Query         psy2313
Match_columns 62
No_of_seqs    152 out of 1013
Neff          7.9 
Searched_HMMs 46136
Date          Fri Aug 16 21:28:25 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy2313.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/2313hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1053|consensus               99.7 8.7E-18 1.9E-22  118.3   4.3   58    1-62    470-527 (1258)
  2 PF10613 Lig_chan-Glu_bd:  Liga  99.7   2E-17 4.3E-22   85.7   3.4   43    1-46     23-65  (65)
  3 KOG1054|consensus               99.7 6.9E-17 1.5E-21  110.7   4.4   60    1-62    450-509 (897)
  4 KOG4440|consensus               99.5 5.5E-14 1.2E-18   97.2   4.6   62    1-62    467-533 (993)
  5 KOG1052|consensus               99.3 3.7E-12 7.9E-17   87.3   4.6   57    1-62    249-305 (656)
  6 TIGR03870 ABC_MoxJ methanol ox  98.6 3.4E-08 7.3E-13   60.9   3.8   46    1-62     23-71  (246)
  7 PF00497 SBP_bac_3:  Bacterial   98.6 2.8E-08   6E-13   58.5   3.1   47    1-62     26-72  (225)
  8 PRK15437 histidine ABC transpo  98.6 7.1E-08 1.5E-12   59.5   4.4   47    1-62     53-99  (259)
  9 PRK10859 membrane-bound lytic   98.6 9.7E-08 2.1E-12   64.2   4.5   48    1-62     68-115 (482)
 10 PRK09495 glnH glutamine ABC tr  98.6   1E-07 2.2E-12   58.3   4.1   47    1-62     51-97  (247)
 11 PRK15010 ABC transporter lysin  98.5 1.2E-07 2.6E-12   58.5   4.3   47    1-62     53-99  (260)
 12 PRK15007 putative ABC transpor  98.5 1.7E-07 3.7E-12   56.9   4.3   47    1-62     48-94  (243)
 13 PRK10797 glutamate and asparta  98.4 4.2E-07   9E-12   57.9   4.6   47    1-62     67-120 (302)
 14 TIGR01096 3A0103s03R lysine-ar  98.4   7E-07 1.5E-11   54.2   4.4   47    1-62     51-97  (250)
 15 PRK11260 cystine transporter s  98.3 8.6E-07 1.9E-11   54.9   4.4   47    1-62     68-114 (266)
 16 PRK11917 bifunctional adhesin/  98.3 1.4E-06 3.1E-11   54.2   4.2   47    1-62     66-115 (259)
 17 PRK09959 hybrid sensory histid  98.2 2.1E-06 4.5E-11   62.1   4.7   48    1-62     84-131 (1197)
 18 TIGR02995 ectoine_ehuB ectoine  98.2 1.4E-06 3.1E-11   54.3   3.4   47    1-62     59-106 (275)
 19 COG0834 HisJ ABC-type amino ac  98.2 2.9E-06 6.2E-11   51.8   3.9   47    1-62     63-111 (275)
 20 TIGR02285 conserved hypothetic  98.0 9.4E-06   2E-10   50.4   4.6   45    2-62     45-90  (268)
 21 smart00062 PBPb Bacterial peri  97.7 8.3E-05 1.8E-09   42.5   4.2   45    1-60     27-71  (219)
 22 cd00134 PBPb Bacterial peripla  97.7  0.0001 2.2E-09   42.3   4.5   45    2-61     27-71  (218)
 23 TIGR03871 ABC_peri_MoxJ_2 quin  97.5 0.00022 4.7E-09   43.0   4.7   41    1-54     23-63  (232)
 24 PRK09959 hybrid sensory histid  97.2 0.00073 1.6E-08   49.2   4.6   47    1-62    329-375 (1197)
 25 TIGR01098 3A0109s03R phosphate  97.1  0.0018 3.8E-08   39.5   5.0   42    2-57     53-94  (254)
 26 COG4623 Predicted soluble lyti  96.8  0.0027 5.9E-08   43.0   4.5   47    2-62     49-95  (473)
 27 TIGR03431 PhnD phosphonate ABC  96.2   0.017 3.7E-07   36.2   5.0   40    3-56     49-88  (288)
 28 PRK00489 hisG ATP phosphoribos  95.8  0.0085 1.8E-07   38.2   2.5   28   35-62     51-78  (287)
 29 PF12974 Phosphonate-bd:  ABC t  94.9   0.084 1.8E-06   32.2   4.7   39    3-55     19-57  (243)
 30 TIGR01729 taurine_ABC_bnd taur  94.6   0.076 1.6E-06   33.4   4.0   37    7-57     21-57  (300)
 31 COG3221 PhnD ABC-type phosphat  94.0    0.15 3.3E-06   33.1   4.5   39    3-55     57-95  (299)
 32 cd05466 PBP2_LTTR_substrate Th  92.0     1.2 2.5E-05   24.4   5.8   23   35-57     36-58  (197)
 33 cd08430 PBP2_IlvY The C-termin  92.0    0.75 1.6E-05   25.8   5.1   39    2-55     17-56  (199)
 34 PF02879 PGM_PMM_II:  Phosphogl  91.6     1.3 2.7E-05   23.9   5.6   53    2-54     35-89  (104)
 35 cd08468 PBP2_Pa0477 The C-term  91.5    0.86 1.9E-05   26.0   5.0   39    3-56     18-57  (202)
 36 TIGR02122 TRAP_TAXI TRAP trans  91.3    0.62 1.3E-05   29.2   4.6   40    3-56     50-90  (320)
 37 cd08427 PBP2_LTTR_like_2 The C  91.0     1.2 2.5E-05   24.9   5.2   39    3-56     18-57  (195)
 38 PF03466 LysR_substrate:  LysR   90.7     1.7 3.7E-05   24.6   5.8   24   35-58     42-65  (209)
 39 cd08446 PBP2_Chlorocatechol Th  89.5     2.3 4.9E-05   23.9   5.6   22   35-56     37-58  (198)
 40 cd08448 PBP2_LTTR_aromatics_li  89.4     2.4 5.2E-05   23.5   5.7   38    3-55     18-56  (197)
 41 cd08456 PBP2_LysR The C-termin  88.9     2.7 5.9E-05   23.4   5.8   39    3-56     18-57  (196)
 42 PF09084 NMT1:  NMT1/THI5 like;  88.9     1.2 2.5E-05   26.4   4.2   34    9-56     17-50  (216)
 43 cd08486 PBP2_CbnR The C-termin  88.8     1.8 3.9E-05   24.7   4.9   21   35-55     37-57  (198)
