q Consensus       212 ~~f~~~~~l~~H~~~  226 (247)
                      +.+..+ .|..|+-.
T Consensus       549 k~Vrlr-dm~~H~~~  562 (567)
T PLN03086        549 RSVMLK-EMDIHQIA  562 (567)
T ss_pred             Ceeeeh-hHHHHHHH
Confidence            777543 56667643


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.40  E-value=2.1e-12  Score=107.65  Aligned_cols=86  Identities=16%  Similarity=0.433  Sum_probs=44.4

Q ss_pred             cccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccccccc----------ChH
Q psy2288         149 FACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFF----------DAQ  218 (247)
Q Consensus       149 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~----------~~~  218 (247)
                      +.|+.|+..|. ...|..|+.+++  .++.|+ |+..+ .+..|..|+.+|.+.+++.|+.|++.|.          ...
T Consensus       454 ~~C~~Cgk~f~-~s~LekH~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s  528 (567)
T PLN03086        454 VHCEKCGQAFQ-QGEMEKHMKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLR  528 (567)
T ss_pred             ccCCCCCCccc-hHHHHHHHHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccccCccccchhhhhh
Confidence            45555555553 344555555543  455555 55433 3455555555555555555555555553          123


Q ss_pred             HHHHHHHhccCCCCCCCccccC
Q psy2288         219 SLNKHKLSHKTSADPISSAKGS  240 (247)
Q Consensus       219 ~l~~H~~~h~~~~~~~c~~c~~  240 (247)
                      .|..|..+. +.+++.|..|+.
T Consensus       529 ~Lt~HE~~C-G~rt~~C~~Cgk  549 (567)
T PLN03086        529 GMSEHESIC-GSRTAPCDSCGR  549 (567)
T ss_pred             hHHHHHHhc-CCcceEccccCC
Confidence            455555443 555555555544


No 13 
>PHA00733 hypothetical protein
Probab=99.26  E-value=6.2e-12  Score=86.01  Aligned_cols=94  Identities=17%  Similarity=0.307  Sum_probs=65.0

Q ss_pred             hHHHHHHHHhCCCCccccCCCccccCChHHHHHH--HH---HhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecc
Q psy2288         134 SQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRH--QR---SHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCS  208 (247)
Q Consensus       134 ~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H--~~---~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~  208 (247)
                      ..|.++.......+++.|.+|...|.....|..+  +.   .+.+.+||.|+.|++.|.+...|..|++.+  ..+|.|+
T Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~  103 (128)
T PHA00733         26 EELKRYHSLTPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCP  103 (128)
T ss_pred             HHhhhhhcCChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCC
Confidence            4444444444445667777777666665554444  11   234477888888888888888888888876  3568888


Q ss_pred             cccccccChHHHHHHHHhccC
Q psy2288         209 HCDKTFFDAQSLNKHKLSHKT  229 (247)
Q Consensus       209 ~C~~~f~~~~~l~~H~~~h~~  229 (247)
                      +|++.|.....|..|+...|+
T Consensus       104 ~CgK~F~~~~sL~~H~~~~h~  124 (128)
T PHA00733        104 VCGKEFRNTDSTLDHVCKKHN  124 (128)
T ss_pred             CCCCccCCHHHHHHHHHHhcC
Confidence            888888888888888876654


No 14 
>PHA00733 hypothetical protein
Probab=99.12  E-value=9.1e-11  Score=80.28  Aligned_cols=84  Identities=24%  Similarity=0.465  Sum_probs=48.8

Q ss_pred             hhcCCceecccccccccCHHHHHHH--HHH---hCCCCceeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCCh
Q psy2288          31 EAQQKSLACNICSMVFCDEIVLNKH--VEE---HSTLGKFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQR  105 (247)
Q Consensus        31 ~~~~~~~~C~~C~~~~~~~~~l~~H--~~~---~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~  105 (247)
                      .+.++++.|.+|...|.+...|..+  +..   .+...+|.|+.|++.|.+...|..|+..+  ..++.|+.|++.|.+.
T Consensus        35 ~~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~  112 (128)
T PHA00733         35 TPEQKRLIRAVVKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNT  112 (128)
T ss_pred             ChhhhhHHHHHHhhhccChhhhcchHHHHhhcccCCCCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCH
Confidence            3446777788877777766555544  111   22344566666666666666666666543  2345666666666666


Q ss_pred             hHHHHHHHHhc
Q psy2288         106 GILSSHLAVHA  116 (247)
Q Consensus       106 ~~l~~H~~~~~  116 (247)
                      ..|..|+...+
T Consensus       113 ~sL~~H~~~~h  123 (128)
T PHA00733        113 DSTLDHVCKKH  123 (128)
T ss_pred             HHHHHHHHHhc
Confidence            66666655443


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=99.09  E-value=4.5e-11  Score=67.41  Aligned_cols=44  Identities=18%  Similarity=0.487  Sum_probs=36.3

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHH
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLN  221 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~  221 (247)
                      .|+|+.||+.|....+|..|+++|+  ++|+|..|++.|.+.+.|.
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l~   48 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEYI   48 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceecccceeE
Confidence            4788888888888888888888887  6788888888888776653


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.89  E-value=1.2e-09  Score=52.70  Aligned_cols=26  Identities=35%  Similarity=0.925  Sum_probs=20.3

Q ss_pred             HHHHHHHhcCCCCCeecccccccccC
Q psy2288         191 IMKEHLNRHKGVQPYSCSHCDKTFFD  216 (247)
Q Consensus       191 ~l~~H~~~h~~~~~~~C~~C~~~f~~  216 (247)
                      +|.+|+++|+|++||+|++|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47788888888888888888888753


No 17 
>PHA02768 hypothetical protein; Provisional
Probab=98.84  E-value=1.3e-09  Score=61.47  Aligned_cols=42  Identities=17%  Similarity=0.445  Sum_probs=28.8

Q ss_pred             cccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHH
Q psy2288         149 FACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIM  192 (247)
Q Consensus       149 ~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  192 (247)
                      |.|+.||+.|...+.|..|+++|.  ++|+|..|++.|.+.+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            567777777777777777777766  566777777776655444


No 18 
>KOG3993|consensus
Probab=98.81  E-value=7.2e-10  Score=87.49  Aligned_cols=165  Identities=21%  Similarity=0.345  Sum_probs=99.1

Q ss_pred             ceecccccccccCHHHHHHHHHHhCCCCceeccccccccCChHHHHHHHhhccCC-------------------------
Q psy2288          36 SLACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKVFNNIKSLKTHSRIHTGE-------------------------   90 (247)
Q Consensus        36 ~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~-------------------------   90 (247)
                      .|.|.+|...|.+...|.+|.-.-.-...|+|+.|+++|.-...|..|.+.|...                         
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            4889999999999999999955433334699999999999999999998777432                         


Q ss_pred             --------CCeeCCCCCcccCChhHHHHHHHHhcCCCC-----------------eecCcCcccccChhHHHHHHHHh-C
Q psy2288          91 --------KPFRCSVCGKSFSQRGILSSHLAVHAGVKP-----------------HICKQCGHAFTQKSQLRLHEMRH-G  144 (247)
Q Consensus        91 --------~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~-----------------~~C~~C~~~f~~~~~l~~h~~~~-~  144 (247)
                              ..|.|.+|++.|+....|+.|+.+|+....                 +-+..++..+.....-..+..-+ .
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence                    125666666666666666666554432110                 11111211111110000000000 0


Q ss_pred             CCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHhcC
Q psy2288         145 NIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHK  200 (247)
Q Consensus       145 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  200 (247)
                      ......++.++..+++...--.+.+.-..+..|.|.+|.-.|.....|.+|+..-|
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence            00113466777666555443333333444566889999999999999999987643


No 19 
>KOG3993|consensus
Probab=98.76  E-value=1.5e-09  Score=85.75  Aligned_cols=165  Identities=19%  Similarity=0.292  Sum_probs=106.0

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHHHhcC--------------------------
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLAVHAG--------------------------  117 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~--------------------------  117 (247)
                      -|.|..|...|.+...|.+|.-.-+-...|.|+.|++.|+-..+|..|.++|.-                          
T Consensus       267 dyiCqLCK~kYeD~F~LAQHrC~RIV~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  267 DYICQLCKEKYEDAFALAQHRCPRIVHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHHHHHHhhhhHHHHhhccCCeeEEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhcc
Confidence            489999999999999999997555555679999999999999999999998721                          


Q ss_pred             -------CCCeecCcCcccccChhHHHHHHHHhCCCCc-----------------cccCCCccccCChHHHHHHHHHhC-
Q psy2288         118 -------VKPHICKQCGHAFTQKSQLRLHEMRHGNIRH-----------------FACNVCPFKFTTKSDLQRHQRSHE-  172 (247)
Q Consensus       118 -------~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~-----------------~~C~~C~~~~~~~~~l~~H~~~h~-  172 (247)
                             +..|.|.+|++.|.....|+.|+.+|.....                 +.+..+...+...+.--.+.-.+. 
T Consensus       347 rsg~dss~gi~~C~~C~KkFrRqAYLrKHqlthq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~  426 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHTCGKKFRRQAYLRKHQLTHQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAG  426 (500)
T ss_pred             ccCCcccCceeecHHhhhhhHHHHHHHHhHHhhhccccchhcccCcchhhcccccccccccccccccccccccceeeeec
Confidence                   1236677777777777777777655432110                 112222222211111000000000 


Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHHHHHHhcc
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      ......++.++..+..+..--.+.+.-..+..|-|.+|-..|.+..+|.+|...-|
T Consensus       427 sael~~pp~~~~ppsss~~sgg~~rlg~~~q~f~~ky~~atfyss~~ltrhin~~H  482 (500)
T KOG3993|consen  427 SAELELPPYDGSPPSSSGSSGGYGRLGIAEQGFTCKYCPATFYSSPGLTRHINKCH  482 (500)
T ss_pred             cccccCCCCCCCCcccCCCCCccccccchhhccccccchHhhhcCcchHhHhhhcC
Confidence            01123467777666665544444444444667999999999999999999976544


No 20 
>PHA00616 hypothetical protein
Probab=98.69  E-value=1.1e-08  Score=54.94  Aligned_cols=34  Identities=18%  Similarity=0.307  Sum_probs=19.9

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcCCCCCeeccc
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSH  209 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~  209 (247)
                      ||+|+.||+.|.+.++|..|++.|+|++++.|+.
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            3556666666666666666666666665555543


No 21 
>PHA00616 hypothetical protein
Probab=98.69  E-value=8.3e-09  Score=55.38  Aligned_cols=34  Identities=21%  Similarity=0.330  Sum_probs=31.9

Q ss_pred             CeecccccccccChHHHHHHHHhccCCCCCCCcc
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSA  237 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~  237 (247)
                      ||+|+.||+.|.+.++|..|+++|+++.++.|..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            6999999999999999999999999999988764


No 22 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.60  E-value=3.3e-08  Score=47.69  Aligned_cols=25  Identities=52%  Similarity=1.283  Sum_probs=18.6

Q ss_pred             HHHHHHHHhCCCCCcccCcCchhcc
Q psy2288         163 DLQRHQRSHEGVKPFRCEYCDKTFT  187 (247)
Q Consensus       163 ~l~~H~~~h~~~~~~~C~~C~~~f~  187 (247)
                      +|.+|+++|.+++||.|+.|++.|.
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEES
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeC
Confidence            3667777777777777777777775


No 23 
>PHA00732 hypothetical protein
Probab=98.47  E-value=1.1e-07  Score=59.03  Aligned_cols=36  Identities=31%  Similarity=0.691  Sum_probs=16.7

Q ss_pred             cccCcCchhcccHHHHHHHHHh-cCCCCCeeccccccccc
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNR-HKGVQPYSCSHCDKTFF  215 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~  215 (247)
                      |.|..|++.|.+...|..|++. |.+   +.|++|++.|.
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H~r~~H~~---~~C~~CgKsF~   38 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQHARRNHTL---TKCPVCNKSYR   38 (79)
T ss_pred             ccCCCCCCccCCHHHHHHHhhcccCC---CccCCCCCEeC
Confidence            4445555555555555555442 221   34555555544


No 24 
>PHA00732 hypothetical protein
Probab=98.27  E-value=6.9e-07  Score=55.51  Aligned_cols=48  Identities=27%  Similarity=0.654  Sum_probs=31.0

Q ss_pred             ccccCCCccccCChHHHHHHHHH-hCCCCCcccCcCchhcccHHHHHHHHHhcCC
Q psy2288         148 HFACNVCPFKFTTKSDLQRHQRS-HEGVKPFRCEYCDKTFTRQIIMKEHLNRHKG  201 (247)
Q Consensus       148 ~~~C~~C~~~~~~~~~l~~H~~~-h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~  201 (247)
                      ||.|..|++.|.+.+.|..|++. |.   ++.|+.|++.|.   .|..|+.++.+
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~~~~~~   49 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHFYSQYD   49 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---ChhhhhcccCC
Confidence            46677777777777777777764 33   246777777776   35667655544


No 25 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.25  E-value=1.9e-06  Score=49.73  Aligned_cols=49  Identities=27%  Similarity=0.521  Sum_probs=29.7

Q ss_pred             cccCcCchhcccHHHHHHHHHh-cCCC-CCeecccccccccChHHHHHHHHhcc
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNR-HKGV-QPYSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~-h~~~-~~~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      |.||.|++ ..+...|..|... |..+ +.+.||+|...+.  .+|..|+..+|
T Consensus         3 f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    3 FTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             cCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            66777777 3445667777654 3332 3577777776544  36777776654


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.20  E-value=3.2e-06  Score=48.74  Aligned_cols=49  Identities=22%  Similarity=0.444  Sum_probs=26.6

Q ss_pred             ceecccccccccCHHHHHHHHHHhCCC--CceeccccccccCChHHHHHHHhhc
Q psy2288          36 SLACNICSMVFCDEIVLNKHVEEHSTL--GKFTCTVCKKVFNNIKSLKTHSRIH   87 (247)
Q Consensus        36 ~~~C~~C~~~~~~~~~l~~H~~~~~~~--~~~~C~~C~~~f~~~~~l~~H~~~~   87 (247)
                      .|.||+|++ ..+...|..|+...+..  +.+.||+|...+.  ..|..|+...
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            356666666 34556666666554332  2466666665433  2555565544


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.14  E-value=1.7e-06  Score=40.39  Aligned_cols=22  Identities=32%  Similarity=0.742  Sum_probs=14.8

Q ss_pred             eecccccccccChHHHHHHHHh
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLS  226 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~  226 (247)
                      |+|++|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            5666677777777777666665


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.97  E-value=6.3e-06  Score=38.79  Aligned_cols=24  Identities=29%  Similarity=0.721  Sum_probs=14.6

Q ss_pred             eecccccccccChHHHHHHHHhcc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      |+|++|++.|.+...|..|+.+|+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHHS
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhhC
Confidence            566677777777777777766653


No 29 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.93  E-value=6.3e-06  Score=38.44  Aligned_cols=22  Identities=32%  Similarity=0.905  Sum_probs=14.5

Q ss_pred             cccCcCchhcccHHHHHHHHHh
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNR  198 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~  198 (247)
                      |.|+.|++.|.+...|..|++.
T Consensus         1 y~C~~C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHHHH
T ss_pred             CCCCCCCCccCCHHHHHHHHhH
Confidence            4566666666666666666655


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.91  E-value=9.7e-06  Score=53.35  Aligned_cols=73  Identities=23%  Similarity=0.435  Sum_probs=18.4

Q ss_pred             ccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHHHHHHhc
Q psy2288         150 ACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       150 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      +|..|+..|.+...|..|+...++...-    ....+.....+..+++.-. ...+.|.+|++.|.+...|..|++++
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~-~~~~~C~~C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKV-KESFRCPYCNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHHT
T ss_pred             Cccccccccccccccccccccccccccc----ccccccccccccccccccc-CCCCCCCccCCCCcCHHHHHHHHcCc
Confidence            3667777777777777777655543211    1111223333434433221 12578888888888888888888764


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.88  E-value=8.7e-06  Score=39.62  Aligned_cols=25  Identities=44%  Similarity=0.870  Sum_probs=18.7

Q ss_pred             CeecccccccccChHHHHHHHHhcc
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      ||+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            5777777777777777777777664


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.69  E-value=3.5e-05  Score=36.12  Aligned_cols=23  Identities=30%  Similarity=0.881  Sum_probs=14.1

Q ss_pred             cccCcCchhcccHHHHHHHHHhc
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNRH  199 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h  199 (247)
                      |.|+.|++.|.+...|..|+.+|
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            45667777777777777776655


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.63  E-value=4.2e-05  Score=50.27  Aligned_cols=72  Identities=24%  Similarity=0.410  Sum_probs=12.4

Q ss_pred             ecccccccccCHHHHHHHHHHhCCCCceeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHHH
Q psy2288          38 ACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLAV  114 (247)
Q Consensus        38 ~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~  114 (247)
                      +|..|+..|++...|..|+...++...-    ....+.....+..+...... ..+.|..|+..|.+...|..|++.
T Consensus         1 ~C~~C~~~f~~~~~l~~H~~~~H~~~~~----~~~~l~~~~~~~~~~~~~~~-~~~~C~~C~~~f~s~~~l~~Hm~~   72 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHMKKKHGFDIP----DQKYLVDPNRLLNYLRKKVK-ESFRCPYCNKTFRSREALQEHMRS   72 (100)
T ss_dssp             -----------------------------------------------------SSEEBSSSS-EESSHHHHHHHHHH
T ss_pred             Cccccccccccccccccccccccccccc----cccccccccccccccccccC-CCCCCCccCCCCcCHHHHHHHHcC
Confidence            3666666666666666666554432110    11111122222222221111 135555555555555555555554


No 34 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.60  E-value=4.1e-05  Score=37.17  Aligned_cols=25  Identities=40%  Similarity=0.856  Sum_probs=17.4

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcC
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHK  200 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~  200 (247)
                      +|+|..|++.|.+...|..|++.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCccCCccCChhHHHHHhHHhc
Confidence            4667777777777777777776654


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.41  E-value=0.00018  Score=39.58  Aligned_cols=32  Identities=19%  Similarity=0.371  Sum_probs=18.2

Q ss_pred             CCCCeecccccccccChHHHHHHHHhccCCCC
Q psy2288         201 GVQPYSCSHCDKTFFDAQSLNKHKLSHKTSAD  232 (247)
Q Consensus       201 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  232 (247)
                      .+.|..||+|+..+.+..+|.+|+...|+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45677777777777777777777766665554


No 36 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=97.22  E-value=0.00029  Score=33.04  Aligned_cols=23  Identities=30%  Similarity=0.704  Sum_probs=12.3

Q ss_pred             eecccccccccChHHHHHHHHhcc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      |+|+.|+.... ...|.+|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            45666666555 556666665544


No 37 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.21  E-value=0.00032  Score=33.28  Aligned_cols=23  Identities=35%  Similarity=0.807  Sum_probs=13.0

Q ss_pred             eecccccccccChHHHHHHHHhc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      |+|+.|++.|.+...|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            34555666666555565555544


No 38 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.09  E-value=0.00036  Score=33.04  Aligned_cols=23  Identities=35%  Similarity=0.714  Sum_probs=17.3

Q ss_pred             eecccccccccChHHHHHHHHhc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      |.|.+|+..|.+...|..|++++
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTTH
T ss_pred             CCCCCCCCCcCCHHHHHHHHCcC
Confidence            56777888888888888777654


No 39 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.02  E-value=0.00075  Score=37.20  Aligned_cols=32  Identities=19%  Similarity=0.435  Sum_probs=18.4

Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhcCCCCC
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQP  204 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~  204 (247)
                      .+.|-.|++|+..+.+..+|++|+...|+.+|
T Consensus        21 S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   21 SEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             cCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            45566777777777777777777777666553


No 40 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.01  E-value=0.00012  Score=56.48  Aligned_cols=67  Identities=25%  Similarity=0.509  Sum_probs=37.4

Q ss_pred             CCccccCC--CccccCChHHHHHHHHH-hCCCCCcccCc--CchhcccHHHHHHHHHhcCCCCCeecccccccccChHHH
Q psy2288         146 IRHFACNV--CPFKFTTKSDLQRHQRS-HEGVKPFRCEY--CDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSL  220 (247)
Q Consensus       146 ~~~~~C~~--C~~~~~~~~~l~~H~~~-h~~~~~~~C~~--C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l  220 (247)
                      ++||+|++  |++.|.+...|+-|+.- |..++..+=+.  =-..|            -...+||.|++|+|.+.+..+|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F------------~~~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIF------------SAKDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccc------------cccCCceeccccchhhccCccc
Confidence            58888875  88888888888888753 32222222111  00111            1224566666666666666555


