Diaphorina citri psyllid: psy2291


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
MEIYCNYVDDKPMKQFLLHLDETNTLGRRFIIHCFSDKPMKQFLLHLDETNTLGRRFIIQDLDETHLFISSDVIELLMTRVDDLLDQISFPINDRD
cEEEEEccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHccccccccEEEEEccccEEEEEHHHHHHHHHHHHHHHHHccccccccc
*EIYCNYVDDKPMKQFLLHLDETNTLGRRFIIHCFSDKPMKQFLLHLDETNTLGRRFIIQDLDETHLFISSDVIELLMTRVDDLLDQISF******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIYCNYVDDKPMKQFLLHLDETNTLGRRFIIHCFSDKPMKQFLLHLDETNTLGRRFIIQDLDETHLFISSDVIELLMTRVDDLLDQISFPINDRD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
General transcription factor IIH subunit 5 Component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.confidentQ5ZKH0
General transcription factor IIH subunit 5 Component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.confidentQ6ZYL4
General transcription factor IIH subunit 5 Component of the TFIIH basal transcription factor involved in nucleotide excision repair (NER) of DNA and, when complexed to CAK, in RNA transcription by RNA polymerase II. Necessary for the stability of the TFIIH complex and for the presence of normal levels of TFIIH in the cell.confidentQ2T9Z5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005675 [CC]holo TFIIH complexprobableGO:0030880, GO:0000428, GO:0031974, GO:0043229, GO:0016591, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0055029, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0005667, GO:0044424, GO:0044422
GO:0006289 [BP]nucleotide-excision repairprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0009411 [BP]response to UVprobableGO:0008150, GO:0009314, GO:0050896, GO:0009416, GO:0009628
GO:0000439 [CC]core TFIIH complexprobableGO:0043234, GO:0032806, GO:0032991, GO:0005575, GO:0005634, GO:0044464, GO:0005623, GO:0043231, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0000441
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YDL, chain A
Confidence level:very confident
Coverage over the Query: 24-95
View the alignment between query and template
View the model in PyMOL