 44 cd08429 PBP2_NhaR The C-termin  88.8       2 4.3E-05   24.9   5.1   22   35-56     36-57  (204)
 45 cd08451 PBP2_BudR The C-termin  88.5       2 4.3E-05   24.0   4.9   22   35-56     37-58  (199)
 46 cd08466 PBP2_LeuO The C-termin  88.2       2 4.4E-05   24.1   4.8   38    3-55     18-56  (200)
 47 cd08442 PBP2_YofA_SoxR_like Th  88.1     2.3 5.1E-05   23.6   5.0   38    3-55     18-56  (193)
 48 PF12916 DUF3834:  Protein of u  87.9    0.98 2.1E-05   28.1   3.5   39    3-55     83-121 (201)
 49 PF13379 NMT1_2:  NMT1-like fam  87.9     2.1 4.5E-05   26.3   5.0   34    7-54     29-62  (252)
 50 cd08419 PBP2_CbbR_RubisCO_like  87.8     3.2   7E-05   23.0   5.7   39    3-56     17-56  (197)
 51 cd08415 PBP2_LysR_opines_like   87.7     3.3 7.1E-05   23.0   5.7   22   35-56     36-57  (196)
 52 cd08413 PBP2_CysB_like The C-t  87.7     2.5 5.5E-05   24.0   5.0   22   35-56     36-57  (198)
 53 cd08459 PBP2_DntR_NahR_LinR_li  87.6     2.9 6.3E-05   23.5   5.2   22   35-56     36-57  (201)
 54 cd08420 PBP2_CysL_like C-termi  87.6     3.3 7.1E-05   22.9   5.8   40    3-57     18-58  (201)
 55 cd08434 PBP2_GltC_like The sub  87.4     3.3 7.2E-05   22.8   5.3   22   35-56     36-57  (195)
 56 cd08437 PBP2_MleR The substrat  87.2     2.9 6.2E-05   23.5   5.0   21   35-55     36-56  (198)
 57 cd08465 PBP2_ToxR The C-termin  87.1     2.6 5.7E-05   24.0   4.9   21   35-55     36-56  (200)
 58 PRK11480 tauA taurine transpor  87.0     1.4   3E-05   28.2   4.0   35    8-56     46-80  (320)
 59 cd08439 PBP2_LrhA_like The C-t  87.0     3.2   7E-05   23.2   5.2   21   35-55     36-56  (185)
 60 cd08418 PBP2_TdcA The C-termin  87.0     3.1 6.7E-05   23.2   5.1   22   35-56     36-57  (201)
 61 cd08421 PBP2_LTTR_like_1 The C  86.9     3.8 8.2E-05   22.9   5.6   39    3-56     18-57  (198)
 62 cd08440 PBP2_LTTR_like_4 TThe   86.8     3.7   8E-05   22.6   5.8   22   35-56     36-57  (197)
 63 cd08450 PBP2_HcaR The C-termin  86.8     3.8 8.3E-05   22.8   5.7   22   35-56     36-57  (196)
 64 cd08411 PBP2_OxyR The C-termin  86.7     3.3 7.1E-05   23.2   5.1   21   35-55     37-57  (200)
 65 cd08453 PBP2_IlvR The C-termin  86.6     3.4 7.3E-05   23.2   5.1   21   35-55     36-56  (200)
 66 cd03770 SR_TndX_transposase Se  86.5     4.2 9.1E-05   23.2   5.4   49    3-54     26-74  (140)
 67 cd08431 PBP2_HupR The C-termin  86.5     2.7 5.9E-05   23.5   4.7   38    3-55     18-56  (195)
 68 cd08425 PBP2_CynR The C-termin  86.4     4.1 8.8E-05   22.8   5.8   22   35-56     37-58  (197)
 69 cd08416 PBP2_MdcR The C-termin  86.3     3.4 7.3E-05   23.1   5.0   39    3-56     18-57  (199)
 70 cd08467 PBP2_SyrM The C-termin  86.3     2.5 5.5E-05   24.0   4.5   21   35-55     36-56  (200)
 71 cd08438 PBP2_CidR The C-termin  86.3     4.1 8.8E-05   22.6   5.6   22   35-56     36-57  (197)
 72 cd08449 PBP2_XapR The C-termin  86.0     3.6 7.8E-05   22.9   5.0   22   35-56     36-57  (197)
 73 cd08452 PBP2_AlsR The C-termin  85.9     3.7 7.9E-05   23.2   5.1   38    3-55     18-56  (197)
 74 cd08444 PBP2_Cbl The C-termina  85.8     3.7   8E-05   23.2   5.0   21   35-55     36-56  (198)
 75 cd08447 PBP2_LTTR_aromatics_li  84.8     4.4 9.6E-05   22.6   5.0   21   35-55     36-56  (198)
 76 cd08436 PBP2_LTTR_like_3 The C  84.7     4.3 9.4E-05   22.4   4.9   23   35-57     36-58  (194)
 77 cd08412 PBP2_PAO1_like The C-t  84.3     5.3 0.00011   22.2   5.2   38    3-55     18-56  (198)
 78 cd08417 PBP2_Nitroaromatics_li  84.3     4.9 0.00011   22.4   5.0   22   35-56     36-57  (200)
 79 cd08441 PBP2_MetR The C-termin  84.2     5.5 0.00012   22.3   5.5   21   35-55     36-56  (198)
 80 cd08463 PBP2_DntR_like_4 The C  84.1     4.5 9.7E-05   23.2   4.9   40    2-55     17-57  (203)
 81 TIGR01728 SsuA_fam ABC transpo  84.0     1.7 3.7E-05   26.5   3.2   22   36-57     38-59  (288)
 82 PF03401 TctC:  Tripartite tric  83.5     2.6 5.6E-05   26.7   3.9   39    4-56    122-160 (274)
 83 cd08423 PBP2_LTTR_like_6 The C  83.4     5.8 0.00013   22.0   5.2   38    3-55     18-56  (200)
 84 cd08461 PBP2_DntR_like_3 The C  83.2     6.1 0.00013   22.1   5.1   38    3-55     18-56  (198)
 85 cd08445 PBP2_BenM_CatM_CatR Th  83.0     6.5 0.00014   22.2   5.7   22   35-56     37-58  (203)
 86 cd08460 PBP2_DntR_like_1 The C  82.8     4.9 0.00011   22.7   4.7   20   35-55     36-55  (200)
 87 PRK03601 transcriptional regul  82.7     7.4 0.00016   24.1   5.7   22   35-56    125-146 (275)
 88 cd08464 PBP2_DntR_like_2 The C  82.4     4.5 9.8E-05   22.6   4.4   38    3-55     18-56  (200)
 89 cd08414 PBP2_LTTR_aromatics_li  82.4     6.2 0.00013   21.8   4.9   22   35-56     36-57  (197)