Q ss_pred             HHHH
Q psy2288         221 NKHK  224 (247)
Q Consensus       221 ~~H~  224 (247)
                      .-|.
T Consensus       415 KYHr  418 (423)
T COG5189         415 KYHR  418 (423)
T ss_pred             eecc
Confidence            5553


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.00  E-value=0.00081  Score=31.82  Aligned_cols=23  Identities=39%  Similarity=0.915  Sum_probs=15.2

Q ss_pred             cccCcCchhcccHHHHHHHHHhc
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNRH  199 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h  199 (247)
                      |.|+.|++.|.....|..|++.|
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H   23 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTH   23 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHh
Confidence            45666777777777777766654


No 42 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.91  E-value=0.00068  Score=31.73  Aligned_cols=23  Identities=30%  Similarity=0.764  Sum_probs=15.0

Q ss_pred             cccCcCchhcccHHHHHHHHHhcC
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNRHK  200 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~  200 (247)
                      |+|+.|+.... ...|..|++.++
T Consensus         1 y~C~~C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHHHhhC
Confidence            56777777776 777777777654


No 43 
>KOG1146|consensus
Probab=96.87  E-value=0.00026  Score=64.64  Aligned_cols=50  Identities=22%  Similarity=0.204  Sum_probs=33.8

Q ss_pred             cccCcCchhcc-cHHHHHHHHHhcC------CCCCeecccccccccChHHHHHHHHh
Q psy2288         177 FRCEYCDKTFT-RQIIMKEHLNRHK------GVQPYSCSHCDKTFFDAQSLNKHKLS  226 (247)
Q Consensus       177 ~~C~~C~~~f~-~~~~l~~H~~~h~------~~~~~~C~~C~~~f~~~~~l~~H~~~  226 (247)
                      +.|-+|+...+ +...|..|..+-.      ....|+|.+|....+.+.++..|.++
T Consensus       735 ~~civcd~~st~~l~~l~~h~~~~rs~ke~v~g~~~~c~l~~y~t~~kanfqlh~Kt  791 (1406)
T KOG1146|consen  735 FDCIVCDVFSTDRLDQLWFHNTRERSRKEQVPGDVPSCKLKPYATNTKANFQLHNKT  791 (1406)
T ss_pred             HHHhhhhhhhhhhHHHHhhcchhhhhhhhcccCCCCcceecccccccchhhhhhccc
Confidence            77888876544 3344555543321      12349999999999999999888765


No 44 
>PRK04860 hypothetical protein; Provisional
Probab=96.86  E-value=0.00063  Score=48.49  Aligned_cols=38  Identities=29%  Similarity=0.769  Sum_probs=26.0

Q ss_pred             CCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccC
Q psy2288         175 KPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFD  216 (247)
Q Consensus       175 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~  216 (247)
                      -+|.|. |+.   ....+++|.++|+++++|.|..|+..|..
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~  155 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVF  155 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEE
Confidence            357776 765   45566777777777777777777776653


No 45 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=96.80  E-value=0.00043  Score=53.53  Aligned_cols=68  Identities=25%  Similarity=0.408  Sum_probs=46.1

Q ss_pred             CCceeccc--cccccCChHHHHHHHhhcc-CCCCeeCC--CCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHH
Q psy2288          62 LGKFTCTV--CKKVFNNIKSLKTHSRIHT-GEKPFRCS--VCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQL  136 (247)
Q Consensus        62 ~~~~~C~~--C~~~f~~~~~l~~H~~~~~-~~~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l  136 (247)
                      .+||+|++  |++.|.+...|+-|+..-+ ..+...-+  .--..|            ....+||.|.+|++.+.+...|
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F------------~~~~KPYrCevC~KRYKNlNGL  414 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIF------------SAKDKPYRCEVCDKRYKNLNGL  414 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccc------------cccCCceeccccchhhccCccc
Confidence            37899987  9999999999999976433 22211111  011112            3467889999999998888888


Q ss_pred             HHHHH
Q psy2288         137 RLHEM  141 (247)
Q Consensus       137 ~~h~~  141 (247)
                      +.|+.
T Consensus       415 KYHr~  419 (423)
T COG5189         415 KYHRK  419 (423)
T ss_pred             eeccc
Confidence            87764


No 46 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=96.56  E-value=0.0014  Score=30.98  Aligned_cols=22  Identities=32%  Similarity=0.905  Sum_probs=15.2

Q ss_pred             cccCcCchhcccHHHHHHHHHh
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNR  198 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~  198 (247)
                      |.|.+|+..|.+...|..|++.
T Consensus         1 ~~C~~C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDICNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETTTTEEESSHHHHHHHHTT
T ss_pred             CCCCCCCCCcCCHHHHHHHHCc
Confidence            4577777777777777777654


No 47 
>KOG1146|consensus
Probab=96.20  E-value=0.00049  Score=62.88  Aligned_cols=28  Identities=21%  Similarity=0.425  Sum_probs=20.3

Q ss_pred             CceeccccccccCChHHHHHHHhhccCC
Q psy2288          63 GKFTCTVCKKVFNNIKSLKTHSRIHTGE   90 (247)
Q Consensus        63 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~   90 (247)
                      +.++|+.|++.|.....|..||+..+.+
T Consensus       464 kt~~cpkc~~~yk~a~~L~vhmRskhp~  491 (1406)
T KOG1146|consen  464 KTLKCPKCNWHYKLAQTLGVHMRSKHPE  491 (1406)
T ss_pred             ccccCCccchhhhhHHHhhhcccccccc
Confidence            5677888887777777777777775444


No 48 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=96.16  E-value=0.0014  Score=31.69  Aligned_cols=22  Identities=36%  Similarity=0.735  Sum_probs=15.8

Q ss_pred             eecccccccccChHHHHHHHHh
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLS  226 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~  226 (247)
                      |-|..|++.|.+...|..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            5677777777777777777655


No 49 
>PRK04860 hypothetical protein; Provisional
Probab=96.14  E-value=0.0031  Score=45.01  Aligned_cols=37  Identities=22%  Similarity=0.430  Sum_probs=32.7

Q ss_pred             CCeecccccccccChHHHHHHHHhccCCCCCCCccccCCCc
Q psy2288         203 QPYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSKLF  243 (247)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~  243 (247)
                      -+|.|. |+.   ....+.+|.++|.++++|.|..|++.+.
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~  154 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLV  154 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeE
Confidence            479998 998   6678899999999999999999988764


No 50 
>KOG2231|consensus
Probab=95.88  E-value=0.042  Score=47.86  Aligned_cols=103  Identities=25%  Similarity=0.565  Sum_probs=60.3

Q ss_pred             CCCCCcccCChhHHHHHHHHhcCCCCeecCcC---ccccc------ChhHHHHHHHHhCC-CC----ccccCCCccccCC
Q psy2288          95 CSVCGKSFSQRGILSSHLAVHAGVKPHICKQC---GHAFT------QKSQLRLHEMRHGN-IR----HFACNVCPFKFTT  160 (247)
Q Consensus        95 C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C---~~~f~------~~~~l~~h~~~~~~-~~----~~~C~~C~~~~~~  160 (247)
                      |..| ..|.....|+.|+...+..  +.|..|   .+.|.      ....|..|++.--. +.    .-.|..|...|..
T Consensus       118 ~~~c-~~~~s~~~Lk~H~~~~H~~--~~c~lC~~~~kif~~e~k~Yt~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld  194 (669)
T KOG2231|consen  118 CLHC-TEFKSVENLKNHMRDQHKL--HLCSLCLQNLKIFINERKLYTRAELNLHLMFGDPDDESCRGHPLCKFCHERFLD  194 (669)
T ss_pred             Cccc-cchhHHHHHHHHHHHhhhh--hccccccccceeeeeeeehehHHHHHHHHhcCCCccccccCCccchhhhhhhcc
Confidence            4444 3444667777787433221  233332   22332      24556666654221 11    2468888888888


Q ss_pred             hHHHHHHHHHhCCCCCcccCcC------chhcccHHHHHHHHHhcCCCCCeecc
Q psy2288         161 KSDLQRHQRSHEGVKPFRCEYC------DKTFTRQIIMKEHLNRHKGVQPYSCS  208 (247)
Q Consensus       161 ~~~l~~H~~~h~~~~~~~C~~C------~~~f~~~~~l~~H~~~h~~~~~~~C~  208 (247)
                      ...|.+|++.++    |.|..|      +..|.....|..|.+.+|    |.|.
T Consensus       195 ~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H----flCE  240 (669)
T KOG2231|consen  195 DDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH----FLCE  240 (669)
T ss_pred             HHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC----cccc
Confidence            888888887766    455555      345667778888887766    5555


No 51 
>KOG2231|consensus
Probab=95.85  E-value=0.036  Score=48.26  Aligned_cols=47  Identities=26%  Similarity=0.460  Sum_probs=27.7

Q ss_pred             ecCcCcccccChhHHHHHHHHhCCCCccccCCCc------cccCChHHHHHHHHHhC
Q psy2288         122 ICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCP------FKFTTKSDLQRHQRSHE  172 (247)
Q Consensus       122 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~------~~~~~~~~l~~H~~~h~  172 (247)
                      .|..|...|.....|..|++..+    |.|..|.      .-|.....|..|.+..|
T Consensus       184 ~C~~C~~~fld~~el~rH~~~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~H  236 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRFDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGH  236 (669)
T ss_pred             cchhhhhhhccHHHHHHhhccce----eheeecCcccccchhcccchHHHHHhhhcC
Confidence            46677777777777776666433    4555553      22445566666665555


No 52 
>KOG2785|consensus
Probab=95.68  E-value=0.053  Score=43.55  Aligned_cols=52  Identities=21%  Similarity=0.505  Sum_probs=36.7

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcCCC-----------------------CCeeccccc---ccccChHHHHHHHHhc
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHKGV-----------------------QPYSCSHCD---KTFFDAQSLNKHKLSH  227 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------~~~~C~~C~---~~f~~~~~l~~H~~~h  227 (247)
                      |-.|-.|+..+.+...-..||..+||-                       .-|.|-.|+   +.|.+......||...
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~~K  243 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMRDK  243 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHhhc
Confidence            456666777777766666777666652                       247888888   8888888888888653


No 53 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=95.56  E-value=0.0031  Score=30.42  Aligned_cols=22  Identities=27%  Similarity=0.673  Sum_probs=14.6

Q ss_pred             eecccccccccCHHHHHHHHHH
Q psy2288          37 LACNICSMVFCDEIVLNKHVEE   58 (247)
Q Consensus        37 ~~C~~C~~~~~~~~~l~~H~~~   58 (247)
                      |.|..|++.|.+...+..|+++
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCTTS
T ss_pred             CCcccCCCCcCCHHHHHHHHcc
Confidence            4567777777777777666654


No 54 
>KOG2482|consensus
Probab=95.51  E-value=0.092  Score=41.53  Aligned_cols=24  Identities=25%  Similarity=0.599  Sum_probs=18.6

Q ss_pred             CeecccccccccChHHHHHHHHhc
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      .-.|-.|.-.|-....|..||.-+
T Consensus       334 ~~~c~~cd~~F~~e~~l~~hm~e~  357 (423)
T KOG2482|consen  334 KSRCAECDLSFWKEPGLLIHMVED  357 (423)
T ss_pred             ccccccccccccCcchhhhhcccc
Confidence            356788888888888888887554


No 55 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=95.31  E-value=0.016  Score=27.30  Aligned_cols=20  Identities=30%  Similarity=0.780  Sum_probs=11.9

Q ss_pred             eecccccccccChHHHHHHHH
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKL  225 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~  225 (247)
                      .+|+.||..| ....|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3566666666 4555666654


No 56 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=95.19  E-value=0.042  Score=43.44  Aligned_cols=126  Identities=25%  Similarity=0.493  Sum_probs=78.6

Q ss_pred             eeCCC--CCcccCChhHHHHHHHHhcCCCCeecCcCc---ccccC------hhHHHHHHHHhCCC----CccccCCCccc
Q psy2288          93 FRCSV--CGKSFSQRGILSSHLAVHAGVKPHICKQCG---HAFTQ------KSQLRLHEMRHGNI----RHFACNVCPFK  157 (247)
Q Consensus        93 ~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~---~~f~~------~~~l~~h~~~~~~~----~~~~C~~C~~~  157 (247)
                      |.|+.  |..+...-..|..|.++.++.  +.|.+|-   +.|+.      +..|+.|...-..+    -.-.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~--~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGF--VLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCc--EEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            66765  555444455677887766543  4566553   44543      34455554432211    12368899988


Q ss_pred             cCChHHHHHHHHHhCCCCCcccCcCch-------hcccHHHHHHHHHhcCCCCCeeccc--c--c--ccccChHHHHHHH
Q psy2288         158 FTTKSDLQRHQRSHEGVKPFRCEYCDK-------TFTRQIIMKEHLNRHKGVQPYSCSH--C--D--KTFFDAQSLNKHK  224 (247)
Q Consensus       158 ~~~~~~l~~H~~~h~~~~~~~C~~C~~-------~f~~~~~l~~H~~~h~~~~~~~C~~--C--~--~~f~~~~~l~~H~  224 (247)
                      |.+-..|.+|++..+.    .|-+|++       .|....+|..|.+.-+    |-|.+  |  |  ..|.....|..|+
T Consensus       230 FYdDDEL~~HcR~~HE----~ChICD~v~p~~~QYFK~Y~~Le~HF~~~h----y~ct~qtc~~~k~~vf~~~~el~~h~  301 (493)
T COG5236         230 FYDDDELRRHCRLRHE----ACHICDMVGPIRYQYFKSYEDLEAHFRNAH----YCCTFQTCRVGKCYVFPYHTELLEHL  301 (493)
T ss_pred             ecChHHHHHHHHhhhh----hhhhhhccCccchhhhhCHHHHHHHhhcCc----eEEEEEEEecCcEEEeccHHHHHHHH
Confidence            9999999999887664    4666654       3667778888876533    55543  3  2  3788888899997


Q ss_pred             Hhcc
Q psy2288         225 LSHK  228 (247)
Q Consensus       225 ~~h~  228 (247)
                      ...|
T Consensus       302 ~~~h  305 (493)
T COG5236         302 TRFH  305 (493)
T ss_pred             HHHh
Confidence            6543


No 57 
>KOG2785|consensus
Probab=95.17  E-value=0.093  Score=42.21  Aligned_cols=27  Identities=26%  Similarity=0.385  Sum_probs=22.6

Q ss_pred             CeecccccccccChHHHHHHHHhccCC
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHKTS  230 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (247)
                      |-.|-.|++.+.+...-..||..+|+-
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~Hgf  192 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGF  192 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCC
Confidence            578888999999988888999887664


No 58 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.77  E-value=0.062  Score=35.59  Aligned_cols=18  Identities=28%  Similarity=0.643  Sum_probs=8.8

Q ss_pred             CeecCcCcccccChhHHH
Q psy2288         120 PHICKQCGHAFTQKSQLR  137 (247)
Q Consensus       120 ~~~C~~C~~~f~~~~~l~  137 (247)
                      |..|++|+....+...|.
T Consensus        15 P~~CpiCgLtLVss~HLA   32 (112)
T TIGR00622        15 PVECPICGLTLILSTHLA   32 (112)
T ss_pred             CCcCCcCCCEEeccchHH
Confidence            344555555554444444


No 59 
>KOG4173|consensus
Probab=94.65  E-value=0.025  Score=41.29  Aligned_cols=74  Identities=27%  Similarity=0.687  Sum_probs=42.1

Q ss_pred             ccccCC--CccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHh-c---------CCCCCeec--cccccc
Q psy2288         148 HFACNV--CPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNR-H---------KGVQPYSC--SHCDKT  213 (247)
Q Consensus       148 ~~~C~~--C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~-h---------~~~~~~~C--~~C~~~  213 (247)
                      .+.|+.  |-..|.+...+..|..+-++.   .|..|.+.|.+..-|..|+.- |         .|.-.|+|  ..|+..
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~K  155 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEK  155 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhh
Confidence            344543  455566666666665554443   566666666666666666532 2         23344666  336666


Q ss_pred             ccChHHHHHHH
Q psy2288         214 FFDAQSLNKHK  224 (247)
Q Consensus       214 f~~~~~l~~H~  224 (247)
                      |-+...-..|+
T Consensus       156 FkT~r~RkdH~  166 (253)
T KOG4173|consen  156 FKTSRDRKDHM  166 (253)
T ss_pred             hhhhhhhhhHH
Confidence            66666666665


No 60 
>KOG2893|consensus
Probab=94.59  E-value=0.0093  Score=44.46  Aligned_cols=45  Identities=29%  Similarity=0.743  Sum_probs=33.5

Q ss_pred             cCcCchhcccHHHHHHHHHhcCCCCCeecccccccccChHHHHHH-HHhc
Q psy2288         179 CEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDAQSLNKH-KLSH  227 (247)
Q Consensus       179 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H-~~~h  227 (247)
                      |..|++.|.....|..|++..+    |+|-+|.+...+--.|..| |++|
T Consensus        13 cwycnrefddekiliqhqkakh----fkchichkkl~sgpglsihcmqvh   58 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIHCMQVH   58 (341)
T ss_pred             eeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceeehhhhh
Confidence            7778888888888888876533    8888888877777777777 4555


No 61 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.49  E-value=0.033  Score=28.51  Aligned_cols=24  Identities=29%  Similarity=0.566  Sum_probs=19.0

Q ss_pred             CeecccccccccChHHHHHHHHhc
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      +|.|.+|+..|.+...+..|+...
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHChH
Confidence            477888888888888888887553


No 62 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=93.85  E-value=0.13  Score=34.25  Aligned_cols=25  Identities=24%  Similarity=0.517  Sum_probs=16.3

Q ss_pred             eec----ccccccccChHHHHHHHHhccC
Q psy2288         205 YSC----SHCDKTFFDAQSLNKHKLSHKT  229 (247)
Q Consensus       205 ~~C----~~C~~~f~~~~~l~~H~~~h~~  229 (247)
                      |.|    +.|++.+.+...+.+|++.+|+
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            666    6666666666666666666543


No 63 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.80  E-value=0.011  Score=49.59  Aligned_cols=147  Identities=25%  Similarity=0.397  Sum_probs=69.5

Q ss_pred             CeeCCCCCcccCChhHHHHHHH--HhcCC--CCeecC--cCcccccChhHHHHHHHHhCCCCccccCC--CccccCChHH
Q psy2288          92 PFRCSVCGKSFSQRGILSSHLA--VHAGV--KPHICK--QCGHAFTQKSQLRLHEMRHGNIRHFACNV--CPFKFTTKSD  163 (247)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~h~~~~~~~~~~~C~~--C~~~~~~~~~  163 (247)
                      ++.|..|...|.....+..|..  .|.++  +++.|+  .|++.|.....+..|...+....+..+..  +...+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            3455555555555555555555  45555  556665  46666665555555555555444444332  1111111110


Q ss_pred             -----HHHHHHHhCCCCCcccC--cCchhcccHHHHHHHHHhcCCCC--CeecccccccccChHHHHHHHHhccCCCCCC
Q psy2288         164 -----LQRHQRSHEGVKPFRCE--YCDKTFTRQIIMKEHLNRHKGVQ--PYSCSHCDKTFFDAQSLNKHKLSHKTSADPI  234 (247)
Q Consensus       164 -----l~~H~~~h~~~~~~~C~--~C~~~f~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  234 (247)
                           .......-.....+.+.  .|...+.....+..|...+-...  .+.+..|.+.+.....+..|++.+....+..
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  448 (467)
T COG5048         369 NEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPLL  448 (467)
T ss_pred             CCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCcee
Confidence                 00000011112222222  24444445555555555544433  3455556666666666666666665555554


Q ss_pred             Cccc
Q psy2288         235 SSAK  238 (247)
Q Consensus       235 c~~c  238 (247)
                      |...
T Consensus       449 ~~~~  452 (467)
T COG5048         449 CSIL  452 (467)
T ss_pred             eccc
Confidence            4433


No 64 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=93.56  E-value=0.072  Score=27.19  Aligned_cols=23  Identities=30%  Similarity=0.834  Sum_probs=14.5

Q ss_pred             ceecccccccccCHHHHHHHHHH
Q psy2288          36 SLACNICSMVFCDEIVLNKHVEE   58 (247)
Q Consensus        36 ~~~C~~C~~~~~~~~~l~~H~~~   58 (247)
                      ++.|.+|+..|.+...+..|++.
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccccCCccCCHHHHHHHHCh
Confidence            45666666666666666666554


No 65 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=93.33  E-value=0.2  Score=33.25  Aligned_cols=109  Identities=17%  Similarity=0.315  Sum_probs=53.3

