Diaphorina citri psyllid: psy230


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MAGDTLSLNAEPRLILGPGLRRESSAILVSQSGILRHAKPFTYYVDYIQRRYVPTRGDLVIGVVTSRVGDNYRVDIGSHDPAVLSYLAFEGATKKNPPKVETGDVVAGKLLTANKDMESEMVCVDSRGKEFIMGILNDGYLLHTSISLCRKLLNPKCPLLKQLAKRSRQKMELSIGMNGKIWIRCESFSDTVRVGNLIMSCELLSYEEILNLCESIHIRFLQ
ccccCCcccccccEEEcccCEECccEEEEEEEEEEEECcccEEEEEccccccccccccEEEEEEEEECccEEEEEccccccEEEEcccccccccccccccccccCEEEEEEEEcccccEEEEEEccccccccEEEcccEEEEEEccHHHHHHccccccHHHHHHHcccccEEEEEEEccEEEEEcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcc
MAGDTLSLNAEPRLILGPGLRRESSAILVSQSGILRHAKPFTYYVDYIQRRYVPTRGDLVIGVVTSRVGDNYRVDIGSHDPAVLSYLAFEGATKKNPPKVETGDVVAGKLLTANKDMESEMVCVDSRGKEFIMGILNDGYLLHTSISLCRKLLNPKCPLLKQLAKRSRQKMELSIGMNGKIWIRCESFSDTVRVGNLIMSCELLSYEEILNLCESIHIRFL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGDTLSLNAEPRLILGPGLRRESSAILVSQSGILRHAKPFTYYVDYIQRRYVPTRGDLVIGVVTSRVGDNYRVDIGSHDPAVLSYLAFEGATKKNPPKVETGDVVAGKLLTANKDMESEMVCVDSRGKEFIMGILNDGYLLHTSISLCRKLLNPKCPLLKQLAKRSRQKMELSIGMNGKIWIRCESFSDTVRVGNLIMSCELLSYEEILNLCESIHIRFLQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exosome complex component RRP40 Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. RRP40 as peripheral part of the Exo-9 complex is thought to stabilize the hexameric ring of RNase PH-domain subunits.confidentQ08285
Putative exosome complex component rrp40 Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events.confidentQ7KWX9
Exosome complex component rrp40 Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and cryptic unstable transcripts (CUTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and in RNA surveillance pathways, preventing translation of aberrant mRNAs. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes. rrp40 as peripheral part of the Exo-9 complex is thought to stabilize the hexameric ring of RNase PH-domain subunits.confidentO13903

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmconfidentGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0030145 [MF]manganese ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0071038 [BP]nuclear polyadenylation-dependent tRNA catabolic processprobableGO:0071046, GO:0071029, GO:0071025, GO:0071027, GO:0090304, GO:0034641, GO:0006807, GO:0034661, GO:0034660, GO:0043632, GO:0043633, GO:0043634, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0016070, GO:0044248, GO:0044270, GO:0016078, GO:0044237, GO:0043170, GO:0006399, GO:0019439
GO:0000176 [CC]nuclear exosome (RNase complex)probableGO:0043234, GO:0005575, GO:0000178, GO:0032991, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000177 [CC]cytoplasmic exosome (RNase complex)probableGO:0005737, GO:0043234, GO:0000178, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0071042 [BP]nuclear polyadenylation-dependent mRNA catabolic processprobableGO:0071047, GO:0090304, GO:0034641, GO:0006807, GO:0043632, GO:0043633, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0000467 [BP]exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)probableGO:0008152, GO:0090304, GO:0090305, GO:0034641, GO:0006807, GO:0000459, GO:0034660, GO:0071840, GO:0006139, GO:0044260, GO:1901360, GO:0042254, GO:0071704, GO:0010467, GO:0006364, GO:0022613, GO:0034470, GO:0044238, GO:0031125, GO:0009987, GO:0006725, GO:0031123, GO:0000460, GO:0008150, GO:0000466, GO:0043628, GO:0000469, GO:0046483, GO:0016070, GO:0090503, GO:0016072, GO:0090501, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0004532 [MF]exoribonuclease activityprobableGO:0016787, GO:0004518, GO:0004527, GO:0004540, GO:0016788, GO:0003824, GO:0003674
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0070478 [BP]nuclear-transcribed mRNA catabolic process, 3'-5' exonucleolytic nonsense-mediated decayprobableGO:0000184, GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0000288, GO:0044260, GO:0009056, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0043928, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0000291, GO:0044270, GO:0044237, GO:0043170, GO:0034427, GO:0000956, GO:0019439
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0007420 [BP]brain developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0040007 [BP]growthprobableGO:0008150
GO:0010468 [BP]regulation of gene expressionprobableGO:0060255, GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0071035 [BP]nuclear polyadenylation-dependent rRNA catabolic processprobableGO:0071046, GO:0071029, GO:0071025, GO:0071027, GO:0090304, GO:0034641, GO:0006807, GO:0034661, GO:0034660, GO:0043632, GO:0043633, GO:0043634, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0046483, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044270, GO:0016070, GO:0044248, GO:0016072, GO:0016075, GO:0044237, GO:0043170, GO:0019439
GO:0071034 [BP]CUT catabolic processprobableGO:0071043, GO:0090304, GO:0034641, GO:0006807, GO:0034661, GO:0034660, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0044238, GO:0044270, GO:0044237, GO:0043170, GO:0019439
GO:0070481 [BP]nuclear-transcribed mRNA catabolic process, non-stop decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0045006 [BP]DNA deaminationprobableGO:0006139, GO:0006304, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0043412, GO:0006807, GO:0008150, GO:0008152, GO:0006259, GO:1901360, GO:0046483
GO:0070651 [BP]nonfunctional rRNA decayprobableGO:0090304, GO:0034641, GO:0006807, GO:0034661, GO:0034660, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0046483, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0044270, GO:0016070, GO:0044238, GO:0016072, GO:0016075, GO:0044237, GO:0043170, GO:0019439

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NN6, chain G
Confidence level:very confident
Coverage over the Query: 12-11,24-218
View the alignment between query and template
View the model in PyMOL