 90 cd08469 PBP2_PnbR The C-termin  82.3     5.9 0.00013   22.7   5.0   22   35-56     36-57  (221)
 91 PRK00072 hemC porphobilinogen   82.0     7.9 0.00017   25.4   5.8   51    4-56     23-81  (295)
 92 cd08485 PBP2_ClcR The C-termin  81.9     7.1 0.00015   22.1   5.1   21   35-55     37-57  (198)
 93 cd08443 PBP2_CysB The C-termin  81.8     6.6 0.00014   22.2   5.0   21   35-55     36-56  (198)
 94 smart00857 Resolvase Resolvase  81.8     7.1 0.00015   21.9   5.3   50    2-54     22-71  (148)
 95 cd03087 PGM_like1 This archaea  81.6     5.3 0.00011   26.8   5.0   52    3-54    179-231 (439)
 96 cd08462 PBP2_NodD The C-termin  80.8     6.5 0.00014   22.2   4.7   17   39-55     39-55  (200)
 97 cd08426 PBP2_LTTR_like_5 The C  80.1     8.2 0.00018   21.5   5.6   22   35-56     36-57  (199)
 98 cd08435 PBP2_GbpR The C-termin  79.4     8.5 0.00018   21.3   5.0   22   35-56     36-57  (201)
 99 cd08428 PBP2_IciA_ArgP The C-t  79.4     6.5 0.00014   22.0   4.4   21   35-55     35-55  (195)
100 PRK11242 DNA-binding transcrip  79.2      12 0.00026   23.0   5.8   23   35-57    127-149 (296)
101 PRK12683 transcriptional regul  79.0     8.6 0.00019   24.3   5.2   21   35-55    129-149 (309)
102 PRK01066 porphobilinogen deami  78.6      12 0.00025   23.9   5.5   51    4-56     36-94  (231)
103 PRK11553 alkanesulfonate trans  78.6     4.7  0.0001   25.5   3.9   20   36-55     65-84  (314)
104 PRK09508 leuO leucine transcri  78.6     8.1 0.00018   24.4   5.0   22   35-56    148-169 (314)
105 TIGR02136 ptsS_2 phosphate bin  78.3     3.2   7E-05   26.2   3.1   22   35-56     71-92  (287)
106 cd08433 PBP2_Nac The C-teminal  78.2     9.6 0.00021   21.2   5.1   21   36-56     37-57  (198)
107 cd00494 HMBS Hydroxymethylbila  77.8      12 0.00026   24.5   5.6   51    4-56     19-77  (292)
108 TIGR00212 hemC porphobilinogen  77.7      12 0.00026   24.5   5.6   51    4-56     19-77  (292)
109 PRK10341 DNA-binding transcrip  77.0      12 0.00026   23.5   5.4   22   35-56    133-154 (312)
110 PF03480 SBP_bac_7:  Bacterial   76.5      16 0.00035   22.9   6.1   46    3-57     18-63  (286)
111 TIGR03339 phn_lysR aminoethylp  76.1      15 0.00032   22.3   5.6   21   35-55    120-140 (279)
112 PRK11716 DNA-binding transcrip  75.9      12 0.00026   22.5   5.0   22   35-56    103-124 (269)
113 PRK12684 transcriptional regul  75.8      12 0.00025   23.7   5.1   21   35-55    129-149 (313)
114 cd08516 PBP2_NikA_DppA_OppA_li  75.8     9.5  0.0002   25.2   4.8   39    3-56    337-375 (457)
115 PRK11233 nitrogen assimilation  75.6      17 0.00037   22.8   5.8   21   35-55    128-148 (305)
116 PRK12680 transcriptional regul  74.4      13 0.00028   23.8   5.1   21   35-55    129-149 (327)
117 PRK07377 hypothetical protein;  74.3      10 0.00022   23.4   4.3   41    2-56     97-137 (184)
118 cd00338 Ser_Recombinase Serine  74.1      12 0.00027   20.5   5.3   50    3-54     22-71  (137)
119 PRK12681 cysB transcriptional   74.1      14 0.00029   23.7   5.1   21   35-55    129-149 (324)
120 PRK11151 DNA-binding transcrip  73.6      19 0.00042   22.4   5.8   22   35-56    127-148 (305)
121 PRK10837 putative DNA-binding   72.6      19 0.00042   22.0   5.7   21   35-55    125-145 (290)
122 PF04069 OpuAC:  Substrate bind  72.2      16 0.00034   22.6   5.0   40    3-56     19-58  (257)
123 PRK11917 bifunctional adhesin/  72.0      14  0.0003   22.9   4.7   21   36-56    181-201 (259)
124 cd08490 PBP2_NikA_DppA_OppA_li  72.0      13 0.00028   24.6   4.8   39    4-57    341-379 (470)
125 cd08457 PBP2_OccR The C-termin  71.8      15 0.00033   20.5   5.6   21   36-56     37-57  (196)
126 cd05800 PGM_like2 This PGM-lik  70.5      14  0.0003   25.0   4.7   53    2-54    187-240 (461)
127 PRK12682 transcriptional regul  70.1      17 0.00037   22.8   4.9   22   35-56    129-150 (309)
128 CHL00180 rbcR LysR transcripti  69.8      21 0.00045   22.3   5.2   21   35-55    131-151 (305)
129 cd08507 PBP2_SgrR_like The C-t  69.2      12 0.00026   25.0   4.2   40    3-57    316-355 (448)
130 COG1638 DctP TRAP-type C4-dica  68.9      22 0.00048   23.4   5.3   47    3-58     49-95  (332)
131 PRK11063 metQ DL-methionine tr  68.9      17 0.00036   23.2   4.6   36    4-53     49-85  (271)
132 TIGR00363 lipoprotein, YaeC fa  68.8      21 0.00045   22.7   5.0   31   10-54     43-73  (258)
133 TIGR01256 modA molybdenum ABC   68.5      22 0.00048   21.0   5.1   39    2-55     10-49  (216)
134 cd08512 PBP2_NikA_DppA_OppA_li  68.2      19 0.00042   23.9   5.0   38    4-56    354-391 (476)
135 cd08504 PBP2_OppA The substrat  68.2      16 0.00035   24.4   4.7   40    3-57    362-402 (498)
136 TIGR02424 TF_pcaQ pca operon t  68.2      25 0.00055   21.7   5.3   22   35-56    129-150 (300)