Q ss_pred             eeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHHhC
Q psy2288          65 FTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMRHG  144 (247)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~  144 (247)
                      |.||.|+..+              -+.|..|+.|+-+..+...|.+....--.-++|.=      ....          .
T Consensus         2 Y~CPrC~skv--------------C~LP~~CpiCgLtLVss~HLARSyHHLfPl~~f~e------v~~~----------~   51 (112)
T TIGR00622         2 YFCPQCRAKV--------------CELPVECPICGLTLILSTHLARSYHHLFPLKAFQE------IPLE----------E   51 (112)
T ss_pred             ccCCCCCCCc--------------cCCCCcCCcCCCEEeccchHHHhhhccCCCccccc------cccc----------c
Confidence            5677776543              23567788888887776666554321111111210      0000          0


Q ss_pred             CCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccc
Q psy2288         145 NIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCD  211 (247)
Q Consensus       145 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  211 (247)
                      ......|-.|+..|........  ..-.....|+|+.|...|-..-++..|...|      .|+.|.
T Consensus        52 ~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~dCD~fiHe~Lh------~CPGC~  110 (112)
T TIGR00622        52 YNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVDCDVFVHESLH------CCPGCI  110 (112)
T ss_pred             cCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCccccccchhhhhhcc------CCcCCC
Confidence            0111236666666654321000  0011233577777777777777777775444      366664


No 66 
>KOG2482|consensus
Probab=93.31  E-value=0.38  Score=38.24  Aligned_cols=134  Identities=19%  Similarity=0.301  Sum_probs=79.6

Q ss_pred             ceeccccccccc-CHHHHHHHHHHhCCC----------------------CceeccccccccCChHHHHHHHhhccCC--
Q psy2288          36 SLACNICSMVFC-DEIVLNKHVEEHSTL----------------------GKFTCTVCKKVFNNIKSLKTHSRIHTGE--   90 (247)
Q Consensus        36 ~~~C~~C~~~~~-~~~~l~~H~~~~~~~----------------------~~~~C~~C~~~f~~~~~l~~H~~~~~~~--   90 (247)
                      ..+|-+|...+. ..+....|+..-|+-                      ..+.|-.|.+.|.++..|+.||+.....  
T Consensus       144 slqClFCn~e~lgnRs~~l~Hlf~~H~lniGlpDniVyvnelLehLkekL~r~~CLyCekifrdkntLkeHMrkK~Hrri  223 (423)
T KOG2482|consen  144 SLQCLFCNNEGLGNRSEILEHLFHVHGLNIGLPDNIVYVNELLEHLKEKLERLRCLYCEKIFRDKNTLKEHMRKKRHRRI  223 (423)
T ss_pred             eeEEEEecchhcccHHHHHHHHHHHhhhccCCCcceeeHHHHHHHHHHHHhhheeeeeccccCCcHHHHHHHHhccCccc
Confidence            478999987654 567777776654321                      2478999999999999999999753211  


Q ss_pred             CC--------eeCCCCCcccCChhHHHHHH--HHh---------------cCCCC--eecCcCcccccChhHHHHHHHHh
Q psy2288          91 KP--------FRCSVCGKSFSQRGILSSHL--AVH---------------AGVKP--HICKQCGHAFTQKSQLRLHEMRH  143 (247)
Q Consensus        91 ~~--------~~C~~C~~~f~~~~~l~~H~--~~~---------------~~~~~--~~C~~C~~~f~~~~~l~~h~~~~  143 (247)
                      .|        |.-.+-..+-++.. ...+.  .+-               .+..+  ..|..|.....+...|..|+...
T Consensus       224 nPknreYDkfyiINY~ev~ks~t~-~~~e~dret~~d~~E~D~~wsDw~ed~a~a~~v~CLfC~~~~en~~~l~eHmk~v  302 (423)
T KOG2482|consen  224 NPKNREYDKFYIINYLEVGKSWTI-VHSEDDRETNEDINETDDTWSDWNEDDAEALSVVCLFCTNFYENPVFLFEHMKIV  302 (423)
T ss_pred             CCCccccceEEEEeHhhcCCccch-hhhhhhhhhhccccccccchhhhhcCCCCccceEEEeeccchhhHHHHHHHHHHH
Confidence            11        11111111111110 01111  000               01112  47888888777777788887643


Q ss_pred             CC---------------------------CCccccCCCccccCChHHHHHHHHH
Q psy2288         144 GN---------------------------IRHFACNVCPFKFTTKSDLQRHQRS  170 (247)
Q Consensus       144 ~~---------------------------~~~~~C~~C~~~~~~~~~l~~H~~~  170 (247)
                      +.                           ...-.|-.|...|.....|..|+.-
T Consensus       303 He~Dl~Ki~sd~~Ln~YqrvrviNyiRkq~~~~~c~~cd~~F~~e~~l~~hm~e  356 (423)
T KOG2482|consen  303 HEFDLLKIQSDYSLNFYQRVRVINYIRKQKKKSRCAECDLSFWKEPGLLIHMVE  356 (423)
T ss_pred             HHhhHHhhccccccchhhhhhHHHHHHHHhhccccccccccccCcchhhhhccc
Confidence            21                           1124578889999999999999854


No 67 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.09  E-value=0.019  Score=48.07  Aligned_cols=149  Identities=26%  Similarity=0.429  Sum_probs=92.3

Q ss_pred             ceeccccccccCChHHHHHHHh--hccCC--CCeeCC--CCCcccCChhHHHHHHHHhcCCCCeecCcCc--ccccChhH
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSR--IHTGE--KPFRCS--VCGKSFSQRGILSSHLAVHAGVKPHICKQCG--HAFTQKSQ  135 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~--~~~~~--~~~~C~--~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~--~~f~~~~~  135 (247)
                      ++.|..|...|.....+..|..  .|..+  .++.|+  .|++.|.+...+..|...+....++.+..-.  ..+.....
T Consensus       289 ~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  368 (467)
T COG5048         289 PIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLN  368 (467)
T ss_pred             CCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccC
Confidence            5778888888888888888888  67777  788888  6888888888888888877777666654422  22221111


Q ss_pred             H-----HHHHHHhCCCCccccC--CCccccCChHHHHHHHHHhCCCC--CcccCcCchhcccHHHHHHHHHhcCCCCCee
Q psy2288         136 L-----RLHEMRHGNIRHFACN--VCPFKFTTKSDLQRHQRSHEGVK--PFRCEYCDKTFTRQIIMKEHLNRHKGVQPYS  206 (247)
Q Consensus       136 l-----~~h~~~~~~~~~~~C~--~C~~~~~~~~~l~~H~~~h~~~~--~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~  206 (247)
                      -     ............+.+.  .|...+.....+..|...+....  .+.+..|...+.....+..|++.+.-..++.
T Consensus       369 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  448 (467)
T COG5048         369 NEPPQSLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNHAPLL  448 (467)
T ss_pred             CCCccchhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccCCcee
Confidence            0     0000011112222222  24444455555555555555544  3556778888888888888888887776666


Q ss_pred             cccccc
Q psy2288         207 CSHCDK  212 (247)
Q Consensus       207 C~~C~~  212 (247)
                      |..+..
T Consensus       449 ~~~~~~  454 (467)
T COG5048         449 CSILKS  454 (467)
T ss_pred             eccccc
Confidence            655544


No 68 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=92.71  E-value=0.22  Score=39.53  Aligned_cols=77  Identities=21%  Similarity=0.305  Sum_probs=39.3

Q ss_pred             eeccc--ccccccCHHHHHHHHHHhCCCCceecccccc---ccC------ChHHHHHHHhhccCCC----CeeCCCCCcc
Q psy2288          37 LACNI--CSMVFCDEIVLNKHVEEHSTLGKFTCTVCKK---VFN------NIKSLKTHSRIHTGEK----PFRCSVCGKS  101 (247)
Q Consensus        37 ~~C~~--C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~---~f~------~~~~l~~H~~~~~~~~----~~~C~~C~~~  101 (247)
                      |.||.  |..+......|..|.+..+.  .+.|.+|-.   .|.      ++..|+.|...-..+.    --.|..|...
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~--~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~FC~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHG--FVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIFCKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcC--cEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhhccce
Confidence            45653  55555556677777776555  456666632   232      2233444433221111    1235566666


Q ss_pred             cCChhHHHHHHHHh
Q psy2288         102 FSQRGILSSHLAVH  115 (247)
Q Consensus       102 f~~~~~l~~H~~~~  115 (247)
                      |.+.+.|..|++..
T Consensus       230 FYdDDEL~~HcR~~  243 (493)
T COG5236         230 FYDDDELRRHCRLR  243 (493)
T ss_pred             ecChHHHHHHHHhh
Confidence            66666666665543


No 69 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=92.59  E-value=0.091  Score=26.59  Aligned_cols=8  Identities=38%  Similarity=1.103  Sum_probs=3.6

Q ss_pred             ccccCCCc
Q psy2288         148 HFACNVCP  155 (247)
Q Consensus       148 ~~~C~~C~  155 (247)
                      ++.||.|+
T Consensus        17 ~~~CP~Cg   24 (33)
T cd00350          17 PWVCPVCG   24 (33)
T ss_pred             CCcCcCCC
Confidence            34444444


No 70 
>KOG2893|consensus
Probab=92.38  E-value=0.034  Score=41.55  Aligned_cols=44  Identities=30%  Similarity=0.544  Sum_probs=36.4

Q ss_pred             eecccccccccCHHHHHHHHHHhCCCCceeccccccccCChHHHHHHH
Q psy2288          37 LACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKVFNNIKSLKTHS   84 (247)
Q Consensus        37 ~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~   84 (247)
                      -+|=+|++.|.+...|.+|++..+    |+|.+|.+...+--.|..|-
T Consensus        11 pwcwycnrefddekiliqhqkakh----fkchichkkl~sgpglsihc   54 (341)
T KOG2893|consen   11 PWCWYCNREFDDEKILIQHQKAKH----FKCHICHKKLFSGPGLSIHC   54 (341)
T ss_pred             ceeeecccccchhhhhhhhhhhcc----ceeeeehhhhccCCCceeeh
Confidence            469999999999999999988754    78999998877777777663


No 71 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=92.35  E-value=0.072  Score=25.32  Aligned_cols=9  Identities=33%  Similarity=0.818  Sum_probs=4.9

Q ss_pred             ccCcCchhc
Q psy2288         178 RCEYCDKTF  186 (247)
Q Consensus       178 ~C~~C~~~f  186 (247)
                      .|+.||..|
T Consensus        16 ~Cp~CG~~F   24 (26)
T PF10571_consen   16 FCPHCGYDF   24 (26)
T ss_pred             cCCCCCCCC
Confidence            455555554


No 72 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=92.06  E-value=0.33  Score=32.34  Aligned_cols=54  Identities=22%  Similarity=0.600  Sum_probs=42.3

Q ss_pred             CccccCCCccccCChHHHHHHHHHhCCC------------------------------------------CCccc----C
Q psy2288         147 RHFACNVCPFKFTTKSDLQRHQRSHEGV------------------------------------------KPFRC----E  180 (247)
Q Consensus       147 ~~~~C~~C~~~~~~~~~l~~H~~~h~~~------------------------------------------~~~~C----~  180 (247)
                      +-..|..|+.++.- +.+..|++..+..                                          ..|.|    +
T Consensus        10 ~vlIC~~C~~av~~-~~v~~HL~~~H~~~~~~~~~~i~~~~~~~~~l~~~~~~~~~p~~~~~Pi~gLp~~~G~~C~~~~~   88 (109)
T PF12013_consen   10 RVLICRQCQYAVQP-SEVESHLRKRHHILKSQERQRIVEAIRQWPDLLPDPDDLQIPPDPSPPIPGLPVYDGYRCQCDPP   88 (109)
T ss_pred             CEEEeCCCCcccCc-hHHHHHHHHhcccccHHHHHHHHHHHHhhhhcccCccccCCCCCCCCcCCCCCCCCCeeeecCCC
Confidence            44679999988765 7888888743311                                          12889    9


Q ss_pred             cCchhcccHHHHHHHHHhcCC
Q psy2288         181 YCDKTFTRQIIMKEHLNRHKG  201 (247)
Q Consensus       181 ~C~~~f~~~~~l~~H~~~h~~  201 (247)
                      .|++.+.+...+.+|++.+||
T Consensus        89 ~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   89 HCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CCCcEeccHHHHHHHHHHhcC
Confidence            999999999999999998775


No 73 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=89.54  E-value=0.18  Score=27.45  Aligned_cols=11  Identities=18%  Similarity=0.658  Sum_probs=5.0

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      |.|..||..|.
T Consensus         3 Y~C~~Cg~~~~   13 (44)
T smart00659        3 YICGECGRENE   13 (44)
T ss_pred             EECCCCCCEee
Confidence            44444444433


No 74 
>PHA00626 hypothetical protein
Probab=89.48  E-value=0.1  Score=29.45  Aligned_cols=13  Identities=23%  Similarity=0.557  Sum_probs=6.6

Q ss_pred             CCeeccccccccc
Q psy2288         203 QPYSCSHCDKTFF  215 (247)
Q Consensus       203 ~~~~C~~C~~~f~  215 (247)
                      ..|+|+.||..|+
T Consensus        22 nrYkCkdCGY~ft   34 (59)
T PHA00626         22 DDYVCCDCGYNDS   34 (59)
T ss_pred             cceEcCCCCCeec
Confidence            3455555555553


No 75 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=89.24  E-value=0.16  Score=28.63  Aligned_cols=31  Identities=26%  Similarity=0.427  Sum_probs=20.6

Q ss_pred             hhcCCceecccccccccCHHHHHHHHHHhCC
Q psy2288          31 EAQQKSLACNICSMVFCDEIVLNKHVEEHST   61 (247)
Q Consensus        31 ~~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~   61 (247)
                      ..++.-+.||-|+..|........|+...++
T Consensus        12 RDGE~~lrCPRC~~~FR~~K~Y~RHVNKaH~   42 (65)
T COG4049          12 RDGEEFLRCPRCGMVFRRRKDYIRHVNKAHG   42 (65)
T ss_pred             cCCceeeeCCchhHHHHHhHHHHHHhhHHhh
Confidence            3455667777777777777777777665444


No 76 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=88.03  E-value=0.26  Score=27.78  Aligned_cols=24  Identities=21%  Similarity=0.476  Sum_probs=12.1

Q ss_pred             CCCCeecccccccccChHHHHHHH
Q psy2288         201 GVQPYSCSHCDKTFFDAQSLNKHK  224 (247)
Q Consensus       201 ~~~~~~C~~C~~~f~~~~~l~~H~  224 (247)
                      |+..+.||-||..|....+..+|+
T Consensus        14 GE~~lrCPRC~~~FR~~K~Y~RHV   37 (65)
T COG4049          14 GEEFLRCPRCGMVFRRRKDYIRHV   37 (65)
T ss_pred             CceeeeCCchhHHHHHhHHHHHHh
Confidence            344455555555555555555554


No 77 
>KOG4173|consensus
Probab=87.63  E-value=0.28  Score=35.97  Aligned_cols=84  Identities=24%  Similarity=0.453  Sum_probs=49.9

Q ss_pred             CeeCCC--CCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHHHHHHHH
Q psy2288          92 PFRCSV--CGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRHQR  169 (247)
Q Consensus        92 ~~~C~~--C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~  169 (247)
                      .+.|+.  |...|.+...+..|..+.++.   .|..|.+.|++...|..|+...+.                +.|  ...
T Consensus        79 ~~~cqvagc~~~~d~lD~~E~hY~~~h~~---sCs~C~r~~Pt~hLLd~HI~E~HD----------------s~F--qa~  137 (253)
T KOG4173|consen   79 AFACQVAGCCQVFDALDDYEHHYHTLHGN---SCSFCKRAFPTGHLLDAHILEWHD----------------SLF--QAL  137 (253)
T ss_pred             cccccccchHHHHhhhhhHHHhhhhcccc---hhHHHHHhCCchhhhhHHHHHHHH----------------HHH--HHH
Confidence            356665  556666666666666544443   477777777777777777654221                000  112


Q ss_pred             HhCCCCCcccC--cCchhcccHHHHHHHH
Q psy2288         170 SHEGVKPFRCE--YCDKTFTRQIIMKEHL  196 (247)
Q Consensus       170 ~h~~~~~~~C~--~C~~~f~~~~~l~~H~  196 (247)
                      +..|...|+|-  .|+..|.+...-..|+
T Consensus       138 veRG~dMy~ClvEgCt~KFkT~r~RkdH~  166 (253)
T KOG4173|consen  138 VERGQDMYQCLVEGCTEKFKTSRDRKDHM  166 (253)
T ss_pred             HHcCccHHHHHHHhhhhhhhhhhhhhhHH
Confidence            33455667773  4777777777777776


No 78 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=87.58  E-value=0.68  Score=32.74  Aligned_cols=12  Identities=17%  Similarity=0.520  Sum_probs=6.1

Q ss_pred             ceeccccccccc
Q psy2288          36 SLACNICSMVFC   47 (247)
Q Consensus        36 ~~~C~~C~~~~~   47 (247)
                      .|.|+.|+..|.
T Consensus        99 ~Y~Cp~C~~~y~  110 (147)
T smart00531       99 YYKCPNCQSKYT  110 (147)
T ss_pred             EEECcCCCCEee
Confidence            455555555544


No 79 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=87.50  E-value=0.48  Score=27.25  Aligned_cols=32  Identities=25%  Similarity=0.517  Sum_probs=16.2

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcCCCCCeecccccc
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDK  212 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  212 (247)
                      .|.|+.||.....+..--+     .-..+|+|+.||.
T Consensus        27 ~F~CPnCGe~~I~Rc~~CR-----k~g~~Y~Cp~CGF   58 (61)
T COG2888          27 KFPCPNCGEVEIYRCAKCR-----KLGNPYRCPKCGF   58 (61)
T ss_pred             EeeCCCCCceeeehhhhHH-----HcCCceECCCcCc
Confidence            3667777755443322111     1135677777764


No 80 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=87.38  E-value=0.38  Score=24.49  Aligned_cols=10  Identities=30%  Similarity=0.856  Sum_probs=5.5

Q ss_pred             CCeecccccc
Q psy2288         203 QPYSCSHCDK  212 (247)
Q Consensus       203 ~~~~C~~C~~  212 (247)
                      .|-.||+||.
T Consensus        17 ~p~~CP~Cg~   26 (34)
T cd00729          17 APEKCPICGA   26 (34)
T ss_pred             CCCcCcCCCC
Confidence            3456666654


No 81 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=86.76  E-value=0.3  Score=32.43  Aligned_cols=29  Identities=24%  Similarity=0.638  Sum_probs=15.3

Q ss_pred             ccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccCh
Q psy2288         178 RCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDA  217 (247)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  217 (247)
                      .|+.||..|...           +..|..||+||..|.-.
T Consensus        11 ~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   11 TCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             cCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            466666555533           13455666666655433


No 82 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=86.68  E-value=0.82  Score=32.75  Aligned_cols=35  Identities=20%  Similarity=0.379  Sum_probs=23.4

Q ss_pred             hCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccc
Q psy2288         171 HEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTF  214 (247)
Q Consensus       171 h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  214 (247)
                      .....-|.|+.|+..|+...++.         .-|.||.||...
T Consensus       104 e~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       104 ETNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             ccCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            34455577888887777776663         248888888643


No 83 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=86.56  E-value=0.61  Score=22.11  Aligned_cols=20  Identities=20%  Similarity=0.388  Sum_probs=14.2

Q ss_pred             eecccccccccChHHHHHHHH
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKL  225 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~  225 (247)
                      ..||+|++.+ ....+..|+-
T Consensus         2 v~CPiC~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPVCFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCCCcCcc-cHHHHHHHHH
Confidence            3688888887 5567777764


No 84 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=86.00  E-value=0.17  Score=27.18  Aligned_cols=29  Identities=28%  Similarity=0.473  Sum_probs=15.9

Q ss_pred             eecccccccccChHHHHHHHHhccCCCCCCCccccC
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGS  240 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~  240 (247)
                      |+|..||..|.....+      .. ..+..|+.||+
T Consensus         6 y~C~~Cg~~fe~~~~~------~~-~~~~~CP~Cg~   34 (42)
T PF09723_consen    6 YRCEECGHEFEVLQSI------SE-DDPVPCPECGS   34 (42)
T ss_pred             EEeCCCCCEEEEEEEc------CC-CCCCcCCCCCC
Confidence            6677777666432221      11 45666777766


No 85 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=85.79  E-value=0.87  Score=32.61  Aligned_cols=31  Identities=19%  Similarity=0.382  Sum_probs=17.1

Q ss_pred             CCceecccccccccCHHHHHHHHHHhCCCCceeccccccc
Q psy2288          34 QKSLACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKKV   73 (247)
Q Consensus        34 ~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~~   73 (247)
                      ..-|.|+.|+..|+...++.         ..|.||.||..
T Consensus       107 ~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~  137 (158)
T TIGR00373       107 NMFFICPNMCVRFTFNEAME---------LNFTCPRCGAM  137 (158)
T ss_pred             CCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCE
Confidence            34466666666665555553         14666666654


