Diaphorina citri psyllid: psy2311


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------
MKLALDIARGMMYLHSKGVFHRDLTSKNVLIKCNDVTHEMTAVVGDFGLAAKIPKLGAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAEVTHKVTNQVMVLKMNQKKINRAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAPFLKLAFSCCNDDKTPLSMRRDIQEGAESLLYP
cHHHHHHHHHHHHHHcccccccccccccEEEECcccccccEEEEcCECcccccccccccccccccccccccccccccccccccccEEEHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEHHHHHHcccccccccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHcccc
MKLALDIARGMMYLHSKGVFHRDLTSKNVLIKCNDVTHEMTAVVGDFGLAAKIPKLGAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAEVTHKVTNQVMVLKMNQKKINRAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAPFLKLAFSCCNDDKTPLSMRRDIQEGAESLLYP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLALDIARGMMYLHSKGVFHRDLTSKNVLIKCNDVTHEMTAVVGDFGLAAKIPKLGAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAEVTHKVTNQVMVLKMNQKKINRAFRLDTAGTPWWMSPECLKGEWYDQHSDVFSYGVILCELAGRCNADPDLLACRTQNFGLDYMAVVQLVSKQPIAPPAPFLKLAFSCCNDDKTPLSMRRDIQEGAESLLYP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dual specificity testis-specific protein kinase 1 Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Probably plays a central role at and after the meiotic phase of spermatogenesis.confidentQ15569
Dual specificity testis-specific protein kinase 2 Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Phosphorylates cofilin at 'Ser-3'. May play an important role in spermatogenesis.confidentQ924U5
Dual specificity testis-specific protein kinase 1 Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Probably plays a central role at and after the meiotic phase of spermatogenesis.confidentO70146

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0032501 [BP]multicellular organismal processprobableGO:0008150
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S95, chain A
Confidence level:very confident
Coverage over the Query: 2-54,160-264
View the alignment between query and template
View the model in PyMOL
Template: 2BDW, chain A
Confidence level:very confident
Coverage over the Query: 2-101,112-170
View the alignment between query and template
View the model in PyMOL