137 TIGR03414 ABC_choline_bnd chol  68.1      14 0.00029   23.7   4.1   38    3-55     26-63  (290)
138 cd06353 PBP1_BmpA_Med_like Per  68.0      18 0.00039   22.6   4.6   41    4-54     23-63  (258)
139 PRK09791 putative DNA-binding   67.7      22 0.00048   22.1   5.0   21   35-55    131-151 (302)
140 cd03089 PMM_PGM The phosphoman  67.2      19 0.00041   24.3   4.8   52    3-54    178-231 (443)
141 PRK09906 DNA-binding transcrip  66.6      28  0.0006   21.5   5.5   23   35-57    126-148 (296)
142 cd08498 PBP2_NikA_DppA_OppA_li  64.9      25 0.00054   23.6   5.0   38    4-56    351-388 (481)
143 COG2113 ProX ABC-type proline/  64.6      15 0.00032   24.1   3.8   39    3-56     49-87  (302)
144 PRK10918 phosphate ABC transpo  64.0      21 0.00044   23.7   4.5   25   35-60     62-86  (346)
145 COG0715 TauA ABC-type nitrate/  63.8      10 0.00022   24.0   2.9   31    9-53     56-87  (335)
146 cd08520 PBP2_NikA_DppA_OppA_li  63.6      26 0.00056   23.4   4.9   38    4-56    349-386 (468)
147 PRK10082 cell density-dependen  63.6      20 0.00043   22.4   4.2   22   35-56    134-155 (303)
148 PRK11482 putative DNA-binding   63.3      26 0.00057   22.3   4.8   22   36-57    152-173 (317)
149 PRK13348 chromosome replicatio  62.9      30 0.00065   21.4   4.9   22   35-56    125-146 (294)
150 cd08497 PBP2_NikA_DppA_OppA_li  62.8      28  0.0006   23.6   5.0   39    4-57    366-404 (491)
151 PRK12679 cbl transcriptional r  62.6      29 0.00062   22.0   4.8   22   35-56    129-150 (316)
152 cd08458 PBP2_NocR The C-termin  62.1      26 0.00056   19.6   5.6   22   35-56     36-57  (196)
153 cd08493 PBP2_DppA_like The sub  61.8      30 0.00066   23.1   5.0   39    4-57    359-397 (482)
154 cd08492 PBP2_NikA_DppA_OppA_li  61.4      25 0.00055   23.4   4.6   39    4-57    364-402 (484)
155 cd05799 PGM2 This CD includes   60.9      21 0.00045   24.4   4.2   52    2-54    200-258 (487)
156 cd08511 PBP2_NikA_DppA_OppA_li  60.6      41 0.00088   22.4   5.4   38    5-57    339-376 (467)
157 cd08489 PBP2_NikA The substrat  60.5      28  0.0006   23.3   4.7   34    5-53    355-388 (488)
158 PRK10094 DNA-binding transcrip  60.3      32 0.00069   21.7   4.8   19   36-54    130-148 (308)
159 PRK15092 DNA-binding transcrip  59.8      37  0.0008   21.6   5.0   20   36-55    136-155 (310)
160 PF00496 SBP_bac_5:  Bacterial   59.6      30 0.00066   22.0   4.6   39    4-57    314-353 (374)
161 PLN02371 phosphoglucosamine mu  59.1      22 0.00047   25.2   4.1   52    3-54    278-332 (583)
162 cd08499 PBP2_Ylib_like The sub  58.4      36 0.00079   22.7   4.9   38    4-56    338-376 (474)
163 TIGR03427 ABC_peri_uca ABC tra  58.0      32  0.0007   22.5   4.6   32    9-54     31-62  (328)
164 cd08494 PBP2_NikA_DppA_OppA_li  57.8      37  0.0008   22.4   4.8   37    5-56    336-373 (448)
165 cd08501 PBP2_Lpqw The substrat  57.4      27 0.00058   23.4   4.2   39    4-57    366-405 (486)
166 TIGR00975 3a0107s03 phosphate   56.5      31 0.00067   22.3   4.3   25   35-60     35-59  (314)
167 cd05803 PGM_like4 This PGM-lik  56.4      41  0.0009   22.7   5.0   51    3-54    188-239 (445)
168 PRK11119 proX glycine betaine   56.0      23 0.00049   23.3   3.6   38    3-55     47-85  (331)
169 PRK03635 chromosome replicatio  55.9      40 0.00086   21.0   4.6   19   37-55    127-145 (294)
170 PRK11074 putative DNA-binding   54.9      38 0.00082   21.1   4.4   21   35-55    128-148 (300)
171 TIGR03298 argP transcriptional  54.8      42 0.00092   20.7   4.6   18   38-55    128-145 (292)
172 COG0583 LysR Transcriptional r  54.4      46   0.001   20.1   5.0   21   37-57    128-148 (297)
173 PRK09542 manB phosphomannomuta  54.2      46   0.001   22.5   4.9   52    3-54    179-232 (445)
174 PRK15421 DNA-binding transcrip  53.4      56  0.0012   20.7   5.1   20   37-56    127-146 (317)
175 cd03084 phosphohexomutase The   53.0      55  0.0012   21.3   5.0   52    3-54    127-180 (355)
176 PRK06034 hypothetical protein;  52.9      20 0.00042   23.4   2.9   22   35-56    126-147 (279)
177 PLN02691 porphobilinogen deami  52.8      65  0.0014   21.8   5.3   22   35-56    102-124 (351)
178 TIGR02294 nickel_nikA nickel A  52.7      38 0.00083   22.9   4.4   35    4-53    362-396 (500)
179 COG1910 Periplasmic molybdate-  52.6      21 0.00045   22.7   2.9   20   35-55     26-45  (223)
180 PRK15414 phosphomannomutase Cp  52.4      46 0.00099   22.7   4.7   47    8-54    193-243 (456)
181 cd03085 PGM1 Phosphoglucomutas  51.9      39 0.00085   23.8   4.4   52    3-54    222-276 (548)
182 cd08502 PBP2_NikA_DppA_OppA_li  51.9      59  0.0013   21.8   5.1   39    5-58    353-393 (472)