No 86 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=85.68  E-value=0.94  Score=23.38  Aligned_cols=8  Identities=25%  Similarity=1.057  Sum_probs=3.2

Q ss_pred             cccccccc
Q psy2288          67 CTVCKKVF   74 (247)
Q Consensus        67 C~~C~~~f   74 (247)
                      |+.|+..|
T Consensus         5 Cp~C~~~y   12 (36)
T PF13717_consen    5 CPNCQAKY   12 (36)
T ss_pred             CCCCCCEE
Confidence            34444333


No 87 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=85.43  E-value=0.89  Score=23.62  Aligned_cols=8  Identities=38%  Similarity=0.995  Sum_probs=3.1

Q ss_pred             cccccccc
Q psy2288          39 CNICSMVF   46 (247)
Q Consensus        39 C~~C~~~~   46 (247)
                      ||.|+..|
T Consensus         5 CP~C~~~f   12 (37)
T PF13719_consen    5 CPNCQTRF   12 (37)
T ss_pred             CCCCCceE
Confidence            33343333


No 88 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=85.31  E-value=0.4  Score=36.59  Aligned_cols=27  Identities=26%  Similarity=0.501  Sum_probs=22.8

Q ss_pred             CCCeecccccccccChHHHHHHHHhcc
Q psy2288         202 VQPYSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       202 ~~~~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      .+++.||.||........|..-.++|.
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmStR~hk  233 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMSTRSHK  233 (314)
T ss_pred             CCCCCCCCCCCcccccccceeeeecch
Confidence            478999999999999888888777773


No 89 
>KOG2186|consensus
Probab=85.13  E-value=0.63  Score=35.44  Aligned_cols=48  Identities=25%  Similarity=0.562  Sum_probs=33.0

Q ss_pred             CeeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHH
Q psy2288          92 PFRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMR  142 (247)
Q Consensus        92 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~  142 (247)
                      .|.|..||....- ..+..|+..-.+ ..|.|..|++.|.. ..+..|..-
T Consensus         3 ~FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kC   50 (276)
T KOG2186|consen    3 FFTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKC   50 (276)
T ss_pred             EEehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhh
Confidence            3678888876554 446667766655 66888888888876 566667653


No 90 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=85.04  E-value=0.37  Score=26.72  Aligned_cols=10  Identities=20%  Similarity=1.059  Sum_probs=5.3

Q ss_pred             cccCcCchhc
Q psy2288         177 FRCEYCDKTF  186 (247)
Q Consensus       177 ~~C~~C~~~f  186 (247)
                      |.|..|++.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            4555555554


No 91 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.70  E-value=0.74  Score=26.57  Aligned_cols=9  Identities=33%  Similarity=0.685  Sum_probs=4.5

Q ss_pred             cccCCCccc
Q psy2288         149 FACNVCPFK  157 (247)
Q Consensus       149 ~~C~~C~~~  157 (247)
                      |.|+.||..
T Consensus        26 F~CPnCG~~   34 (59)
T PRK14890         26 FLCPNCGEV   34 (59)
T ss_pred             eeCCCCCCe
Confidence            455555544


No 92 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=84.62  E-value=0.3  Score=25.88  Aligned_cols=11  Identities=45%  Similarity=1.135  Sum_probs=5.6

Q ss_pred             eeccccccccc
Q psy2288         205 YSCSHCDKTFF  215 (247)
Q Consensus       205 ~~C~~C~~~f~  215 (247)
                      |+|+.||..|.
T Consensus         6 y~C~~Cg~~fe   16 (41)
T smart00834        6 YRCEDCGHTFE   16 (41)
T ss_pred             EEcCCCCCEEE
Confidence            45555555443


No 93 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=84.13  E-value=1.1  Score=32.83  Aligned_cols=33  Identities=24%  Similarity=0.547  Sum_probs=21.3

Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccc
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTF  214 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  214 (247)
                      ...-|.|+.|+..|+...++.         .-|.|+.||...
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L  146 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEML  146 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCC
Confidence            344577777777777666542         247777777644


No 94 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=83.24  E-value=0.17  Score=35.89  Aligned_cols=14  Identities=36%  Similarity=0.532  Sum_probs=8.5

Q ss_pred             cccCcCchhcccHH
Q psy2288         177 FRCEYCDKTFTRQI  190 (247)
Q Consensus       177 ~~C~~C~~~f~~~~  190 (247)
                      ++|+.||..|.+..
T Consensus        29 ~~c~~c~~~f~~~e   42 (154)
T PRK00464         29 RECLACGKRFTTFE   42 (154)
T ss_pred             eeccccCCcceEeE
Confidence            56666666666543


No 95 
>KOG2807|consensus
Probab=82.76  E-value=1.8  Score=34.34  Aligned_cols=25  Identities=24%  Similarity=0.476  Sum_probs=13.8

Q ss_pred             CCeecccccccccChHHHHHHHHhc
Q psy2288         203 QPYSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      ..|+|+.|...|=---+.-.|-..|
T Consensus       344 ~~y~C~~Ck~~FCldCDv~iHesLh  368 (378)
T KOG2807|consen  344 GRYRCESCKNVFCLDCDVFIHESLH  368 (378)
T ss_pred             CcEEchhccceeeccchHHHHhhhh
Confidence            3466666666665555555554333


No 96 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=82.75  E-value=1.2  Score=32.61  Aligned_cols=16  Identities=19%  Similarity=0.389  Sum_probs=8.1

Q ss_pred             ceecccccccccCHHH
Q psy2288          36 SLACNICSMVFCDEIV   51 (247)
Q Consensus        36 ~~~C~~C~~~~~~~~~   51 (247)
                      -|.|+.|+..|+...+
T Consensus       117 ~Y~Cp~C~~rytf~eA  132 (178)
T PRK06266        117 FFFCPNCHIRFTFDEA  132 (178)
T ss_pred             EEECCCCCcEEeHHHH
Confidence            4555555555544443


No 97 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=82.35  E-value=1.2  Score=23.08  Aligned_cols=8  Identities=38%  Similarity=1.032  Sum_probs=3.2

Q ss_pred             cccccccc
Q psy2288          39 CNICSMVF   46 (247)
Q Consensus        39 C~~C~~~~   46 (247)
                      |+.|+..|
T Consensus         5 CP~C~~~~   12 (38)
T TIGR02098         5 CPNCKTSF   12 (38)
T ss_pred             CCCCCCEE
Confidence            44444433


No 98 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=82.10  E-value=0.7  Score=22.76  Aligned_cols=25  Identities=20%  Similarity=0.692  Sum_probs=10.2

Q ss_pred             ccCcCchhcccHHHHHHHHHhcCCCCCeeccccccc
Q psy2288         178 RCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKT  213 (247)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  213 (247)
                      .|+.|+..+.+           .+...|.|+.|+..
T Consensus         4 ~Cp~C~se~~y-----------~D~~~~vCp~C~~e   28 (30)
T PF08274_consen    4 KCPLCGSEYTY-----------EDGELLVCPECGHE   28 (30)
T ss_dssp             --TTT-----E-----------E-SSSEEETTTTEE
T ss_pred             CCCCCCCccee-----------ccCCEEeCCccccc
Confidence            46666655554           33445777777654


No 99 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=81.58  E-value=0.43  Score=26.92  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=5.6

Q ss_pred             eeccccccccc
Q psy2288         205 YSCSHCDKTFF  215 (247)
Q Consensus       205 ~~C~~C~~~f~  215 (247)
                      |+|..||..|.
T Consensus         6 y~C~~Cg~~fe   16 (52)
T TIGR02605         6 YRCTACGHRFE   16 (52)
T ss_pred             EEeCCCCCEeE
Confidence            45555555443


No 100
>KOG2593|consensus
Probab=81.57  E-value=1.5  Score=36.21  Aligned_cols=37  Identities=22%  Similarity=0.473  Sum_probs=17.4

Q ss_pred             CCeecccccccccChHHHHHHHHhccCCCCCCCccccCCC
Q psy2288         203 QPYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSKL  242 (247)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~  242 (247)
                      .-|.||.|++.|+.   |..-...-.....|.|..|++.+
T Consensus       127 ~~Y~Cp~C~kkyt~---Lea~~L~~~~~~~F~C~~C~gel  163 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTS---LEALQLLDNETGEFHCENCGGEL  163 (436)
T ss_pred             ccccCCccccchhh---hHHHHhhcccCceEEEecCCCch
Confidence            34555555555542   33333333334455555555544


No 101
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=80.96  E-value=1  Score=24.69  Aligned_cols=8  Identities=25%  Similarity=0.746  Sum_probs=3.7

Q ss_pred             eecccccc
Q psy2288         205 YSCSHCDK  212 (247)
Q Consensus       205 ~~C~~C~~  212 (247)
                      ..|+.||.
T Consensus        22 ~~Cp~CG~   29 (46)
T PRK00398         22 VRCPYCGY   29 (46)
T ss_pred             eECCCCCC
Confidence            44444443


No 102
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=80.90  E-value=1.1  Score=32.24  Aligned_cols=11  Identities=36%  Similarity=0.845  Sum_probs=5.9

Q ss_pred             CCCCcccCcCc
Q psy2288         173 GVKPFRCEYCD  183 (247)
Q Consensus       173 ~~~~~~C~~C~  183 (247)
                      ++.|-.||+||
T Consensus       146 ge~P~~CPiCg  156 (166)
T COG1592         146 GEAPEVCPICG  156 (166)
T ss_pred             CCCCCcCCCCC
Confidence            34455566665


No 103
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=79.53  E-value=0.24  Score=37.45  Aligned_cols=20  Identities=25%  Similarity=0.589  Sum_probs=12.9

Q ss_pred             CCceecccccccccCHHHHH
Q psy2288          34 QKSLACNICSMVFCDEIVLN   53 (247)
Q Consensus        34 ~~~~~C~~C~~~~~~~~~l~   53 (247)
                      .+.+.||.|+..|.+...+.
T Consensus         3 ~k~~~CPvC~~~F~~~~vrs   22 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKVRS   22 (214)
T ss_pred             CCceECCCCCCeeeeeEEEc
Confidence            35677888887777664433


No 104
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=79.49  E-value=0.44  Score=36.03  Aligned_cols=18  Identities=44%  Similarity=0.680  Sum_probs=13.1

Q ss_pred             CCceeccccccccCChHH
Q psy2288          62 LGKFTCTVCKKVFNNIKS   79 (247)
Q Consensus        62 ~~~~~C~~C~~~f~~~~~   79 (247)
                      ++.+.||+|+..|.+..-
T Consensus         3 ~k~~~CPvC~~~F~~~~v   20 (214)
T PF09986_consen    3 DKKITCPVCGKEFKTKKV   20 (214)
T ss_pred             CCceECCCCCCeeeeeEE
Confidence            356788888888876643


No 105
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=79.45  E-value=0.94  Score=26.27  Aligned_cols=25  Identities=20%  Similarity=0.506  Sum_probs=11.0

Q ss_pred             HHHHHHHHhcCCCCCeeccc----ccccc
Q psy2288         190 IIMKEHLNRHKGVQPYSCSH----CDKTF  214 (247)
Q Consensus       190 ~~l~~H~~~h~~~~~~~C~~----C~~~f  214 (247)
                      ..|..|+...=...+..|++    |+..+
T Consensus        24 ~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen   24 KELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             CCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             HHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            34555555443444555555    55554


No 106
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=79.24  E-value=2.2  Score=23.00  Aligned_cols=25  Identities=20%  Similarity=0.372  Sum_probs=13.3

Q ss_pred             CCCeecccccccccCh----HHHHHHHHh
Q psy2288         202 VQPYSCSHCDKTFFDA----QSLNKHKLS  226 (247)
Q Consensus       202 ~~~~~C~~C~~~f~~~----~~l~~H~~~  226 (247)
                      ....+|.+|++.+...    +.|..|++.
T Consensus        14 ~~~a~C~~C~~~~~~~~~~ts~l~~HL~~   42 (45)
T PF02892_consen   14 KKKAKCKYCGKVIKYSSGGTSNLKRHLKK   42 (45)
T ss_dssp             SS-EEETTTTEE-----SSTHHHHHHHHH
T ss_pred             cCeEEeCCCCeEEeeCCCcHHHHHHhhhh
Confidence            4456777777766553    567777743


No 107
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=79.20  E-value=1.1  Score=32.10  Aligned_cols=25  Identities=36%  Similarity=0.818  Sum_probs=19.3

Q ss_pred             CCcccCcCchhcccHHHHHHHHHhcCCCCCeecccccc
Q psy2288         175 KPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDK  212 (247)
Q Consensus       175 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  212 (247)
                      +.|.|++||+.             +.|+.|-+||+||.
T Consensus       133 ~~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            36899999865             34578889999984


No 108
>KOG2186|consensus
Probab=78.44  E-value=2  Score=32.85  Aligned_cols=49  Identities=27%  Similarity=0.552  Sum_probs=36.0

Q ss_pred             eeccccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChhHHHHHHHHhc
Q psy2288          65 FTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRGILSSHLAVHA  116 (247)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~~~  116 (247)
                      |.|..|+....- ..+..|+..-++ .-|.|--|+..|.. ..+..|..--+
T Consensus         4 FtCnvCgEsvKK-p~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~kCIT   52 (276)
T KOG2186|consen    4 FTCNVCGESVKK-PQVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCIT   52 (276)
T ss_pred             Eehhhhhhhccc-cchHHHHHhccC-CeeEEeeccccccc-chhhhhhhhcc
Confidence            789999987654 446668887776 56889999999987 55777765443


No 109
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=78.32  E-value=1.9  Score=21.57  Aligned_cols=10  Identities=10%  Similarity=0.039  Sum_probs=4.2

Q ss_pred             CCCCccccCC
Q psy2288         232 DPISSAKGSK  241 (247)
Q Consensus       232 ~~~c~~c~~~  241 (247)
                      +.+|..||..
T Consensus        17 ~irC~~CG~R   26 (32)
T PF03604_consen   17 PIRCPECGHR   26 (32)
T ss_dssp             TSSBSSSS-S
T ss_pred             cEECCcCCCe
Confidence            3445555443


No 110
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=78.31  E-value=1.2  Score=38.38  Aligned_cols=9  Identities=22%  Similarity=0.907  Sum_probs=5.4

Q ss_pred             ccCCCcccc
Q psy2288         150 ACNVCPFKF  158 (247)
Q Consensus       150 ~C~~C~~~~  158 (247)
                      .|..||...
T Consensus       215 ~C~~Cg~~~  223 (505)
T TIGR00595       215 LCRSCGYIL  223 (505)
T ss_pred             EhhhCcCcc
Confidence            566666553


No 111
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=77.43  E-value=0.85  Score=23.56  Aligned_cols=31  Identities=13%  Similarity=0.375  Sum_probs=16.0

Q ss_pred             eecccccccccChHHHHHHHHhccCCCCCCCccccCCCc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSKLF  243 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~  243 (247)
                      ..|+.||..|.        +...-...+-.|..||+.|+
T Consensus         2 r~C~~Cg~~Yh--------~~~~pP~~~~~Cd~cg~~L~   32 (36)
T PF05191_consen    2 RICPKCGRIYH--------IEFNPPKVEGVCDNCGGELV   32 (36)
T ss_dssp             EEETTTTEEEE--------TTTB--SSTTBCTTTTEBEB
T ss_pred             cCcCCCCCccc--------cccCCCCCCCccCCCCCeeE
Confidence            35666666663        33333445556666666543


No 112
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=76.13  E-value=7.3  Score=27.50  Aligned_cols=35  Identities=17%  Similarity=0.604  Sum_probs=16.9

Q ss_pred             ceeccccccccCChHHHHHHHhhccCCCCeeCCCCCccc
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSF  102 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f  102 (247)
                      .|.||.|+..|.....+.. .  . ....|.|+.||...
T Consensus        99 ~Y~Cp~C~~~y~~~ea~~~-~--d-~~~~f~Cp~Cg~~l  133 (147)
T smart00531       99 YYKCPNCQSKYTFLEANQL-L--D-MDGTFTCPRCGEEL  133 (147)
T ss_pred             EEECcCCCCEeeHHHHHHh-c--C-CCCcEECCCCCCEE
Confidence            4666666666653332211 0  1 12336666666543


No 113
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=75.96  E-value=1.2  Score=25.70  Aligned_cols=38  Identities=24%  Similarity=0.579  Sum_probs=16.7

Q ss_pred             ccCcCchh-cccHHHHHHHHHhcCCCCCeeccccccccc
Q psy2288         178 RCEYCDKT-FTRQIIMKEHLNRHKGVQPYSCSHCDKTFF  215 (247)
Q Consensus       178 ~C~~C~~~-f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  215 (247)
                      +|.+|++. +.....+..-.......+.|-|++|.....
T Consensus         4 kCiiCd~v~~iD~rt~~tKrLrN~PIrtymC~eC~~Rva   42 (68)
T COG4896           4 KCIICDRVDEIDNRTFKTKRLRNKPIRTYMCPECEHRVA   42 (68)
T ss_pred             eEEEecceeeecchhHHHHHhhCCCceeEechhhHhhhc
Confidence            45555443 223333333333333344466666655443


No 114
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=75.37  E-value=0.99  Score=34.53  Aligned_cols=39  Identities=21%  Similarity=0.480  Sum_probs=19.0

Q ss_pred             CCCceeccccccccCChHHHHHHHhh--ccCCCCeeCCCCCc
Q psy2288          61 TLGKFTCTVCKKVFNNIKSLKTHSRI--HTGEKPFRCSVCGK  100 (247)
Q Consensus        61 ~~~~~~C~~C~~~f~~~~~l~~H~~~--~~~~~~~~C~~C~~  100 (247)
                      +-..|+|..|.. |.-..+--.|+..  ......|+|..|++
T Consensus       139 GGrif~CsfC~~-flCEDDQFEHQAsCQvLe~E~~KC~SCNr  179 (314)
T PF06524_consen  139 GGRIFKCSFCDN-FLCEDDQFEHQASCQVLESETFKCQSCNR  179 (314)
T ss_pred             CCeEEEeecCCC-eeeccchhhhhhhhhhhhccccccccccc
Confidence            444677877765 2233333344321  11223466666654


No 115
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=74.57  E-value=1.5  Score=29.69  Aligned_cols=13  Identities=15%  Similarity=0.212  Sum_probs=6.6

Q ss_pred             CCeeccccccccc
Q psy2288         203 QPYSCSHCDKTFF  215 (247)
Q Consensus       203 ~~~~C~~C~~~f~  215 (247)
                      .|..|++||..|.
T Consensus        25 ~p~vcP~cg~~~~   37 (129)
T TIGR02300        25 RPAVSPYTGEQFP   37 (129)
T ss_pred             CCccCCCcCCccC
Confidence            4455555555543


No 116
>KOG2807|consensus
Probab=74.08  E-value=6.2  Score=31.51  Aligned_cols=88  Identities=20%  Similarity=0.430  Sum_probs=55.0

Q ss_pred             CCeeCCCCCcccCChhHHHHHHHHhcCCCCeecCcCcccccChhHHHHHHHHhCCCCcc------------ccCCCcccc
Q psy2288          91 KPFRCSVCGKSFSQRGILSSHLAVHAGVKPHICKQCGHAFTQKSQLRLHEMRHGNIRHF------------ACNVCPFKF  158 (247)
Q Consensus        91 ~~~~C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~------------~C~~C~~~~  158 (247)
                      .-|.|++|+...              -..|..|++|+....+...|.+-..-.-.-++|            .|-.|+-. 
T Consensus       275 ~Gy~CP~Ckakv--------------CsLP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~-  339 (378)
T KOG2807|consen  275 GGYFCPQCKAKV--------------CSLPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGE-  339 (378)
T ss_pred             CceeCCcccCee--------------ecCCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccc-
Confidence            348899987653              245678999998887777766543321111221            15555222 


Q ss_pred             CChHHHHHHHHHhCCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccc
Q psy2288         159 TTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCD  211 (247)
Q Consensus       159 ~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~  211 (247)
                                  ..+.-.|.|+.|...|-..-+...|-..|      -|+.|.
T Consensus       340 ------------~~~~~~y~C~~Ck~~FCldCDv~iHesLh------~CpgCe  374 (378)
T KOG2807|consen  340 ------------LLSSGRYRCESCKNVFCLDCDVFIHESLH------NCPGCE  374 (378)
T ss_pred             ------------cCCCCcEEchhccceeeccchHHHHhhhh------cCCCcC
Confidence                        12344589999999888888877885554      577776


No 117
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=73.77  E-value=3  Score=23.25  Aligned_cols=22  Identities=23%  Similarity=0.472  Sum_probs=13.4

Q ss_pred             CeecccccccccCh-----HHHHHHHH
Q psy2288         204 PYSCSHCDKTFFDA-----QSLNKHKL  225 (247)
Q Consensus       204 ~~~C~~C~~~f~~~-----~~l~~H~~  225 (247)
                      ...|..|++.++..     +.|.+|+.
T Consensus        18 ~a~C~~C~~~l~~~~~~gTs~L~rHl~   44 (50)
T smart00614       18 RAKCKYCGKKLSRSSKGGTSNLRRHLR   44 (50)
T ss_pred             EEEecCCCCEeeeCCCCCcHHHHHHHH
Confidence            35666666665443     46777766


No 118
>PF12907 zf-met2:  Zinc-binding
Probab=71.06  E-value=2.8  Score=22.20  Aligned_cols=27  Identities=22%  Similarity=0.540  Sum_probs=13.7

Q ss_pred             eeccccccccc---ChHHHHHHHHhccCCC
Q psy2288         205 YSCSHCDKTFF---DAQSLNKHKLSHKTSA  231 (247)
Q Consensus       205 ~~C~~C~~~f~---~~~~l~~H~~~h~~~~  231 (247)
                      ++|.+|-..|.   +...|..|..+.|...
T Consensus         2 i~C~iC~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKICRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHHhhHHHHhcCCHHHHHHHHHccCCCC
Confidence            45666664333   3344666665544443


No 119
>PRK14873 primosome assembly protein PriA; Provisional
Probab=68.47  E-value=2.7  Score=37.61  Aligned_cols=11  Identities=18%  Similarity=0.525  Sum_probs=6.4

Q ss_pred             CCCeecccccc
Q psy2288         202 VQPYSCSHCDK  212 (247)
Q Consensus       202 ~~~~~C~~C~~  212 (247)
                      .+...|.+||.
T Consensus       408 ~~~l~Ch~CG~  418 (665)
T PRK14873        408 GGTPRCRWCGR  418 (665)
T ss_pred             CCeeECCCCcC
Confidence            34566666664


No 120
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=67.49  E-value=2.5  Score=19.62  Aligned_cols=8  Identities=38%  Similarity=1.572  Sum_probs=4.5

Q ss_pred             Ceeccccc
Q psy2288         204 PYSCSHCD  211 (247)
Q Consensus       204 ~~~C~~C~  211 (247)
                      +|.||.||
T Consensus        16 ~f~CPnCG   23 (24)
T PF07754_consen   16 PFPCPNCG   23 (24)
T ss_pred             eEeCCCCC
Confidence            35555555


No 121
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=67.16  E-value=1.1  Score=27.30  Aligned_cols=19  Identities=26%  Similarity=0.579  Sum_probs=11.2

Q ss_pred             CCCeecc--cccccccChHHH
Q psy2288         202 VQPYSCS--HCDKTFFDAQSL  220 (247)
Q Consensus       202 ~~~~~C~--~C~~~f~~~~~l  220 (247)
                      +.-++|.  +||..|.....+
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es~   45 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYESV   45 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEEE
Confidence            3446776  677777655443


No 122
>KOG2593|consensus
Probab=66.90  E-value=7.7  Score=32.31  Aligned_cols=37  Identities=19%  Similarity=0.434  Sum_probs=22.1

Q ss_pred             cCCceecccccccccCHHHHHHHHHHhCCCCceecccccc
Q psy2288          33 QQKSLACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKK   72 (247)
Q Consensus        33 ~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~   72 (247)
                      ....|.|+.|.+.|++...++.   .-.....|.|..|+-
T Consensus       125 ~~~~Y~Cp~C~kkyt~Lea~~L---~~~~~~~F~C~~C~g  161 (436)
T KOG2593|consen  125 NVAGYVCPNCQKKYTSLEALQL---LDNETGEFHCENCGG  161 (436)
T ss_pred             ccccccCCccccchhhhHHHHh---hcccCceEEEecCCC
Confidence            3455777777777766555542   222334677777754


No 123
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=66.09  E-value=7.9  Score=36.94  Aligned_cols=11  Identities=27%  Similarity=0.863  Sum_probs=6.7

Q ss_pred             Ceecccccccc
Q psy2288         204 PYSCSHCDKTF  214 (247)
Q Consensus       204 ~~~C~~C~~~f  214 (247)
                      +|.|+.||...
T Consensus       692 vy~CPsCGaev  702 (1337)
T PRK14714        692 VYVCPDCGAEV  702 (1337)
T ss_pred             ceeCccCCCcc
Confidence            46666666654


No 124
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=65.85  E-value=3.9  Score=28.27  Aligned_cols=23  Identities=30%  Similarity=0.602  Sum_probs=12.3

Q ss_pred             eecccccccccChHHHHHHHHhccCC
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHKTS  230 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (247)
                      ..|-+||+.|.   .|.+|+++|++-
T Consensus        73 i~clecGk~~k---~LkrHL~~~~gl   95 (132)
T PF05443_consen   73 IICLECGKKFK---TLKRHLRTHHGL   95 (132)
T ss_dssp             EE-TBT--EES---BHHHHHHHTT-S
T ss_pred             eEEccCCcccc---hHHHHHHHccCC
Confidence            67777777665   346777777554


No 125
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=65.53  E-value=1.5  Score=39.37  Aligned_cols=10  Identities=20%  Similarity=0.677  Sum_probs=6.4

Q ss_pred             cccCCCcccc
Q psy2288         149 FACNVCPFKF  158 (247)
Q Consensus       149 ~~C~~C~~~~  158 (247)
                      ..|..||+.+
T Consensus       436 l~C~~Cg~v~  445 (730)
T COG1198         436 LLCRDCGYIA  445 (730)
T ss_pred             eecccCCCcc
Confidence            3477777664


No 126
>PF14353 CpXC:  CpXC protein
Probab=64.03  E-value=6.9  Score=26.82  Aligned_cols=10  Identities=30%  Similarity=0.723  Sum_probs=5.2

Q ss_pred             eccccccccc
Q psy2288          38 ACNICSMVFC   47 (247)
Q Consensus        38 ~C~~C~~~~~   47 (247)
                      .||.|+..|.
T Consensus         3 tCP~C~~~~~   12 (128)
T PF14353_consen    3 TCPHCGHEFE   12 (128)
T ss_pred             CCCCCCCeeE
Confidence            4555555443


No 127
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.29  E-value=10  Score=35.29  Aligned_cols=9  Identities=22%  Similarity=0.512  Sum_probs=5.0

Q ss_pred             cccCCCccc
Q psy2288         149 FACNVCPFK  157 (247)
Q Consensus       149 ~~C~~C~~~  157 (247)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            456666654


No 128
>PRK04023 DNA polymerase II large subunit; Validated
Probab=63.07  E-value=8.5  Score=35.81  Aligned_cols=9  Identities=33%  Similarity=1.047  Sum_probs=6.1

Q ss_pred             eecCcCccc
Q psy2288         121 HICKQCGHA  129 (247)
Q Consensus       121 ~~C~~C~~~  129 (247)
                      ..|+.||..
T Consensus       627 RfCpsCG~~  635 (1121)
T PRK04023        627 RKCPSCGKE  635 (1121)
T ss_pred             ccCCCCCCc
Confidence            467777766


No 129
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=63.06  E-value=10  Score=20.16  Aligned_cols=25  Identities=20%  Similarity=0.428  Sum_probs=17.8

Q ss_pred             ceecccccccccC--HHHHHHHHHHhC
Q psy2288          36 SLACNICSMVFCD--EIVLNKHVEEHS   60 (247)
Q Consensus        36 ~~~C~~C~~~~~~--~~~l~~H~~~~~   60 (247)
                      ...|+.|+..|..  ..+-..|.+-|.
T Consensus        13 ~~~C~~CgM~Y~~~~~eD~~~H~~yH~   39 (41)
T PF13878_consen   13 ATTCPTCGMLYSPGSPEDEKLHKKYHD   39 (41)
T ss_pred             CcCCCCCCCEECCCCHHHHHHHHHHHh
Confidence            3679999988764  466777776653


No 130
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=62.72  E-value=6.1  Score=21.26  Aligned_cols=23  Identities=26%  Similarity=0.483  Sum_probs=17.7

Q ss_pred             ceeccccccccCChHHHHHHHhh
Q psy2288          64 KFTCTVCKKVFNNIKSLKTHSRI   86 (247)
Q Consensus        64 ~~~C~~C~~~f~~~~~l~~H~~~   86 (247)
                      .|+|-.|..+...++.|-.||+.
T Consensus        20 ~ykcfqcpftc~~kshl~nhmky   42 (54)
T PF15269_consen   20 KYKCFQCPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             cceeecCCcccchHHHHHHHHHH
Confidence            37788888888888888888764


No 131
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=60.83  E-value=3.5  Score=18.83  Aligned_cols=6  Identities=33%  Similarity=1.376  Sum_probs=2.7

Q ss_pred             cccccc
Q psy2288         207 CSHCDK  212 (247)
Q Consensus       207 C~~C~~  212 (247)
                      |+.||.
T Consensus        16 C~~CG~   21 (23)
T PF13240_consen   16 CPNCGT   21 (23)
T ss_pred             hhhhCC
Confidence            444443


No 132
>PF05290 Baculo_IE-1:  Baculovirus immediate-early protein (IE-0);  InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0.
Probab=60.79  E-value=11  Score=25.99  Aligned_cols=57  Identities=26%  Similarity=0.568  Sum_probs=33.2

Q ss_pred             hcCCceecccccccccCHHHHHHHHHHhCCCCceec---cccccccCChHHHHHHHhhccCCCCeeCCCCCcccCChh
Q psy2288          32 AQQKSLACNICSMVFCDEIVLNKHVEEHSTLGKFTC---TVCKKVFNNIKSLKTHSRIHTGEKPFRCSVCGKSFSQRG  106 (247)
Q Consensus        32 ~~~~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C---~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~  106 (247)
                      .+.+.|+|.+|..+..+...|.          |-.|   .+|+.-+   ..|+.|-..+     -.||.|..+|.+..
T Consensus        76 ~d~~lYeCnIC~etS~ee~FLK----------PneCCgY~iCn~Cy---a~LWK~~~~y-----pvCPvCkTSFKss~  135 (140)
T PF05290_consen   76 LDPKLYECNICKETSAEERFLK----------PNECCGYSICNACY---ANLWKFCNLY-----PVCPVCKTSFKSSS  135 (140)
T ss_pred             cCCCceeccCcccccchhhcCC----------cccccchHHHHHHH---HHHHHHcccC-----CCCCcccccccccc
Confidence            3457799999998876554332          3333   2233322   4456665433     34888888877654


No 133
>KOG2071|consensus
Probab=60.48  E-value=7.4  Score=33.79  Aligned_cols=42  Identities=24%  Similarity=0.545  Sum_probs=0.0

Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhc-----------------------------------------------------
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRH-----------------------------------------------------  199 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h-----------------------------------------------------  199 (247)
                      ...+-+|..||..|........||..|                                                     
T Consensus       415 ~~~pnqC~~CG~R~~~~ee~sk~md~H~dwh~r~n~~~r~s~~~~~sR~Wf~s~s~W~~~K~~e~t~e~~~~~~~~~~~~  494 (579)
T KOG2071|consen  415 KDSPNQCKSCGLRFDDSEERSKHMDIHDDWHRRKNTTIRGSSKWQKSRSWFPSKSGWLAAKAGEETDEKEKVEHEELQIK  494 (579)
T ss_pred             cCCcchhcccccccccchhhhhHhhhhhhhhhhhhhhcccccccccccceeechhhhccccccccccccccccchhhcch


Q ss_pred             --------------CCCCCeecccccccc
Q psy2288         200 --------------KGVQPYSCSHCDKTF  214 (247)
Q Consensus       200 --------------~~~~~~~C~~C~~~f  214 (247)
                                    .++.+..|++|+..|
T Consensus       495 ~~~s~~~k~~~Vp~d~e~~~~C~IC~EkF  523 (579)
T KOG2071|consen  495 KELSLRSKYELVPADSERQASCPICQEKF  523 (579)
T ss_pred             hhhhhhccceecccCcccccCCccccccc


No 134
>KOG4167|consensus
Probab=60.28  E-value=2.4  Score=37.50  Aligned_cols=27  Identities=33%  Similarity=0.752  Sum_probs=24.1

Q ss_pred             CeecccccccccChHHHHHHHHhccCC
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHKTS  230 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (247)
                      .|.|.+|++.|-...++..||++|..+
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~q  818 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQQ  818 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHHH
Confidence            599999999999999999999999543


No 135
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=60.18  E-value=4.5  Score=25.46  Aligned_cols=11  Identities=27%  Similarity=1.059  Sum_probs=5.3

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      +.|..|+..|.
T Consensus        54 W~C~kCg~~fA   64 (89)
T COG1997          54 WKCRKCGAKFA   64 (89)
T ss_pred             EEcCCCCCeec
Confidence            44555554443


No 136
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=59.19  E-value=8.8  Score=20.91  Aligned_cols=8  Identities=38%  Similarity=1.128  Sum_probs=3.6

Q ss_pred             eecccccc
Q psy2288          65 FTCTVCKK   72 (247)
Q Consensus        65 ~~C~~C~~   72 (247)
                      +.||.|+.
T Consensus        19 ~~CP~Cg~   26 (46)
T PF12760_consen   19 FVCPHCGS   26 (46)
T ss_pred             CCCCCCCC
Confidence            34444443


No 137
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=58.19  E-value=4.3  Score=28.61  Aligned_cols=33  Identities=18%  Similarity=0.297  Sum_probs=23.5

Q ss_pred             CeecccccccccChHHHHHHHHhccCCCCCCCccccCCCcCCC
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSKLFGGI  246 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~  246 (247)
                      .|.|..||....    |      .+.+..+.|+.|++.-|.+.
T Consensus       112 ~l~C~~Cg~~~~----~------~~~~~l~~Cp~C~~~~F~R~  144 (146)
T PF07295_consen  112 TLVCENCGHEVE----L------THPERLPPCPKCGHTEFTRQ  144 (146)
T ss_pred             eEecccCCCEEE----e------cCCCcCCCCCCCCCCeeeeC
Confidence            488998988542    1      23467888999988888753


No 138
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=54.13  E-value=5.4  Score=21.12  Aligned_cols=21  Identities=38%  Similarity=0.719  Sum_probs=13.1

Q ss_pred             CCCeecccccccccChHHHHH
Q psy2288         202 VQPYSCSHCDKTFFDAQSLNK  222 (247)
Q Consensus       202 ~~~~~C~~C~~~f~~~~~l~~  222 (247)
                      .....|+.|+-.+.....|.+
T Consensus        17 ~~id~C~~C~G~W~d~~el~~   37 (41)
T PF13453_consen   17 VEIDVCPSCGGIWFDAGELEK   37 (41)
T ss_pred             EEEEECCCCCeEEccHHHHHH
Confidence            344667777777666666643


No 139
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=53.58  E-value=8.5  Score=26.41  Aligned_cols=14  Identities=43%  Similarity=1.196  Sum_probs=7.3

Q ss_pred             CeecCcCcccccCh
Q psy2288         120 PHICKQCGHAFTQK  133 (247)
Q Consensus       120 ~~~C~~C~~~f~~~  133 (247)
                      |++|..||+.|.+.
T Consensus         1 PH~Ct~Cg~~f~dg   14 (131)
T PF09845_consen    1 PHQCTKCGRVFEDG   14 (131)
T ss_pred             CcccCcCCCCcCCC
Confidence            34555555555543


No 140
>PRK05580 primosome assembly protein PriA; Validated
Probab=53.40  E-value=7.1  Score=35.25  Aligned_cols=8  Identities=25%  Similarity=0.812  Sum_probs=3.7

Q ss_pred             ccCCCccc
Q psy2288         150 ACNVCPFK  157 (247)
Q Consensus       150 ~C~~C~~~  157 (247)
                      .|..||..
T Consensus       383 ~C~~Cg~~  390 (679)
T PRK05580        383 LCRDCGWV  390 (679)
T ss_pred             EhhhCcCc
Confidence            35555443


No 141
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=52.81  E-value=8.3  Score=24.46  Aligned_cols=12  Identities=50%  Similarity=1.259  Sum_probs=5.7

Q ss_pred             CeecCcCccccc
Q psy2288         120 PHICKQCGHAFT  131 (247)
Q Consensus       120 ~~~C~~C~~~f~  131 (247)
                      |-.|..||..|.
T Consensus        58 Pa~CkkCGfef~   69 (97)
T COG3357          58 PARCKKCGFEFR   69 (97)
T ss_pred             ChhhcccCcccc
Confidence            334555555544


No 142
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=51.34  E-value=6.4  Score=25.86  Aligned_cols=12  Identities=17%  Similarity=0.404  Sum_probs=6.1

Q ss_pred             CCeecccccccc
Q psy2288         203 QPYSCSHCDKTF  214 (247)
Q Consensus       203 ~~~~C~~C~~~f  214 (247)
                      .|..||+||++|
T Consensus        25 dPiVsPytG~s~   36 (129)
T COG4530          25 DPIVSPYTGKSY   36 (129)
T ss_pred             CccccCcccccc
Confidence            445555555554


No 143
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=51.08  E-value=7.3  Score=25.64  Aligned_cols=29  Identities=17%  Similarity=0.455  Sum_probs=17.7

Q ss_pred             ccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccCh
Q psy2288         178 RCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDA  217 (247)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  217 (247)
                      .||.|+..|.+..           ...|.||+|+..+...
T Consensus         4 ~CP~C~seytY~d-----------g~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         4 PCPKCNSEYTYHD-----------GTQLICPSCLYEWNEN   32 (109)
T ss_pred             cCCcCCCcceEec-----------CCeeECcccccccccc
Confidence            4677766666542           2347777777766544


No 144
>KOG3408|consensus
Probab=50.94  E-value=10  Score=25.48  Aligned_cols=28  Identities=21%  Similarity=0.409  Sum_probs=23.2

Q ss_pred             hcCCceecccccccccCHHHHHHHHHHh
Q psy2288          32 AQQKSLACNICSMVFCDEIVLNKHVEEH   59 (247)
Q Consensus        32 ~~~~~~~C~~C~~~~~~~~~l~~H~~~~   59 (247)
                      +|...+-|-+|.+.|.+...|..|.++.
T Consensus        53 PG~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   53 PGGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCCceeehhhhhhhhcchHHHHHHHhcc
Confidence            4556688999999999999999998763


No 145
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=50.32  E-value=3.2  Score=22.26  Aligned_cols=29  Identities=14%  Similarity=0.402  Sum_probs=15.1

Q ss_pred             cccCcCchhcccHHHHHHHHHhcCCCCCeecccccccc
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTF  214 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  214 (247)
                      |.||.|+....         -.-.....+.|+.||...
T Consensus         1 m~Cp~Cg~~~~---------~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    1 MKCPNCGSKEI---------VFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             ESBTTTSSSEE---------EEETTTTEEEETTT-BBE
T ss_pred             CCCcCCcCCce---------EEcCCCCeEECCCCCCEe
Confidence            46777776532         011223447888887654


No 146
>PF12773 DZR:  Double zinc ribbon
Probab=49.43  E-value=10  Score=20.91  Aligned_cols=8  Identities=25%  Similarity=0.850  Sum_probs=3.9

Q ss_pred             eecccccc
Q psy2288         205 YSCSHCDK  212 (247)
Q Consensus       205 ~~C~~C~~  212 (247)
                      ..|+.|+.
T Consensus        30 ~~C~~Cg~   37 (50)
T PF12773_consen   30 KICPNCGA   37 (50)
T ss_pred             CCCcCCcC
Confidence            44555554


No 147
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=48.54  E-value=13  Score=28.11  Aligned_cols=30  Identities=13%  Similarity=0.291  Sum_probs=21.0

Q ss_pred             CCCccccCCCccccCChHHHHHHHHHhCCC
Q psy2288         145 NIRHFACNVCPFKFTTKSDLQRHQRSHEGV  174 (247)
Q Consensus       145 ~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~  174 (247)
                      .+..|.|+.|++.|........|+...|.+
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~nKH~e  103 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFNKHPE  103 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHHH-HH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhhcCHH
Confidence            344588999999998888888888776654


No 148
>KOG4167|consensus
Probab=47.73  E-value=5.5  Score=35.45  Aligned_cols=27  Identities=44%  Similarity=0.775  Sum_probs=23.2

Q ss_pred             CceeccccccccCChHHHHHHHhhccC
Q psy2288          63 GKFTCTVCKKVFNNIKSLKTHSRIHTG   89 (247)
Q Consensus        63 ~~~~C~~C~~~f~~~~~l~~H~~~~~~   89 (247)
                      ..|.|..|+++|....++..||++|..
T Consensus       791 giFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            358999999999999999999998853