183 cd08514 PBP2_AppA_like The sub  51.8      18 0.00038   24.2   2.7   36    3-53    358-393 (483)
184 cd00995 PBP2_NikA_DppA_OppA_li  51.6      58  0.0013   21.3   5.0   38    4-56    343-381 (466)
185 PRK11013 DNA-binding transcrip  51.6      58  0.0013   20.4   5.8   20   37-56    132-151 (309)
186 PRK14321 glmM phosphoglucosami  51.1      65  0.0014   21.9   5.3   50    3-54    180-231 (449)
187 PRK11062 nhaR transcriptional   50.6      58  0.0013   20.3   4.7   21   35-55    129-149 (296)
188 PTZ00150 phosphoglucomutase-2-  50.5      23  0.0005   25.0   3.1   52    3-54    243-301 (584)
189 COG3181 Uncharacterized protei  50.3      42  0.0009   22.4   4.1   40    4-57    166-205 (319)
190 PF06345 Drf_DAD:  DRF Autoregu  48.1      14 0.00031   13.5   1.0   13   37-49      3-15  (15)
191 cd08517 PBP2_NikA_DppA_OppA_li  48.0      78  0.0017   21.0   5.2   36    4-54    354-390 (480)
192 PF12849 PBP_like_2:  PBP super  47.9      42 0.00091   20.7   3.8   23   37-59     47-69  (281)
193 PRK09861 cytoplasmic membrane   47.6      52  0.0011   21.0   4.2   37    3-53     49-86  (272)
194 smart00094 TR_FER Transferrin.  47.4      64  0.0014   21.4   4.7   20   35-54     35-54  (332)
195 PF03480 SBP_bac_7:  Bacterial   47.0      56  0.0012   20.5   4.3   22   35-56    161-182 (286)
196 PRK11890 phosphate acetyltrans  46.6      40 0.00088   22.3   3.6   47    3-59     58-107 (312)
197 PF03180 Lipoprotein_9:  NLPA l  46.2      69  0.0015   20.2   4.5   37    3-53     16-52  (237)
198 COG3888 Predicted transcriptio  46.1      16 0.00035   24.1   1.7   20   37-56    111-130 (321)
199 cd08500 PBP2_NikA_DppA_OppA_li  45.8      68  0.0015   21.8   4.8   39    4-57    364-403 (499)
200 cd05805 MPG1_transferase GTP-m  45.7      77  0.0017   21.4   5.0   51    3-54    183-234 (441)
201 PF13531 SBP_bac_11:  Bacterial  44.9      66  0.0014   19.1   4.7   39    2-55     15-54  (230)
202 TIGR00787 dctP tripartite ATP-  44.6      75  0.0016   19.6   5.7   45    3-56     18-62  (257)
203 PRK14315 glmM phosphoglucosami  44.5      99  0.0021   21.0   5.6   50    3-54    191-241 (448)
204 PF11834 DUF3354:  Domain of un  44.2      38 0.00082   17.5   2.7   21    2-22     30-50  (69)
205 cd08505 PBP2_NikA_DppA_OppA_li  44.2      93   0.002   21.5   5.3   38    4-56    400-437 (528)
206 KOG0024|consensus               43.8      29 0.00062   23.5   2.6   19   34-52    301-319 (354)
207 PRK09986 DNA-binding transcrip  43.4      77  0.0017   19.4   4.5   18   37-54    135-152 (294)
208 PRK14317 glmM phosphoglucosami  43.3      89  0.0019   21.3   5.0   50    3-54    203-253 (465)
209 TIGR00067 glut_race glutamate   43.2      30 0.00065   21.8   2.6   53    3-56     13-69  (251)
210 PRK11899 prephenate dehydratas  42.6      24 0.00051   22.8   2.1   22   35-56     34-55  (279)
211 PRK15109 antimicrobial peptide  41.5   1E+02  0.0023   21.3   5.2   40    3-57    399-438 (547)
212 COG0077 PheA Prephenate dehydr  41.4      25 0.00055   22.9   2.1   22   35-56     33-54  (279)
213 COG1428 Deoxynucleoside kinase  41.2      28  0.0006   22.0   2.2   22    3-24     20-41  (216)
214 PRK09755 putative ABC transpor  41.1   1E+02  0.0022   21.3   5.0   32   11-57    404-435 (535)
215 cd08496 PBP2_NikA_DppA_OppA_li  41.0 1.1E+02  0.0023   20.4   5.1   40    4-58    334-374 (454)
216 KOG1879|consensus               40.6      32 0.00069   27.3   2.7   19    2-20   1227-1245(1470)
217 cd08432 PBP2_GcdR_TrpI_HvrB_Am  40.6      53  0.0012   17.9   3.2   16   40-55     38-53  (194)
218 cd08312 Death_MyD88 Death doma  40.5      14 0.00031   19.2   0.7   12    4-15     19-30  (79)
219 cd08311 Death_p75NR Death doma  39.8      15 0.00033   19.3   0.7   15    4-18     18-32  (77)
220 PF14503 YhfZ_C:  YhfZ C-termin  39.6      77  0.0017   20.2   4.0   29   12-55    136-164 (232)
221 PRK14316 glmM phosphoglucosami  39.4 1.2E+02  0.0026   20.5   5.5   50    3-54    188-238 (448)
222 PRK14320 glmM phosphoglucosami  37.8 1.1E+02  0.0024   20.7   4.8   50    3-54    187-237 (443)
223 PRK10116 universal stress prot  37.5      72  0.0016   17.4   5.0   21   35-55     89-109 (142)
224 PF00800 PDT:  Prephenate dehyd  36.9      34 0.00073   20.3   2.0   23   35-57     30-52  (181)
225 PRK14324 glmM phosphoglucosami  36.8 1.4E+02  0.0029   20.4   5.5   50    3-54    190-240 (446)
226 PRK09590 celB cellobiose phosp  36.8      76  0.0016   17.5   4.6   17    3-19     20-36  (104)
227 PF01784 NIF3:  NIF3 (NGG1p int  36.6 1.1E+02  0.0023   19.1   5.4   52    2-55    146-198 (241)
228 PRK14314 glmM phosphoglucosami  36.3 1.4E+02   0.003   20.3   5.4   50    3-54    192-242 (450)