No 149
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=47.71  E-value=8.8  Score=26.69  Aligned_cols=11  Identities=18%  Similarity=0.987  Sum_probs=5.4

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      +.|+.||..|.
T Consensus        71 ~~C~~CG~~~~   81 (135)
T PRK03824         71 LKCRNCGNEWS   81 (135)
T ss_pred             EECCCCCCEEe
Confidence            45555554443


No 150
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=46.74  E-value=5.8  Score=27.35  Aligned_cols=15  Identities=33%  Similarity=0.864  Sum_probs=8.6

Q ss_pred             CCCcccCcCchhccc
Q psy2288         174 VKPFRCEYCDKTFTR  188 (247)
Q Consensus       174 ~~~~~C~~C~~~f~~  188 (247)
                      ...|.|+.|++.|..
T Consensus        51 ~qRyrC~~C~~tf~~   65 (129)
T COG3677          51 HQRYKCKSCGSTFTV   65 (129)
T ss_pred             ccccccCCcCcceee
Confidence            344666666666653


No 151
>KOG1280|consensus
Probab=46.53  E-value=20  Score=28.98  Aligned_cols=37  Identities=22%  Similarity=0.524  Sum_probs=24.4

Q ss_pred             CceecccccccccCHHHHHHHHHHhCCCCc--eeccccc
Q psy2288          35 KSLACNICSMVFCDEIVLNKHVEEHSTLGK--FTCTVCK   71 (247)
Q Consensus        35 ~~~~C~~C~~~~~~~~~l~~H~~~~~~~~~--~~C~~C~   71 (247)
                      ..|.|++|+.+-.+...|..|+...|.+-.  ..|++|.
T Consensus        78 qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   78 QSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             ccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            367788888877777888888776554422  3455554


No 152
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.48  E-value=17  Score=27.50  Aligned_cols=26  Identities=19%  Similarity=0.483  Sum_probs=13.3

Q ss_pred             ceecccccccccCHHHHHHHHHHhCC
Q psy2288          36 SLACNICSMVFCDEIVLNKHVEEHST   61 (247)
Q Consensus        36 ~~~C~~C~~~~~~~~~l~~H~~~~~~   61 (247)
                      .|.|++|++.|........|+...|.
T Consensus        77 K~~C~lc~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   77 KWRCPLCGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             EEEE-SSS-EESSHHHHHHHHHHH-H
T ss_pred             EECCCCCCcccCChHHHHHHHhhcCH
Confidence            35566666666666666666555443


No 153
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=46.43  E-value=8.9  Score=21.57  Aligned_cols=20  Identities=25%  Similarity=0.534  Sum_probs=7.4

Q ss_pred             CcccCcCchhcccHHHHHHH
Q psy2288         176 PFRCEYCDKTFTRQIIMKEH  195 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H  195 (247)
                      .|+|+.|...|=-.-++..|
T Consensus        21 ~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen   21 RYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             EE--TTTT--B-HHHHHTTT
T ss_pred             eEECCCCCCccccCcChhhh
Confidence            35555555555544444444


No 154
>PRK10220 hypothetical protein; Provisional
Probab=46.30  E-value=11  Score=24.86  Aligned_cols=29  Identities=28%  Similarity=0.677  Sum_probs=17.4

Q ss_pred             ccCcCchhcccHHHHHHHHHhcCCCCCeecccccccccCh
Q psy2288         178 RCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFFDA  217 (247)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  217 (247)
                      .||.|+..|.+..           ...|.|++|+..++..
T Consensus         5 ~CP~C~seytY~d-----------~~~~vCpeC~hEW~~~   33 (111)
T PRK10220          5 HCPKCNSEYTYED-----------NGMYICPECAHEWNDA   33 (111)
T ss_pred             cCCCCCCcceEcC-----------CCeEECCcccCcCCcc
Confidence            4666766665542           2347777777766544


No 155
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=46.04  E-value=11  Score=29.86  Aligned_cols=78  Identities=19%  Similarity=0.449  Sum_probs=40.5

Q ss_pred             CccccCCCccccCChHHHHHHHHH------------hCCCCCcccCcCchhcccHHHHHHHH-HhcCCCCCeeccccccc
Q psy2288         147 RHFACNVCPFKFTTKSDLQRHQRS------------HEGVKPFRCEYCDKTFTRQIIMKEHL-NRHKGVQPYSCSHCDKT  213 (247)
Q Consensus       147 ~~~~C~~C~~~~~~~~~l~~H~~~------------h~~~~~~~C~~C~~~f~~~~~l~~H~-~~h~~~~~~~C~~C~~~  213 (247)
                      -|..||.|.-.+.....|.+-..-            -...+.-.|-.|...|.-...   |- ..-+....|+|+.|...
T Consensus       321 LPi~CP~Csl~LilsthLarSyhhL~PLk~f~E~p~~~~~ks~~Cf~CQ~~fp~~~~---~~~~~~~ss~rY~Ce~CK~~  397 (421)
T COG5151         321 LPISCPICSLQLILSTHLARSYHHLYPLKPFVEKPEGTNPKSTHCFVCQGPFPKPPV---SPFDESTSSGRYQCELCKST  397 (421)
T ss_pred             CCccCcchhHHHHHHHHHHHHHHhhccCcccccccCCCCCCCccceeccCCCCCCCC---Ccccccccccceechhhhhh
Confidence            355677776665544444332211            011122346677666653321   10 00122345888888888


Q ss_pred             ccChHHHHHHHHhc
Q psy2288         214 FFDAQSLNKHKLSH  227 (247)
Q Consensus       214 f~~~~~l~~H~~~h  227 (247)
                      |-.--+.-.|-..|
T Consensus       398 FC~dCdvfiHe~Lh  411 (421)
T COG5151         398 FCSDCDVFIHETLH  411 (421)
T ss_pred             hhhhhHHHHHHHHh
Confidence            87777777776555


No 156
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=45.14  E-value=11  Score=21.66  Aligned_cols=14  Identities=21%  Similarity=0.847  Sum_probs=7.5

Q ss_pred             CCCCeecccccccc
Q psy2288         201 GVQPYSCSHCDKTF  214 (247)
Q Consensus       201 ~~~~~~C~~C~~~f  214 (247)
                      ....|-|..|....
T Consensus        28 Pi~tYmC~eC~~RI   41 (56)
T PF09963_consen   28 PIHTYMCDECKERI   41 (56)
T ss_pred             CCcceeChhHHHHH
Confidence            34446666665543


No 157
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=45.09  E-value=11  Score=17.70  Aligned_cols=7  Identities=29%  Similarity=0.652  Sum_probs=3.6

Q ss_pred             ccCCCcc
Q psy2288         150 ACNVCPF  156 (247)
Q Consensus       150 ~C~~C~~  156 (247)
                      .|+.||.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            4555554


No 158
>KOG3408|consensus
Probab=44.90  E-value=15  Score=24.71  Aligned_cols=27  Identities=26%  Similarity=0.536  Sum_probs=22.2

Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhc
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRH  199 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h  199 (247)
                      |.-.|.|-.|.+-|.+...|..|.++.
T Consensus        54 G~GqfyCi~CaRyFi~~~~l~~H~ktK   80 (129)
T KOG3408|consen   54 GGGQFYCIECARYFIDAKALKTHFKTK   80 (129)
T ss_pred             CCceeehhhhhhhhcchHHHHHHHhcc
Confidence            344578999999999999999998763


No 159
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=44.08  E-value=11  Score=22.54  Aligned_cols=9  Identities=44%  Similarity=1.069  Sum_probs=2.5

Q ss_pred             ccCCCcccc
Q psy2288         150 ACNVCPFKF  158 (247)
Q Consensus       150 ~C~~C~~~~  158 (247)
                      .|..|++.|
T Consensus        11 ~C~~C~~~F   19 (69)
T PF01363_consen   11 NCMICGKKF   19 (69)
T ss_dssp             B-TTT--B-
T ss_pred             cCcCcCCcC
Confidence            345555555


No 160
>KOG1701|consensus
Probab=44.03  E-value=6.6  Score=32.61  Aligned_cols=42  Identities=17%  Similarity=0.325  Sum_probs=20.7

Q ss_pred             ecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHH
Q psy2288         122 ICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSD  163 (247)
Q Consensus       122 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~  163 (247)
                      .|..|++...-...-..=+...-...-|.|..|++.+.-.+.
T Consensus       276 iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~F  317 (468)
T KOG1701|consen  276 ICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSF  317 (468)
T ss_pred             hhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccc
Confidence            466666665544333333332222344666667666554433


No 161
>KOG1280|consensus
Probab=43.60  E-value=24  Score=28.59  Aligned_cols=40  Identities=18%  Similarity=0.384  Sum_probs=27.1

Q ss_pred             CCCCcccCcCchhcccHHHHHHHHHhcCCCCC--eecccccc
Q psy2288         173 GVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQP--YSCSHCDK  212 (247)
Q Consensus       173 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~--~~C~~C~~  212 (247)
                      ....|.|+.|+..=.+...|..|....+.+-+  -.|++|+-
T Consensus        76 ~~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~~  117 (381)
T KOG1280|consen   76 DPQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCAA  117 (381)
T ss_pred             ccccccCCcccccccchhHHHHHhhhcCcccCcceeeecccc
Confidence            34468888888877778888888876554432  45566654


No 162
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=42.15  E-value=18  Score=24.94  Aligned_cols=23  Identities=30%  Similarity=0.374  Sum_probs=12.1

Q ss_pred             eecccccccccChHHHHHHHHhccCC
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSHKTS  230 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h~~~  230 (247)
                      ..|-++|+.|-   +|.+|+.+|++-
T Consensus        77 IicLEDGkkfK---SLKRHL~t~~gm   99 (148)
T COG4957          77 IICLEDGKKFK---SLKRHLTTHYGL   99 (148)
T ss_pred             EEEeccCcchH---HHHHHHhcccCC
Confidence            45555555552   455555555543


No 163
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=41.98  E-value=13  Score=19.47  Aligned_cols=12  Identities=33%  Similarity=1.060  Sum_probs=10.2

Q ss_pred             Ceeccccccccc
Q psy2288         204 PYSCSHCDKTFF  215 (247)
Q Consensus       204 ~~~C~~C~~~f~  215 (247)
                      ||+|..|+..|=
T Consensus        12 ~f~C~~C~~~FC   23 (39)
T smart00154       12 GFKCRHCGNLFC   23 (39)
T ss_pred             CeECCccCCccc
Confidence            789999998884


No 164
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=41.73  E-value=21  Score=19.91  Aligned_cols=38  Identities=24%  Similarity=0.400  Sum_probs=18.4

Q ss_pred             CCceecccccccccCHHHHHHHHHHhCC-CCceeccccc
Q psy2288          34 QKSLACNICSMVFCDEIVLNKHVEEHST-LGKFTCTVCK   71 (247)
Q Consensus        34 ~~~~~C~~C~~~~~~~~~l~~H~~~~~~-~~~~~C~~C~   71 (247)
                      .+.+.|..||..|.--..=+.......- ..|-.|+.|-
T Consensus         2 Dk~l~C~dCg~~FvfTa~EQ~fy~eKgf~n~p~RC~~CR   40 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVFTAGEQKFYAEKGFDNEPKRCPSCR   40 (49)
T ss_pred             CeeEEcccCCCeEEEehhHHHHHHhcCCcCCCccCHHHH
Confidence            3566777777765443333333222211 1355566664


No 165
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=39.43  E-value=9.3  Score=24.36  Aligned_cols=9  Identities=22%  Similarity=0.855  Sum_probs=4.1

Q ss_pred             cccCCCccc
Q psy2288         149 FACNVCPFK  157 (247)
Q Consensus       149 ~~C~~C~~~  157 (247)
                      |.|+.|++.
T Consensus        36 y~Cp~Cgk~   44 (90)
T PF01780_consen   36 YTCPFCGKT   44 (90)
T ss_dssp             BEESSSSSS
T ss_pred             CcCCCCCCc
Confidence            444444433


No 166
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=39.43  E-value=35  Score=24.97  Aligned_cols=33  Identities=15%  Similarity=0.532  Sum_probs=16.6

Q ss_pred             CCCCCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccccc
Q psy2288         172 EGVKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKT  213 (247)
Q Consensus       172 ~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  213 (247)
                      ..+.-|.|+.|...++...++.         ..|.||.||..
T Consensus       109 ~~~~~y~C~~~~~r~sfdeA~~---------~~F~Cp~Cg~~  141 (176)
T COG1675         109 TENNYYVCPNCHVKYSFDEAME---------LGFTCPKCGED  141 (176)
T ss_pred             ccCCceeCCCCCCcccHHHHHH---------hCCCCCCCCch
Confidence            3444466666655555444332         12666666653


No 167
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=38.82  E-value=12  Score=21.36  Aligned_cols=9  Identities=56%  Similarity=1.257  Sum_probs=4.4

Q ss_pred             ecccccccc
Q psy2288          66 TCTVCKKVF   74 (247)
Q Consensus        66 ~C~~C~~~f   74 (247)
                      .|+.|++.|
T Consensus         7 ~C~~Cg~~~   15 (54)
T PF14446_consen    7 KCPVCGKKF   15 (54)
T ss_pred             cChhhCCcc
Confidence            345555544


No 168
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=38.29  E-value=14  Score=20.64  Aligned_cols=10  Identities=30%  Similarity=0.916  Sum_probs=5.3

Q ss_pred             Ceeccccccc
Q psy2288         204 PYSCSHCDKT  213 (247)
Q Consensus       204 ~~~C~~C~~~  213 (247)
                      .+.|..||..
T Consensus        37 r~~C~~Cgyt   46 (50)
T PRK00432         37 RWHCGKCGYT   46 (50)
T ss_pred             cEECCCcCCE
Confidence            4555555554


No 169
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=37.96  E-value=19  Score=24.27  Aligned_cols=11  Identities=27%  Similarity=0.806  Sum_probs=5.4

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (115)
T TIGR00100        71 CECEDCSEEVS   81 (115)
T ss_pred             EEcccCCCEEe
Confidence            44555554444


No 170
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=37.51  E-value=21  Score=23.89  Aligned_cols=11  Identities=18%  Similarity=0.426  Sum_probs=5.6

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      ..|..|+..|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PRK12380         71 AWCWDCSQVVE   81 (113)
T ss_pred             EEcccCCCEEe
Confidence            45555554444


No 171
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=37.35  E-value=19  Score=27.64  Aligned_cols=58  Identities=17%  Similarity=0.433  Sum_probs=27.3

Q ss_pred             CCeecCcCcccccChhHHHHHHHHhCCCCccccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccH
Q psy2288         119 KPHICKQCGHAFTQKSQLRLHEMRHGNIRHFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQ  189 (247)
Q Consensus       119 ~~~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  189 (247)
                      ..|.|..|......        +.......-.|..|.+.|.-...     ..--|-.-|.|+.|+..|...
T Consensus       111 rqFaC~~Cd~~WwR--------rvp~rKeVSRCr~C~~rYDPVP~-----dkmwG~aef~C~~C~h~F~G~  168 (278)
T PF15135_consen  111 RQFACSSCDHMWWR--------RVPQRKEVSRCRKCRKRYDPVPC-----DKMWGIAEFHCPKCRHNFRGF  168 (278)
T ss_pred             eeeeccccchHHHh--------ccCcccccccccccccccCCCcc-----ccccceeeeecccccccchhh
Confidence            45667776544321        11222233456666666532210     000122336777777777644


No 172
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=36.88  E-value=5.3  Score=20.61  Aligned_cols=11  Identities=45%  Similarity=1.138  Sum_probs=4.7

Q ss_pred             CCCCCeecccc
Q psy2288         200 KGVQPYSCSHC  210 (247)
Q Consensus       200 ~~~~~~~C~~C  210 (247)
                      .|...|.|..|
T Consensus        25 ~G~qryrC~~C   35 (36)
T PF03811_consen   25 SGHQRYRCKDC   35 (36)
T ss_pred             CCCEeEecCcC
Confidence            33344444444


No 173
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=36.46  E-value=1.6e+02  Score=21.14  Aligned_cols=49  Identities=16%  Similarity=0.313  Sum_probs=23.1

Q ss_pred             ccccCCCccccCChHHHHHHHHHhCCCCCcccCc--CchhcccHHHHHHHHHh
Q psy2288         148 HFACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEY--CDKTFTRQIIMKEHLNR  198 (247)
Q Consensus       148 ~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~--C~~~f~~~~~l~~H~~~  198 (247)
                      ...||.|.-......-.. -.+.+...|+-.|..  |... .+...|++|.+.
T Consensus        80 ~L~CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~  130 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCSFS-GTYSELRKHARS  130 (162)
T ss_pred             cccCccccCceeceEEch-HHHHHhccCCccCcccccccc-cCHHHHHHHHHh
Confidence            356777755544332211 133334444445543  4322 244567777665


No 174
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=36.19  E-value=16  Score=24.52  Aligned_cols=11  Identities=27%  Similarity=0.742  Sum_probs=4.6

Q ss_pred             eeccccccccc
Q psy2288         205 YSCSHCDKTFF  215 (247)
Q Consensus       205 ~~C~~C~~~f~  215 (247)
                      +.|..||+.|.
T Consensus        71 ~~C~~Cg~~~~   81 (113)
T PF01155_consen   71 ARCRDCGHEFE   81 (113)
T ss_dssp             EEETTTS-EEE
T ss_pred             EECCCCCCEEe
Confidence            44444444443


No 175
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=36.01  E-value=23  Score=20.03  Aligned_cols=10  Identities=20%  Similarity=0.889  Sum_probs=4.4

Q ss_pred             cccCCCcccc
Q psy2288         149 FACNVCPFKF  158 (247)
Q Consensus       149 ~~C~~C~~~~  158 (247)
                      +.|+.|+..|
T Consensus        29 W~C~~Cgh~w   38 (55)
T PF14311_consen   29 WKCPKCGHEW   38 (55)
T ss_pred             EECCCCCCee
Confidence            4444444443


No 176
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=35.30  E-value=14  Score=19.55  Aligned_cols=12  Identities=17%  Similarity=0.708  Sum_probs=8.6

Q ss_pred             Cceecccccccc
Q psy2288          35 KSLACNICSMVF   46 (247)
Q Consensus        35 ~~~~C~~C~~~~   46 (247)
                      ++..|++|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            457788888765


No 177
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=35.17  E-value=17  Score=23.26  Aligned_cols=12  Identities=42%  Similarity=0.911  Sum_probs=6.3

Q ss_pred             CcccCcCchhcc
Q psy2288         176 PFRCEYCDKTFT  187 (247)
Q Consensus       176 ~~~C~~C~~~f~  187 (247)
                      .+.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PTZ00255         54 IWRCKGCKKTVA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            355555555544


No 178
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=35.11  E-value=36  Score=17.18  Aligned_cols=22  Identities=18%  Similarity=0.422  Sum_probs=12.8

Q ss_pred             eecccccccccChHHHHHHHHhc
Q psy2288         205 YSCSHCDKTFFDAQSLNKHKLSH  227 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H~~~h  227 (247)
                      +.|+.|+..+. .+.+..|+..-
T Consensus         5 ~~C~nC~R~v~-a~RfA~HLekC   26 (33)
T PF08209_consen    5 VECPNCGRPVA-ASRFAPHLEKC   26 (33)
T ss_dssp             EE-TTTSSEEE-GGGHHHHHHHH
T ss_pred             EECCCCcCCcc-hhhhHHHHHHH
Confidence            67777777654 44566666543


No 179
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=35.02  E-value=6.7  Score=23.81  Aligned_cols=9  Identities=22%  Similarity=0.693  Sum_probs=3.0

Q ss_pred             eeCCCCCcc
Q psy2288          93 FRCSVCGKS  101 (247)
Q Consensus        93 ~~C~~C~~~  101 (247)
                      ..|..|+..
T Consensus        42 v~Cg~C~~~   50 (71)
T PF05495_consen   42 VICGKCRTE   50 (71)
T ss_dssp             EEETTT--E
T ss_pred             eECCCCCCc
Confidence            344444433


No 180
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=34.69  E-value=14  Score=19.81  Aligned_cols=13  Identities=46%  Similarity=1.313  Sum_probs=8.2

Q ss_pred             CCeeccccccccc
Q psy2288         203 QPYSCSHCDKTFF  215 (247)
Q Consensus       203 ~~~~C~~C~~~f~  215 (247)
                      .|++|+.|++.|=
T Consensus        12 ~~~~C~~C~~~FC   24 (43)
T PF01428_consen   12 LPFKCKHCGKSFC   24 (43)
T ss_dssp             SHEE-TTTS-EE-
T ss_pred             CCeECCCCCcccC
Confidence            4688999998883


No 181
>KOG3214|consensus
Probab=34.49  E-value=11  Score=24.36  Aligned_cols=14  Identities=29%  Similarity=0.724  Sum_probs=7.5