229 PF13189 Cytidylate_kin2:  Cyti  36.3      31 0.00067   20.3   1.8   13    3-15     15-27  (179)
230 PF11761 CbiG_mid:  Cobalamin b  36.1      22 0.00048   18.3   1.0   14   35-48     19-32  (93)
231 cd08802 Death_UNC5B Death doma  35.9      19 0.00042   19.3   0.8   11    4-14     23-33  (84)
232 PF09568 RE_MjaI:  MjaI restric  35.7      22 0.00048   21.7   1.1   24    3-26     97-120 (170)
233 PRK15046 2-aminoethylphosphona  35.5 1.2E+02  0.0027   19.5   4.8   38    3-55     52-93  (349)
234 cd08513 PBP2_thermophilic_Hb8_  35.5 1.1E+02  0.0025   20.4   4.5   38    4-56    357-395 (482)
235 PRK14318 glmM phosphoglucosami  35.3 1.4E+02  0.0031   20.2   5.5   50    3-54    190-240 (448)
236 PRK10677 modA molybdate transp  35.2 1.1E+02  0.0025   19.0   5.0   38    3-55     44-82  (257)
237 PRK10216 DNA-binding transcrip  34.6 1.2E+02  0.0026   19.1   4.7   17   39-55    136-152 (319)
238 cd08506 PBP2_clavulanate_OppA2  34.4 1.4E+02  0.0031   19.9   4.9   38    4-56    338-378 (466)
239 cd08804 Death_ank2 Death domai  34.2      21 0.00045   18.9   0.8   15    4-18     18-32  (84)
240 COG1109 {ManB} Phosphomannomut  33.7 1.6E+02  0.0034   20.2   5.1   52    3-54    193-245 (464)
241 cd08803 Death_ank3 Death domai  33.5      21 0.00047   18.9   0.7   12    4-15     18-29  (84)
242 PF04509 CheC:  CheC-like famil  33.3      54  0.0012   14.7   2.5   17    4-20     18-34  (38)
243 PF01379 Porphobil_deam:  Porph  32.6      42 0.00092   21.1   2.0   22   35-56     56-78  (215)
244 cd08310 Death_NFkB-like Death   32.5      23  0.0005   18.2   0.7   13    4-16     15-27  (72)
245 PRK10622 pheA bifunctional cho  32.2      41 0.00089   22.7   2.0   22   35-56    137-158 (386)
246 COG1961 PinR Site-specific rec  32.0 1.2E+02  0.0026   18.3   5.1   47    2-53     22-68  (222)
247 PRK11898 prephenate dehydratas  31.8      44 0.00095   21.5   2.1   22   35-56     34-55  (283)
248 PRK15104 oligopeptide ABC tran  31.4 1.6E+02  0.0034   20.4   4.8   33    9-56    410-442 (543)
249 PF04914 DltD_C:  DltD C-termin  31.0      66  0.0014   18.5   2.5   20    2-21     39-58  (130)
250 PRK14498 putative molybdopteri  30.9 1.1E+02  0.0024   21.7   4.1   22   35-56    448-469 (633)
251 COG0283 Cmk Cytidylate kinase   30.5      40 0.00087   21.4   1.7   13    3-15     20-32  (222)
252 PF07833 Cu_amine_oxidN1:  Copp  30.4      53  0.0011   16.6   1.9   15    4-18      9-23  (93)
253 cd08777 Death_RIP1 Death Domai  29.5      39 0.00086   17.9   1.4   13    4-16     16-28  (86)
254 PF14399 Transpep_BrtH:  NlpC/p  29.4 1.4E+02  0.0031   18.7   4.1   44    2-55     53-96  (317)
255 PF11057 Cortexin:  Cortexin of  29.1      31 0.00068   18.4   0.9   20   35-54     62-81  (81)
256 PF05687 DUF822:  Plant protein  28.9      48   0.001   19.8   1.7   15    2-16     49-63  (150)
257 PF09862 DUF2089:  Protein of u  28.8      38 0.00082   19.2   1.2   47    4-50     52-104 (113)
258 PRK13626 transcriptional regul  28.1 1.8E+02   0.004   20.2   4.7   38    3-57    422-459 (552)
259 cd08318 Death_NMPP84 Death dom  27.9      44 0.00095   17.6   1.3   12    4-15     21-32  (86)
260 COG4143 TbpA ABC-type thiamine  27.6 1.2E+02  0.0026   20.5   3.6   42    3-54     46-87  (336)
261 PF13847 Methyltransf_31:  Meth  26.8      97  0.0021   17.3   2.8   39    2-56     42-81  (152)
262 PF01976 DUF116:  Protein of un  26.6 1.5E+02  0.0032   17.6   4.7   35    3-53     77-111 (158)
263 COG2358 Imp TRAP-type uncharac  26.5      94   0.002   20.7   2.9   38    3-54     46-84  (321)
264 PLN02307 phosphoglucomutase     26.4 1.7E+02  0.0036   21.0   4.3   29    3-31    239-270 (579)
265 PRK09501 potD spermidine/putre  25.7 1.9E+02  0.0041   18.6   5.1   39    2-54     41-82  (348)
266 COG1110 Reverse gyrase [DNA re  25.7 1.5E+02  0.0033   23.3   4.1   41    2-57    349-392 (1187)
267 cd08519 PBP2_NikA_DppA_OppA_li  25.6 2.1E+02  0.0046   19.1   4.9   22   35-56    364-385 (469)
268 TIGR01276 thiB thiamine ABC tr  25.5 1.8E+02  0.0039   18.2   5.0   38    3-54     22-63  (309)
269 cd08509 PBP2_TmCBP_oligosaccha  25.4 2.2E+02  0.0047   19.4   4.6   33    3-50    371-403 (509)
270 TIGR01254 sfuA ABC transporter  25.4 1.8E+02  0.0039   18.2   4.9   38    3-54     22-63  (304)
271 cd05802 GlmM GlmM is a bacteri  25.2 2.2E+02  0.0048   19.2   5.4   50    3-54    184-234 (434)
272 cd03088 ManB ManB is a bacteri  25.2 2.3E+02   0.005   19.3   5.1   51    3-54    180-231 (459)
273 TIGR00412 redox_disulf_2 small  25.2   1E+02  0.0022   15.4   2.9   19    3-21     19-37  (76)
274 PRK15118 universal stress glob  25.1 1.3E+02  0.0028   16.4   4.5   21   36-56     91-111 (144)
275 PRK15329 chaperone protein Sic  25.1      78  0.0017   18.7   2.1   16    2-17      6-21  (138)
276 PF00766 ETF_alpha:  Electron t  24.9      72  0.0016   17.2   1.8   19    1-19     23-41  (86)
277 COG0181 HemC Porphobilinogen d  24.9      53  0.0012   21.8   1.6   22   35-56     58-80  (307)
278 PF00035 dsrm:  Double-stranded  24.8      92   0.002   14.6   2.4   19    2-20      3-21  (67)
279 PF04111 APG6:  Autophagy prote  24.6      95  0.0021   20.4   2.7   17    3-19    181-200 (314)
280 PLN02317 arogenate dehydratase  24.6      68  0.0015   21.9   2.1   22   35-56    124-145 (382)
281 cd08317 Death_ank Death domain  24.6      55  0.0012   17.0   1.4   12    4-15     18-29  (84)
282 TIGR01455 glmM phosphoglucosam  24.4 2.3E+02   0.005   19.1   5.5   50    3-54    187-237 (443)
283 PRK10887 glmM phosphoglucosami  24.2 2.4E+02  0.0051   19.1   5.4   50    3-54    186-236 (443)
284 TIGR02706 P_butyryltrans phosp  24.1 2.1E+02  0.0045   18.5   4.5   17   40-56     79-95  (294)
285 PF09140 MipZ:  ATPase MipZ;  I  23.9      62  0.0013   21.1   1.7   17    2-18    195-211 (261)
286 PF06506 PrpR_N:  Propionate ca  23.7 1.7E+02  0.0036   17.2   4.1   43    4-57     92-134 (176)
287 TIGR00083 ribF riboflavin kina  23.5      64  0.0014   21.0   1.7   43    2-52    119-161 (288)
288 PF09379 FERM_N:  FERM N-termin  23.4      61  0.0013   16.1   1.4   13    2-14     21-33  (80)
289 TIGR00246 tRNA_RlmH_YbeA rRNA   22.8 1.3E+02  0.0028   17.7   2.8   13   48-60    114-128 (153)
290 PF04459 DUF512:  Protein of un  22.6   2E+02  0.0044   17.8   5.5   51    3-53    111-166 (204)
291 COG4002 Predicted phosphotrans  22.4      62  0.0013   20.7   1.4   33    9-54     37-69  (256)
292 cd08508 PBP2_NikA_DppA_OppA_li  22.3 2.5E+02  0.0055   18.8   5.5   17    4-20    345-361 (470)
293 PRK08190 bifunctional enoyl-Co  22.2 1.9E+02  0.0041   19.9   3.9   19   39-57    241-259 (466)
294 PRK04021 hypothetical protein;  22.1 1.2E+02  0.0026   16.4   2.4   17    2-18     50-66  (92)
295 PF02621 VitK2_biosynth:  Menaq  22.1 1.7E+02  0.0037   18.3   3.4   22   35-56     31-52  (251)
296 PRK10222 PTS system L-ascorbat  22.0 1.4E+02   0.003   15.7   3.5   16    4-19      7-22  (85)
297 cd08799 Death_UNC5C Death doma  21.9      60  0.0013   17.4   1.2   11    4-14     23-33  (84)
298 cd00560 PanC Pantoate-beta-ala  21.7      97  0.0021   20.1   2.3   18    2-19    156-173 (277)
299 PF13207 AAA_17:  AAA domain; P  21.7      84  0.0018   16.6   1.8   13    3-15     15-27  (121)
300 PF13369 Transglut_core2:  Tran  21.5 1.4E+02  0.0031   17.1   2.8   21    3-23     73-93  (152)
301 TIGR00251 conserved hypothetic  20.9 1.4E+02  0.0031   16.0   2.5   17    2-18     49-65  (87)
302 cd08478 PBP2_CrgA The C-termin  20.8      62  0.0013   17.9   1.2   14   43-56     44-57  (199)
303 PRK11205 tbpA thiamine transpo  20.7 2.4E+02  0.0052   17.9   5.1   39    2-54     42-84  (330)
304 PF12727 PBP_like:  PBP superfa  20.7 2.1E+02  0.0045   17.2   5.1   24   35-59     19-42  (193)
305 PF12953 DUF3842:  Domain of un  20.5      39 0.00085   19.8   0.3   53    3-58     16-74  (131)
306 PF11823 DUF3343:  Protein of u  20.2 1.3E+02  0.0028   15.0   2.2   20    4-23     17-36  (73)
307 cd08306 Death_FADD Fas-associa  20.2      76  0.0016   16.7   1.4   11    4-14     16-26  (86)
308 PF02310 B12-binding:  B12 bind  20.2 1.6E+02  0.0034   15.6   5.0   41    3-56     19-59  (121)
309 cd02065 B12-binding_like B12 b  20.2 1.6E+02  0.0034   15.6   4.3   42    3-57     18-59  (125)

No 1  
>KOG1053|consensus
Probab=99.71  E-value=8.7e-18  Score=118.30  Aligned_cols=58  Identities=33%  Similarity=0.808  Sum_probs=56.1

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      ||||++||+.++|+|+++.+.|++||.+..    |.|+||||+|..++|||||++++|++||
T Consensus       470 IDiLkKlA~~v~FtYDLYlVtnGKhGkk~n----g~WnGmIGev~~~rA~MAVgSltINeeR  527 (1258)
T KOG1053|consen  470 IDILKKLARDVKFTYDLYLVTNGKHGKKIN----GVWNGMIGEVVYQRADMAVGSLTINEER  527 (1258)
T ss_pred             HHHHHHHHhhcCcceEEEEecCCcccceec----CcchhhHHHHHhhhhheeeeeeEechhh
Confidence            799999999999999999999999999874    8999999999999999999999999998


No 2  
>PF10613 Lig_chan-Glu_bd:  Ligated ion channel L-glutamate- and glycine-binding site;  InterPro: IPR019594  This entry, sometimes called the S1 domain, is the luminal domain just upstream of the first, M1, transmembrane region of transmembrane ion-channel proteins, and binds L-glutamate and glycine [, ]. It is found in association with IPR001320 from INTERPRO. ; GO: 0004970 ionotropic glutamate receptor activity, 0005234 extracellular-glutamate-gated ion channel activity, 0016020 membrane; PDB: 4E0W_A 3S9E_A 3QXM_B 2F34_A 3C34_B 3S2V_A 3GBB_B 2F36_D 4E0X_A 1TXF_A ....