Q ss_pred             CeecccccccccCh
Q psy2288         204 PYSCSHCDKTFFDA  217 (247)
Q Consensus       204 ~~~C~~C~~~f~~~  217 (247)
                      -..|.+|+.+|++.
T Consensus        47 ~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   47 KASCRICEESFQTT   60 (109)
T ss_pred             eeeeeehhhhhccc
Confidence            34555555555544


No 182
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=34.46  E-value=21  Score=23.21  Aligned_cols=16  Identities=38%  Similarity=0.941  Sum_probs=11.2

Q ss_pred             cCCCCCeeccccccccc
Q psy2288         199 HKGVQPYSCSHCDKTFF  215 (247)
Q Consensus       199 h~~~~~~~C~~C~~~f~  215 (247)
                      +.| ++++|++||..|.
T Consensus        75 ~~g-~~~rC~eCG~~fk   90 (97)
T cd00924          75 EKG-KPKRCPECGHVFK   90 (97)
T ss_pred             eCC-CceeCCCCCcEEE
Confidence            444 6788888887774


No 183
>PF14369 zf-RING_3:  zinc-finger
Probab=34.29  E-value=25  Score=17.95  Aligned_cols=8  Identities=38%  Similarity=1.011  Sum_probs=3.5

Q ss_pred             cccccccc
Q psy2288          67 CTVCKKVF   74 (247)
Q Consensus        67 C~~C~~~f   74 (247)
                      ||.|+..|
T Consensus        24 CP~C~~gF   31 (35)
T PF14369_consen   24 CPRCHGGF   31 (35)
T ss_pred             CcCCCCcE
Confidence            44444333


No 184
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=33.22  E-value=32  Score=29.45  Aligned_cols=26  Identities=31%  Similarity=0.534  Sum_probs=18.5

Q ss_pred             CCeecccccccccChHHHHHHHHhcc
Q psy2288         203 QPYSCSHCDKTFFDAQSLNKHKLSHK  228 (247)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h~  228 (247)
                      +--.|+.|++.|.....+..|+...|
T Consensus        56 rFWiCp~CskkF~d~~~~~~H~~~eH   81 (466)
T PF04780_consen   56 RFWICPRCSKKFSDAESCLSHMEQEH   81 (466)
T ss_pred             eEeeCCcccceeCCHHHHHHHHHHhh
Confidence            34577888888888888888876533


No 185
>KOG2907|consensus
Probab=33.14  E-value=20  Score=23.88  Aligned_cols=12  Identities=25%  Similarity=0.783  Sum_probs=6.3

Q ss_pred             CeeCCCCCcccC
Q psy2288          92 PFRCSVCGKSFS  103 (247)
Q Consensus        92 ~~~C~~C~~~f~  103 (247)
                      .|.|+.|+..|.
T Consensus       102 FYTC~kC~~k~~  113 (116)
T KOG2907|consen  102 FYTCPKCKYKFT  113 (116)
T ss_pred             EEEcCccceeee
Confidence            355555555543


No 186
>KOG2636|consensus
Probab=32.94  E-value=37  Score=28.60  Aligned_cols=29  Identities=17%  Similarity=0.369  Sum_probs=19.1

Q ss_pred             HhcCCCCCeeccccc-ccccChHHHHHHHH
Q psy2288         197 NRHKGVQPYSCSHCD-KTFFDAQSLNKHKL  225 (247)
Q Consensus       197 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~  225 (247)
                      +.|.-...|.|.+|| +++.....+.+|..
T Consensus       394 KLHGL~~ey~CEICGNy~Y~GrkaF~RHF~  423 (497)
T KOG2636|consen  394 KLHGLDIEYNCEICGNYVYKGRKAFDRHFN  423 (497)
T ss_pred             hhcCCCcccceeeccCccccCcHHHHHHhH
Confidence            344445567777777 67777777777753


No 187
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=32.66  E-value=24  Score=19.90  Aligned_cols=9  Identities=44%  Similarity=0.796  Sum_probs=4.2

Q ss_pred             cCCCccccC
Q psy2288         151 CNVCPFKFT  159 (247)
Q Consensus       151 C~~C~~~~~  159 (247)
                      |..|++.|.
T Consensus         5 C~~C~~~F~   13 (57)
T cd00065           5 CMGCGKPFT   13 (57)
T ss_pred             CcccCcccc
Confidence            444554444


No 188
>PF06220 zf-U1:  U1 zinc finger;  InterPro: IPR013085 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a C2H2-type zinc finger motif found in several U1 small nuclear ribonucleoprotein C (U1-C) proteins. Some proteins contain multiple copies of this motif. The U1 small nuclear ribonucleoprotein (U1 snRNP) binds to the pre-mRNA 5' splice site at early stages of spliceosome assembly. Recruitment of U1 to a class of weak 5' splice site is promoted by binding of the protein TIA-1 to uridine-rich sequences immediately downstream from the 5' splice site. Binding of TIA-1 in the vicinity of a 5' splice site helps to stabilise U1 snRNP recruitment, at least in part, via a direct interaction with U1-C, thus providing one molecular mechanism for the function of this splicing regulator []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2VRD_A.
Probab=32.63  E-value=35  Score=17.75  Aligned_cols=12  Identities=17%  Similarity=0.586  Sum_probs=4.1

Q ss_pred             Cceecccccccc
Q psy2288          35 KSLACNICSMVF   46 (247)
Q Consensus        35 ~~~~C~~C~~~~   46 (247)
                      +.|-|..|+..+
T Consensus         2 ~ryyCdyC~~~~   13 (38)
T PF06220_consen    2 PRYYCDYCKKYL   13 (38)
T ss_dssp             -S-B-TTT--B-
T ss_pred             cCeeccccccee
Confidence            346677777777


No 189
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=32.47  E-value=25  Score=23.79  Aligned_cols=10  Identities=30%  Similarity=1.062  Sum_probs=4.5

Q ss_pred             cccCcCchhc
Q psy2288         177 FRCEYCDKTF  186 (247)
Q Consensus       177 ~~C~~C~~~f  186 (247)
                      ..|..|+..|
T Consensus        72 ~~C~~Cg~~~   81 (117)
T PRK00564         72 LECKDCSHVF   81 (117)
T ss_pred             EEhhhCCCcc
Confidence            3455554433


No 190
>PRK04351 hypothetical protein; Provisional
Probab=32.42  E-value=17  Score=25.78  Aligned_cols=33  Identities=21%  Similarity=0.690  Sum_probs=17.3

Q ss_pred             CCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccccccc
Q psy2288         175 KPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTFF  215 (247)
Q Consensus       175 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  215 (247)
                      -.|.|..|+..+...       +.+ +...|.|..|+..+.
T Consensus       111 y~Y~C~~Cg~~~~r~-------Rr~-n~~~yrCg~C~g~L~  143 (149)
T PRK04351        111 YLYECQSCGQQYLRK-------RRI-NTKRYRCGKCRGKLK  143 (149)
T ss_pred             EEEECCCCCCEeeee-------eec-CCCcEEeCCCCcEee
Confidence            346776676544321       111 234577777766543


No 191
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=32.05  E-value=17  Score=23.29  Aligned_cols=11  Identities=27%  Similarity=0.972  Sum_probs=5.8

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      +.|..|++.|.
T Consensus        54 W~C~~C~~~~A   64 (91)
T TIGR00280        54 WTCRKCGAKFA   64 (91)
T ss_pred             EEcCCCCCEEe
Confidence            45555555443


No 192
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=31.83  E-value=43  Score=18.86  Aligned_cols=12  Identities=25%  Similarity=0.761  Sum_probs=5.1

Q ss_pred             ecccccccccCH
Q psy2288          38 ACNICSMVFCDE   49 (247)
Q Consensus        38 ~C~~C~~~~~~~   49 (247)
                      .||.|+..|...
T Consensus        22 ~CPlC~r~l~~e   33 (54)
T PF04423_consen   22 CCPLCGRPLDEE   33 (54)
T ss_dssp             E-TTT--EE-HH
T ss_pred             cCCCCCCCCCHH
Confidence            677777766544


No 193
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=31.47  E-value=25  Score=20.54  Aligned_cols=15  Identities=20%  Similarity=0.611  Sum_probs=11.3

Q ss_pred             cCCceeccccccccc
Q psy2288          33 QQKSLACNICSMVFC   47 (247)
Q Consensus        33 ~~~~~~C~~C~~~~~   47 (247)
                      .+....|++|+..|.
T Consensus        45 ~~gev~CPYC~t~y~   59 (62)
T COG4391          45 DEGEVVCPYCSTRYR   59 (62)
T ss_pred             CCCcEecCccccEEE
Confidence            356678999998874


No 194
>COG2879 Uncharacterized small protein [Function unknown]
Probab=31.29  E-value=63  Score=19.03  Aligned_cols=20  Identities=15%  Similarity=0.215  Sum_probs=12.9

Q ss_pred             cChHHHHHHHHhccCCCCCC
Q psy2288         215 FDAQSLNKHKLSHKTSADPI  234 (247)
Q Consensus       215 ~~~~~l~~H~~~h~~~~~~~  234 (247)
                      ++..+...||+.+|..+|++
T Consensus        23 pdYdnYVehmr~~hPd~p~m   42 (65)
T COG2879          23 PDYDNYVEHMRKKHPDKPPM   42 (65)
T ss_pred             CcHHHHHHHHHHhCcCCCcc
Confidence            34456667777777776664


No 195
>COG1773 Rubredoxin [Energy production and conversion]
Probab=30.64  E-value=23  Score=20.24  Aligned_cols=14  Identities=21%  Similarity=0.574  Sum_probs=10.4

Q ss_pred             CeecccccccccCh
Q psy2288         204 PYSCSHCDKTFFDA  217 (247)
Q Consensus       204 ~~~C~~C~~~f~~~  217 (247)
                      .|+|..||..|.-.
T Consensus         3 ~~~C~~CG~vYd~e   16 (55)
T COG1773           3 RWRCSVCGYVYDPE   16 (55)
T ss_pred             ceEecCCceEeccc
Confidence            47888888887543


No 196
>COG2331 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=30.61  E-value=17  Score=22.18  Aligned_cols=32  Identities=16%  Similarity=0.593  Sum_probs=16.5

Q ss_pred             CcccCcCchhcccHHHHHHHHHhcCCCCCeecccccccc
Q psy2288         176 PFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKTF  214 (247)
Q Consensus       176 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f  214 (247)
                      .|+|..|+..|.    +..++   ++...-.|+.|+..+
T Consensus        12 ~Y~c~~cg~~~d----vvq~~---~ddplt~ce~c~a~~   43 (82)
T COG2331          12 SYECTECGNRFD----VVQAM---TDDPLTTCEECGARL   43 (82)
T ss_pred             EEeecccchHHH----HHHhc---ccCccccChhhChHH
Confidence            367777776554    22222   223334677777633


No 197
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=30.52  E-value=64  Score=19.08  Aligned_cols=6  Identities=50%  Similarity=1.531  Sum_probs=2.2

Q ss_pred             eCCCCC
Q psy2288          94 RCSVCG   99 (247)
Q Consensus        94 ~C~~C~   99 (247)
                      .|+.||
T Consensus        48 ~C~~Cg   53 (69)
T PF07282_consen   48 TCPNCG   53 (69)
T ss_pred             EcCCCC
Confidence            333333


No 198
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=30.09  E-value=20  Score=25.35  Aligned_cols=35  Identities=29%  Similarity=0.859  Sum_probs=18.4

Q ss_pred             CCCcccCcCchhcccHHHHHHHHHhcCCCCCeeccccccc
Q psy2288         174 VKPFRCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDKT  213 (247)
Q Consensus       174 ~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~  213 (247)
                      ..+|.|. |+..+.+.   ++|=..-.|+ .|.|..|+..
T Consensus       115 ~~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         115 TYPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             ceeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            4456666 66554433   2333333444 5666666653


No 199
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=29.88  E-value=45  Score=19.13  Aligned_cols=7  Identities=43%  Similarity=1.293  Sum_probs=2.9

Q ss_pred             cccCcCc
Q psy2288         177 FRCEYCD  183 (247)
Q Consensus       177 ~~C~~C~  183 (247)
                      |.|+.||
T Consensus        15 ~~Cp~cG   21 (55)
T PF13824_consen   15 FECPDCG   21 (55)
T ss_pred             CcCCCCC
Confidence            3444443


No 200
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=29.79  E-value=31  Score=31.45  Aligned_cols=13  Identities=23%  Similarity=0.514  Sum_probs=7.2

Q ss_pred             CCCCcccCcCchh
Q psy2288         173 GVKPFRCEYCDKT  185 (247)
Q Consensus       173 ~~~~~~C~~C~~~  185 (247)
                      ...|..|+.||..
T Consensus       472 ~~~p~~Cp~Cgs~  484 (730)
T COG1198         472 EPIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCCC
Confidence            3445566666544


No 201
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=29.46  E-value=10  Score=26.73  Aligned_cols=14  Identities=29%  Similarity=0.472  Sum_probs=9.5

Q ss_pred             cccCcCchhcccHH
Q psy2288         177 FRCEYCDKTFTRQI  190 (247)
Q Consensus       177 ~~C~~C~~~f~~~~  190 (247)
                      -+|+.|+..|++..
T Consensus        29 ReC~~C~~RFTTfE   42 (156)
T COG1327          29 RECLECGERFTTFE   42 (156)
T ss_pred             hcccccccccchhh
Confidence            46777777777654


No 202
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=29.09  E-value=25  Score=19.40  Aligned_cols=36  Identities=14%  Similarity=0.277  Sum_probs=17.6

Q ss_pred             eecccccccccChHHHHHH-----HHhccCCCCCCCccccC
Q psy2288         205 YSCSHCDKTFFDAQSLNKH-----KLSHKTSADPISSAKGS  240 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H-----~~~h~~~~~~~c~~c~~  240 (247)
                      |+|.+||..+.....-...     ..-..-...+.|..|+.
T Consensus         2 y~C~~CgyvYd~~~Gd~~~~i~pGt~F~~Lp~~w~CP~C~a   42 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKGDPENGIPPGTPFEDLPDDWVCPVCGA   42 (47)
T ss_dssp             EEETTTSBEEETTTBBGGGTB-TT--GGGS-TT-B-TTTSS
T ss_pred             cCCCCCCEEEcCCcCCcccCcCCCCCHHHCCCCCcCcCCCC
Confidence            7899999877655431100     01112245667777753


No 203
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=28.45  E-value=16  Score=25.86  Aligned_cols=10  Identities=30%  Similarity=1.089  Sum_probs=5.0

Q ss_pred             eecccccccc
Q psy2288         205 YSCSHCDKTF  214 (247)
Q Consensus       205 ~~C~~C~~~f  214 (247)
                      |.|+.|+..+
T Consensus       144 ~~C~~C~~~l  153 (157)
T PF10263_consen  144 YRCGRCGGPL  153 (157)
T ss_pred             EECCCCCCEE
Confidence            5555555433


No 205
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=28.43  E-value=23  Score=20.01  Aligned_cols=11  Identities=18%  Similarity=0.582  Sum_probs=7.5

Q ss_pred             eeccccccccc
Q psy2288         205 YSCSHCDKTFF  215 (247)
Q Consensus       205 ~~C~~C~~~f~  215 (247)
                      +.||+||..+.
T Consensus         1 i~CPyCge~~~   11 (52)
T PF14255_consen    1 IQCPYCGEPIE   11 (52)
T ss_pred             CCCCCCCCeeE
Confidence            36888887654


No 206
>KOG2272|consensus
Probab=28.32  E-value=41  Score=26.00  Aligned_cols=19  Identities=32%  Similarity=0.766  Sum_probs=10.4

Q ss_pred             HhCCCCccccCCCccccCC
Q psy2288         142 RHGNIRHFACNVCPFKFTT  160 (247)
Q Consensus       142 ~~~~~~~~~C~~C~~~~~~  160 (247)
                      .|.....|.|..|.+-|..
T Consensus       215 KhWHveHFvCa~CekPFlG  233 (332)
T KOG2272|consen  215 KHWHVEHFVCAKCEKPFLG  233 (332)
T ss_pred             cccchhheeehhcCCcccc
Confidence            3344455666666666543


No 207
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=28.26  E-value=12  Score=28.33  Aligned_cols=8  Identities=25%  Similarity=0.646  Sum_probs=5.6

Q ss_pred             ccCcCchh
Q psy2288         178 RCEYCDKT  185 (247)
Q Consensus       178 ~C~~C~~~  185 (247)
                      .||.|..+
T Consensus        64 vCP~C~yA   71 (267)
T COG1655          64 VCPICYYA   71 (267)
T ss_pred             EcchhhHH
Confidence            57888764


No 208
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=28.17  E-value=10  Score=24.58  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=5.7

Q ss_pred             ccccCCCcccc
Q psy2288         148 HFACNVCPFKF  158 (247)
Q Consensus       148 ~~~C~~C~~~~  158 (247)
                      .|.|+.||..-
T Consensus        22 ~FtCp~Cghe~   32 (104)
T COG4888          22 TFTCPRCGHEK   32 (104)
T ss_pred             eEecCccCCee
Confidence            35555555443


No 209
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=27.51  E-value=38  Score=28.50  Aligned_cols=29  Identities=24%  Similarity=0.626  Sum_probs=16.9

Q ss_pred             ccCCCccccCChHHHHHHHHHhCCCCCcccCcCchhcccH
Q psy2288         150 ACNVCPFKFTTKSDLQRHQRSHEGVKPFRCEYCDKTFTRQ  189 (247)
Q Consensus       150 ~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~  189 (247)
                      .|+.||....+.           |..-|+|+.|++.+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~kCg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKKCGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCcccccccccCCcc
Confidence            577777554432           22267777777766644


No 210
>KOG0717|consensus
Probab=27.38  E-value=40  Score=28.67  Aligned_cols=22  Identities=41%  Similarity=0.777  Sum_probs=18.0

Q ss_pred             eeccccccccCChHHHHHHHhh
Q psy2288          65 FTCTVCKKVFNNIKSLKTHSRI   86 (247)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~~   86 (247)
                      +-|++|+++|.+...+..|.+.
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7799999999888888888643


No 211
>PLN02294 cytochrome c oxidase subunit Vb
Probab=27.16  E-value=33  Score=24.78  Aligned_cols=14  Identities=21%  Similarity=0.667  Sum_probs=10.8

Q ss_pred             CCCeeccccccccc
Q psy2288         202 VQPYSCSHCDKTFF  215 (247)
Q Consensus       202 ~~~~~C~~C~~~f~  215 (247)
                      .+++.|++||..|.
T Consensus       139 Gkp~RCpeCG~~fk  152 (174)
T PLN02294        139 GKSFECPVCTQYFE  152 (174)
T ss_pred             CCceeCCCCCCEEE
Confidence            36788989988774


No 212
>KOG0717|consensus
Probab=27.09  E-value=36  Score=28.92  Aligned_cols=22  Identities=32%  Similarity=0.688  Sum_probs=20.1

Q ss_pred             cccCcCchhcccHHHHHHHHHh
Q psy2288         177 FRCEYCDKTFTRQIIMKEHLNR  198 (247)
Q Consensus       177 ~~C~~C~~~f~~~~~l~~H~~~  198 (247)
                      +.|.+|.++|.+..+|.+|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999999865


No 213
>KOG4118|consensus
Probab=26.37  E-value=34  Score=20.22  Aligned_cols=26  Identities=19%  Similarity=0.474  Sum_probs=18.1

Q ss_pred             eecccccccccCHHHHHHHHHHhCCC
Q psy2288          37 LACNICSMVFCDEIVLNKHVEEHSTL   62 (247)
Q Consensus        37 ~~C~~C~~~~~~~~~l~~H~~~~~~~   62 (247)
                      |+|..|-...++...+.+|..+.+..
T Consensus        39 ~kCtVC~~~mpdpktfkqhfe~kHpk   64 (74)
T KOG4118|consen   39 HKCTVCMVQMPDPKTFKQHFENKHPK   64 (74)
T ss_pred             hhhHhhHhhCCCCchHHHHHhhcCCC
Confidence            66777777777777777777665543


No 214
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=26.14  E-value=15  Score=17.71  Aligned_cols=9  Identities=33%  Similarity=1.025  Sum_probs=4.2

Q ss_pred             ecCcCcccc
Q psy2288         122 ICKQCGHAF  130 (247)
Q Consensus       122 ~C~~C~~~f  130 (247)
                      .|..|++.|
T Consensus         2 sCiDC~~~F   10 (28)
T PF08790_consen    2 SCIDCSKDF   10 (28)
T ss_dssp             EETTTTEEE
T ss_pred             eeecCCCCc
Confidence            344444444


No 215
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=25.90  E-value=24  Score=22.57  Aligned_cols=11  Identities=27%  Similarity=0.990  Sum_probs=5.6

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      +.|..|++.|.
T Consensus        55 W~C~~C~~~~A   65 (90)
T PRK03976         55 WECRKCGAKFA   65 (90)
T ss_pred             EEcCCCCCEEe
Confidence            45555555443


No 216
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=25.77  E-value=35  Score=22.26  Aligned_cols=13  Identities=38%  Similarity=1.004  Sum_probs=7.9

Q ss_pred             CeecccccccccC
Q psy2288         204 PYSCSHCDKTFFD  216 (247)
Q Consensus       204 ~~~C~~C~~~f~~  216 (247)
                      |++|..||..|.+
T Consensus         2 pH~CtrCG~vf~~   14 (112)
T COG3364           2 PHQCTRCGEVFDD   14 (112)
T ss_pred             Cceeccccccccc
Confidence            4566666666655


No 217
>PRK00420 hypothetical protein; Validated
Probab=25.62  E-value=42  Score=22.52  Aligned_cols=9  Identities=22%  Similarity=0.372  Sum_probs=4.9

Q ss_pred             cccCcCchh
Q psy2288         177 FRCEYCDKT  185 (247)
Q Consensus       177 ~~C~~C~~~  185 (247)
                      ..|+.||..
T Consensus        41 ~~Cp~Cg~~   49 (112)
T PRK00420         41 VVCPVHGKV   49 (112)
T ss_pred             eECCCCCCe
Confidence            456666554


No 218
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=25.53  E-value=5.1  Score=21.18  Aligned_cols=7  Identities=43%  Similarity=1.322  Sum_probs=2.8

Q ss_pred             eeccccc
Q psy2288          65 FTCTVCK   71 (247)
Q Consensus        65 ~~C~~C~   71 (247)
                      |.|..|+
T Consensus        29 y~C~~C~   35 (40)
T smart00440       29 YVCTKCG   35 (40)
T ss_pred             EEeCCCC
Confidence            3344443


No 219
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=24.94  E-value=29  Score=19.41  Aligned_cols=36  Identities=17%  Similarity=0.254  Sum_probs=19.8

Q ss_pred             eecccccccccChHHHHHH-H----HhccCCCCCCCccccC
Q psy2288         205 YSCSHCDKTFFDAQSLNKH-K----LSHKTSADPISSAKGS  240 (247)
Q Consensus       205 ~~C~~C~~~f~~~~~l~~H-~----~~h~~~~~~~c~~c~~  240 (247)
                      |+|.+||..+.-...-... .    .--.-...+.|+.|+.
T Consensus         2 y~C~~CgyiYd~~~Gd~~~~i~pGt~f~~Lp~~w~CP~C~a   42 (50)
T cd00730           2 YECRICGYIYDPAEGDPDEGIPPGTPFEDLPDDWVCPVCGA   42 (50)
T ss_pred             cCCCCCCeEECCCCCCcccCcCCCCCHhHCCCCCCCCCCCC
Confidence            7899999988744211000 0    0001235678888864


No 220
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=24.92  E-value=68  Score=27.55  Aligned_cols=21  Identities=29%  Similarity=0.656  Sum_probs=11.0

Q ss_pred             eeccccccccCChHHHHHHHh
Q psy2288          65 FTCTVCKKVFNNIKSLKTHSR   85 (247)
Q Consensus        65 ~~C~~C~~~f~~~~~l~~H~~   85 (247)
                      ..|+.|.+.|.+...+..|+.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~   78 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHME   78 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHH
Confidence            445555555555555555544


No 221
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=24.92  E-value=82  Score=23.38  Aligned_cols=11  Identities=27%  Similarity=0.640  Sum_probs=5.8

Q ss_pred             ceecccccccc
Q psy2288          64 KFTCTVCKKVF   74 (247)
Q Consensus        64 ~~~C~~C~~~f   74 (247)
                      .+.|..|+.++
T Consensus        30 lvrC~eCG~V~   40 (201)
T COG1326          30 LVRCEECGTVH   40 (201)
T ss_pred             EEEccCCCcEe
Confidence            35555555554


No 222
>KOG0978|consensus
Probab=24.88  E-value=27  Score=31.44  Aligned_cols=10  Identities=30%  Similarity=1.082  Sum_probs=6.0

Q ss_pred             eecccccccc
Q psy2288          65 FTCTVCKKVF   74 (247)
Q Consensus        65 ~~C~~C~~~f   74 (247)
                      .+|+.|+..+
T Consensus       644 LkCs~Cn~R~  653 (698)
T KOG0978|consen  644 LKCSVCNTRW  653 (698)
T ss_pred             eeCCCccCch
Confidence            5677776444


No 223
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=24.72  E-value=32  Score=23.12  Aligned_cols=10  Identities=30%  Similarity=0.763  Sum_probs=4.9

Q ss_pred             cccCcCchhc
Q psy2288         177 FRCEYCDKTF  186 (247)
Q Consensus       177 ~~C~~C~~~f  186 (247)
                      ..|..|+..|
T Consensus        71 ~~C~~Cg~~~   80 (114)
T PRK03681         71 CWCETCQQYV   80 (114)
T ss_pred             EEcccCCCee
Confidence            4455555433


No 224
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=24.52  E-value=64  Score=18.28  Aligned_cols=31  Identities=16%  Similarity=0.325  Sum_probs=17.2

Q ss_pred             ecccccccccCHHHHHHHHHHhCCCCceecccccc
Q psy2288          38 ACNICSMVFCDEIVLNKHVEEHSTLGKFTCTVCKK   72 (247)
Q Consensus        38 ~C~~C~~~~~~~~~l~~H~~~~~~~~~~~C~~C~~   72 (247)
                      .|.-|....+........    .++....|+.|+.
T Consensus        24 ~C~gC~~~l~~~~~~~i~----~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIR----KGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHH----cCCCeEECcCCCc
Confidence            577777766554433331    1244567777765


No 225
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=24.50  E-value=57  Score=26.61  Aligned_cols=30  Identities=13%  Similarity=0.396  Sum_probs=21.4

Q ss_pred             HhcCCCCCeeccccc-ccccChHHHHHHHHh
Q psy2288         197 NRHKGVQPYSCSHCD-KTFFDAQSLNKHKLS  226 (247)
Q Consensus       197 ~~h~~~~~~~C~~C~-~~f~~~~~l~~H~~~  226 (247)
                      +.|.-.+.|.|.+|| +++.....+.+|..-
T Consensus       367 klhgLd~ef~CEICgNyvy~GR~~FdrHF~E  397 (470)
T COG5188         367 KLHGLDIEFECEICGNYVYYGRDRFDRHFEE  397 (470)
T ss_pred             HhcCCCcceeeeecccccccchHHHHhhhhh
Confidence            445556678888888 777777778877644


No 226
>PRK12496 hypothetical protein; Provisional
Probab=24.43  E-value=47  Score=23.98  Aligned_cols=9  Identities=33%  Similarity=0.925  Sum_probs=4.1

Q ss_pred             ccCCCcccc
Q psy2288         150 ACNVCPFKF  158 (247)
Q Consensus       150 ~C~~C~~~~  158 (247)
                      .|.-|++.|
T Consensus       129 ~C~gC~~~~  137 (164)
T PRK12496        129 VCKGCKKKY  137 (164)
T ss_pred             ECCCCCccc
Confidence            344444444


No 227
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=24.29  E-value=15  Score=24.61  Aligned_cols=9  Identities=22%  Similarity=0.988  Sum_probs=3.9

Q ss_pred             cccCcCchh
Q psy2288         177 FRCEYCDKT  185 (247)
Q Consensus       177 ~~C~~C~~~  185 (247)
                      |.|..||..
T Consensus       101 y~C~~Cg~~  109 (113)
T COG1594         101 YKCTRCGYR  109 (113)
T ss_pred             EEecccCCE
Confidence            444444433


No 228
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=24.02  E-value=32  Score=19.65  Aligned_cols=30  Identities=13%  Similarity=0.267  Sum_probs=18.6

Q ss_pred             CeecccccccccChHHHHHHHHhccCCCCCCCccccCC
Q psy2288         204 PYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSK  241 (247)
Q Consensus       204 ~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~  241 (247)
                      .|+|+.||..+.=....        ......|..||-.
T Consensus         2 ~~~CP~CG~~iev~~~~--------~GeiV~Cp~CGae   31 (54)
T TIGR01206         2 QFECPDCGAEIELENPE--------LGELVICDECGAE   31 (54)
T ss_pred             ccCCCCCCCEEecCCCc--------cCCEEeCCCCCCE
Confidence            37899999977422211        1346678888754


No 229
>PRK11032 hypothetical protein; Provisional
Probab=23.62  E-value=33  Score=24.63  Aligned_cols=34  Identities=15%  Similarity=0.291  Sum_probs=23.8

Q ss_pred             CCeecccccccccChHHHHHHHHhccCCCCCCCccccCCCcCCC
Q psy2288         203 QPYSCSHCDKTFFDAQSLNKHKLSHKTSADPISSAKGSKLFGGI  246 (247)
Q Consensus       203 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~c~~~~~~~~  246 (247)
                      ..+.|..||...          ...+.+..+-|+.||..-|.+.
T Consensus       123 G~LvC~~Cg~~~----------~~~~p~~i~pCp~C~~~~F~R~  156 (160)
T PRK11032        123 GNLVCEKCHHHL----------AFYTPEVLPLCPKCGHDQFQRR  156 (160)
T ss_pred             ceEEecCCCCEE----------EecCCCcCCCCCCCCCCeeeeC
Confidence            358888888743          2345677788888888887653


No 230
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=23.32  E-value=49  Score=29.82  Aligned_cols=13  Identities=15%  Similarity=0.350  Sum_probs=8.3

Q ss_pred             eecccccccccCh
Q psy2288         205 YSCSHCDKTFFDA  217 (247)
Q Consensus       205 ~~C~~C~~~f~~~  217 (247)
                      --|+.||....+.
T Consensus        42 ~fC~~CG~~~~~~   54 (645)
T PRK14559         42 AHCPNCGAETGTI   54 (645)
T ss_pred             ccccccCCcccch
Confidence            4677777666555


No 231
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=23.13  E-value=1.1e+02  Score=22.91  Aligned_cols=12  Identities=17%  Similarity=0.509  Sum_probs=5.7

Q ss_pred             CcccCcCchhcc
Q psy2288         176 PFRCEYCDKTFT  187 (247)
Q Consensus       176 ~~~C~~C~~~f~  187 (247)
                      ...|..|+..+.
T Consensus        95 ~~~C~~C~~~~~  106 (206)
T cd01410          95 IEVCKSCGPEYV  106 (206)
T ss_pred             cccCCCCCCccc
Confidence            344555554443


No 232
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=23.04  E-value=86  Score=24.32  Aligned_cols=10  Identities=10%  Similarity=-0.047  Sum_probs=5.4

Q ss_pred             CCCCccccCC
Q psy2288         232 DPISSAKGSK  241 (247)
Q Consensus       232 ~~~c~~c~~~  241 (247)
                      .+.|..|++.
T Consensus       143 ~p~Cp~Cgg~  152 (244)
T PRK14138        143 VPRCDDCSGL  152 (244)
T ss_pred             CCCCCCCCCe
Confidence            4556666543


No 233
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=23.00  E-value=77  Score=24.45  Aligned_cols=9  Identities=22%  Similarity=0.276  Sum_probs=4.2

Q ss_pred             CCCccccCC
Q psy2288         233 PISSAKGSK  241 (247)
Q Consensus       233 ~~c~~c~~~  241 (247)
                      +.|+.|++.
T Consensus       143 p~C~~Cgg~  151 (242)
T PRK00481        143 PRCPKCGGI  151 (242)
T ss_pred             CCCCCCCCc
Confidence            335555443


No 234
>KOG1842|consensus
Probab=23.00  E-value=48  Score=28.00  Aligned_cols=24  Identities=25%  Similarity=0.534  Sum_probs=12.9

Q ss_pred             eecccccccccCHHHHHHHHHHhC
Q psy2288          37 LACNICSMVFCDEIVLNKHVEEHS   60 (247)
Q Consensus        37 ~~C~~C~~~~~~~~~l~~H~~~~~   60 (247)
                      +.||+|...|.+...|..|....|
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhhhc
Confidence            445555555555555555555444


No 235
>PF11789 zf-Nse:  Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C.
Probab=22.92  E-value=57  Score=18.77  Aligned_cols=12  Identities=17%  Similarity=0.520  Sum_probs=4.4

Q ss_pred             Cceecccccccc
Q psy2288          35 KSLACNICSMVF   46 (247)
Q Consensus        35 ~~~~C~~C~~~~   46 (247)
                      .|+....|+-+|
T Consensus        23 ~PV~s~~C~H~f   34 (57)
T PF11789_consen   23 DPVKSKKCGHTF   34 (57)
T ss_dssp             SEEEESSS--EE
T ss_pred             CCcCcCCCCCee
Confidence            344444454444


No 236
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=22.36  E-value=74  Score=17.44  Aligned_cols=6  Identities=50%  Similarity=1.425  Sum_probs=2.2

Q ss_pred             eCCCCC
Q psy2288          94 RCSVCG   99 (247)
Q Consensus        94 ~C~~C~   99 (247)
                      .|+.|+
T Consensus        22 vC~~Cg   27 (52)
T smart00661       22 VCRKCG   27 (52)
T ss_pred             ECCcCC
Confidence            333333


No 237
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=22.22  E-value=28  Score=19.78  Aligned_cols=9  Identities=22%  Similarity=0.567  Sum_probs=4.0

Q ss_pred             CccccCCCc
Q psy2288         147 RHFACNVCP  155 (247)
Q Consensus       147 ~~~~C~~C~  155 (247)
                      -|..|+.|.
T Consensus        27 fPlyCpKCK   35 (55)
T PF14205_consen   27 FPLYCPKCK   35 (55)
T ss_pred             ccccCCCCC
Confidence            344444443


No 238
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=22.16  E-value=44  Score=16.78  Aligned_cols=10  Identities=30%  Similarity=0.869  Sum_probs=5.0

Q ss_pred             eecccccccc
Q psy2288         205 YSCSHCDKTF  214 (247)
Q Consensus       205 ~~C~~C~~~f  214 (247)
                      +.|..||.+|
T Consensus        22 ~~C~~Cg~~~   31 (33)
T PF08792_consen   22 EVCIFCGSSF   31 (33)
T ss_pred             EEcccCCcEe
Confidence            4555555444


No 239
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=21.88  E-value=59  Score=21.71  Aligned_cols=12  Identities=25%  Similarity=0.578  Sum_probs=6.4

Q ss_pred             CCcccCcCchhc
Q psy2288         175 KPFRCEYCDKTF  186 (247)
Q Consensus       175 ~~~~C~~C~~~f  186 (247)
                      ...+||.|++..
T Consensus        68 v~V~CP~C~K~T   79 (114)
T PF11023_consen   68 VQVECPNCGKQT   79 (114)
T ss_pred             eeeECCCCCChH
Confidence            345566666543


No 240
>KOG2636|consensus
Probab=21.03  E-value=70  Score=27.09  Aligned_cols=27  Identities=19%  Similarity=0.443  Sum_probs=16.1

Q ss_pred             HhCCCCCcccCcCc-hhcccHHHHHHHH
Q psy2288         170 SHEGVKPFRCEYCD-KTFTRQIIMKEHL  196 (247)
Q Consensus       170 ~h~~~~~~~C~~C~-~~f~~~~~l~~H~  196 (247)
                      .|.-...|.|.+|| +++.-+..+.+|-
T Consensus       395 LHGL~~ey~CEICGNy~Y~GrkaF~RHF  422 (497)
T KOG2636|consen  395 LHGLDIEYNCEICGNYVYKGRKAFDRHF  422 (497)
T ss_pred             hcCCCcccceeeccCccccCcHHHHHHh
Confidence            34455556666666 5556666666664


No 241
>KOG1842|consensus
Probab=20.83  E-value=63  Score=27.34  Aligned_cols=22  Identities=27%  Similarity=0.623  Sum_probs=10.8

Q ss_pred             cccCCCccccCChHHHHHHHHH
Q psy2288         149 FACNVCPFKFTTKSDLQRHQRS  170 (247)
Q Consensus       149 ~~C~~C~~~~~~~~~l~~H~~~  170 (247)
                      |.||+|...|.+...|..|.-.
T Consensus        16 flCPiC~~dl~~~~~L~~H~d~   37 (505)
T KOG1842|consen   16 FLCPICLLDLPNLSALNDHLDV   37 (505)
T ss_pred             ccCchHhhhhhhHHHHHHHHhh
Confidence            4455555555555555554433


No 242
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=20.58  E-value=9.1  Score=30.51  Aligned_cols=14  Identities=21%  Similarity=0.683  Sum_probs=6.4

Q ss_pred             CCCccccCCCcccc
Q psy2288         145 NIRHFACNVCPFKF  158 (247)
Q Consensus       145 ~~~~~~C~~C~~~~  158 (247)
                      +.+-..|..|+..+
T Consensus       194 G~R~L~Cs~C~t~W  207 (290)
T PF04216_consen  194 GKRYLHCSLCGTEW  207 (290)
T ss_dssp             -EEEEEETTT--EE
T ss_pred             ccEEEEcCCCCCee
Confidence            34555666666554


No 243
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=20.56  E-value=18  Score=32.41  Aligned_cols=29  Identities=31%  Similarity=0.865  Sum_probs=16.6

Q ss_pred             ccCcCchhcccHHHHHHHHHhcCCCCCeecccccc
Q psy2288         178 RCEYCDKTFTRQIIMKEHLNRHKGVQPYSCSHCDK  212 (247)
Q Consensus       178 ~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  212 (247)
                      -|+.|.+.+.+..+-+-|      -.|..|+.||=
T Consensus       153 lC~~C~~EY~dP~nRRfH------AQp~aCp~CGP  181 (750)
T COG0068         153 LCPFCDKEYKDPLNRRFH------AQPIACPKCGP  181 (750)
T ss_pred             CCHHHHHHhcCccccccc------cccccCcccCC
Confidence            366666666655544433      34566777764


No 244
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=20.47  E-value=60  Score=25.82  Aligned_cols=11  Identities=27%  Similarity=0.745  Sum_probs=7.1

Q ss_pred             eeccccccccc
Q psy2288         205 YSCSHCDKTFF  215 (247)
Q Consensus       205 ~~C~~C~~~f~  215 (247)
                      |.|+.|.-.|-
T Consensus       256 yvCs~Clsi~C  266 (279)
T TIGR00627       256 FVCSVCLSVLC  266 (279)
T ss_pred             EECCCccCCcC
Confidence            66666666554


No 245
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=20.40  E-value=1.2e+02  Score=23.15  Aligned_cols=11  Identities=18%  Similarity=0.637  Sum_probs=5.1

Q ss_pred             cccCcCchhcc
Q psy2288         177 FRCEYCDKTFT  187 (247)
Q Consensus       177 ~~C~~C~~~f~  187 (247)
                      ..|..|+..+.
T Consensus       114 ~~C~~C~~~~~  124 (222)
T cd01413         114 AYCVNCGSKYD  124 (222)
T ss_pred             ceECCCCCCcc
Confidence            44555554443


No 246
>KOG4377|consensus
Probab=20.40  E-value=45  Score=27.84  Aligned_cols=25  Identities=20%  Similarity=0.408  Sum_probs=17.8

Q ss_pred             eec--cccccccCChHHHHHHHhhccC
Q psy2288          65 FTC--TVCKKVFNNIKSLKTHSRIHTG   89 (247)
Q Consensus        65 ~~C--~~C~~~f~~~~~l~~H~~~~~~   89 (247)
                      |.|  +.|+..+..+.++..|.+.|-.
T Consensus       272 yhcl~e~C~ykr~~k~DvirH~~~hkk  298 (480)
T KOG4377|consen  272 YHCLNEYCFYKRGQKNDVIRHVEIHKK  298 (480)
T ss_pred             hcccCccccccccchhhhHHHHHHHhh
Confidence            555  4588777778888888877643


No 247
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=20.19  E-value=51  Score=21.63  Aligned_cols=25  Identities=24%  Similarity=0.327  Sum_probs=19.9

Q ss_pred             CCceecccccccccCHHHHHHHHHH
Q psy2288          34 QKSLACNICSMVFCDEIVLNKHVEE   58 (247)
Q Consensus        34 ~~~~~C~~C~~~~~~~~~l~~H~~~   58 (247)
                      -..+-|-+|.+.|.+...|..|.+.
T Consensus        53 lGqhYCieCaryf~t~~aL~~Hkkg   77 (126)
T COG5112          53 LGQHYCIECARYFITEKALMEHKKG   77 (126)
T ss_pred             CceeeeehhHHHHHHHHHHHHHhcc
Confidence            3447788999999999888888765


Done!