Probab=99.69  E-value=2e-17  Score=85.74  Aligned_cols=43  Identities=47%  Similarity=1.056  Sum_probs=36.6

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhc
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVT   46 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~   46 (62)
                      ||||++||+.+||+|+++.++|++||.+++   +|+|+||||+|++
T Consensus        23 iDll~~la~~l~F~y~i~~~~Dg~yG~~~~---~g~W~GmiGeli~   65 (65)
T PF10613_consen   23 IDLLEELAEELNFTYEIYLVPDGKYGSKNP---NGSWNGMIGELIR   65 (65)
T ss_dssp             HHHHHHHHHHHT-EEEEEE-TTS--EEBET---TSEBEHHHHHHHT
T ss_pred             HHHHHHHHHHcCCeEEEEECCCCCCcCcCC---CCcCcCHHHHhcC
Confidence            699999999999999999999999999998   4999999999974


No 3  
>KOG1054|consensus
Probab=99.66  E-value=6.9e-17  Score=110.71  Aligned_cols=60  Identities=38%  Similarity=0.788  Sum_probs=56.3

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      |||+.+|||+.+++|++.+++|++||.++++  +..|+||+|+|.+|+||+|++|+|||.+|
T Consensus       450 vdLa~~iAkhi~~~Y~l~iv~dgkyGardaD--~k~WnGMvGeLv~grAdiavApLTIt~~R  509 (897)
T KOG1054|consen  450 VDLAAEIAKHIGIKYKLFIVGDGKYGARDAD--TKIWNGMVGELVYGRADIAVAPLTITLVR  509 (897)
T ss_pred             HHHHHHHHHhcCceEEEEEecCCcccccCCC--cccccchhHHHhcCccceEEeeeeeehhh
Confidence            6999999999999999999999999999985  33499999999999999999999999987


No 4  
>KOG4440|consensus
Probab=99.47  E-value=5.5e-14  Score=97.17  Aligned_cols=62  Identities=39%  Similarity=0.839  Sum_probs=55.0

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceec-cC----CCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVR-EN----QKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~-~~----~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      ||||-.|++.+||+|+....+|+++|.+.. ++    ...+|+||||+|.+++|||+++++||++||
T Consensus       467 IDLLi~Ls~~~Nftyd~~l~~dg~fg~~~~vnnsseT~~kew~G~iGEL~~~~ADMivaplTINpER  533 (993)
T KOG4440|consen  467 IDLLIKLSRTMNFTYDVHLVADGKFGTQERVNNSSETNKKEWNGMIGELLSGQADMIVAPLTINPER  533 (993)
T ss_pred             HHHHHHHHHhhcceEEEEEeecccccceeeeecccccccceehhhhhhhhCCccceEeeceeeChhh
Confidence            699999999999999999999999997653 21    124699999999999999999999999998


No 5  
>KOG1052|consensus
Probab=99.29  E-value=3.7e-12  Score=87.33  Aligned_cols=57  Identities=35%  Similarity=0.800  Sum_probs=53.6

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++.+||+|+++.++++. |.++++   |.|+||+++|.+|++|++ ++++||++|
T Consensus       249 idll~~l~~~l~f~~~~~~~~~~~-g~~~~~---g~~~g~v~~l~~~~advg-~~~tit~~R  305 (656)
T KOG1052|consen  249 IDLLQALAKRLNFSYEIIFVPDGS-GSRDPN---GNWDGLVGQLVDGEADVG-ADITITPER  305 (656)
T ss_pred             ehHHHHHHHhCCCceEEEEcCCCC-CCCCCC---CChhHHHHHHhcCccccc-cceEEeecc
Confidence            689999999999999999999988 888873   899999999999999999 999999987


No 6  
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ. This predicted periplasmic protein, called MoxJ or MxaJ, is required for methanol oxidation in Methylobacterium extorquens. Two differing lines of evidence suggest two different roles. Forming one view, homology suggests it is the substrate-binding protein of an ABC transporter associated with methanol oxidation. The gene, furthermore, is found regular in genomes with, and only two or three genes away from, a corresponding permease and ATP-binding cassette gene pair. The other view is that this protein is an accessory factor or additional subunit of methanol dehydrogenase itself. Mutational studies show a dependence on this protein for expression of the PQQ-dependent, two-subunit methanol dehydrogenase (MxaF and MxaI) in Methylobacterium extorquens, as if it is a chaperone for enzyme assembly or a third subunit. A homologous N-terminal sequence was found in Paracoccus denitrificans as a 32Kd third subunit. This protein may, in 
Probab=98.65  E-value=3.4e-08  Score=60.88  Aligned_cols=46  Identities=9%  Similarity=0.060  Sum_probs=40.6

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHH---HhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVV---GDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~i---g~l~~g~~D~av~~ltit~eR   62 (62)
                      |||+++||+++|++++++.               ..|++++   ..|.+|++|+++ ++++|++|
T Consensus        23 vdl~~~ia~~lg~~~~~~~---------------~~~~~~~~~~~~L~~g~~Dii~-~~~~t~~r   71 (246)
T TIGR03870        23 NKIAAALAAAMGRKVVFVW---------------LAKPAIYLVRDGLDKKLCDVVL-GLDTGDPR   71 (246)
T ss_pred             HHHHHHHHHHhCCCeEEEE---------------eccchhhHHHHHHhcCCccEEE-eCCCChHH
Confidence            5899999999999999985               4698877   699999999988 58998876


No 7  
>PF00497 SBP_bac_3:  Bacterial extracellular solute-binding proteins, family 3;  InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins (ABC transporters; see IPR003439 from INTERPRO) and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into the cytoplasm. In Gram-positive bacteria which are surrounded by a single membrane and have therefore no periplasmic region, the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition, at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped [] into eight families or clusters, which generally correlate with the nature of the solute bound. Family 3 groups together specific amino acids and opine-binding periplasmic proteins and a periplasmic homologue with catalytic activity.; GO: 0005215 transporter activity, 0006810 transport, 0030288 outer membrane-bounded periplasmic space; PDB: 3N26_A 3QAX_A 3I6V_A 2VHA_B 2IA4_B 2Q89_A 2Q88_A 2YJP_C 1II5_A 1IIW_A ....
Probab=98.64  E-value=2.8e-08  Score=58.52  Aligned_cols=47  Identities=28%  Similarity=0.483  Sum_probs=42.0

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++++++++|++++++.               ..|+.++..|.+|++|+++++++.|++|
T Consensus        26 ~dl~~~i~~~~g~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~~~~r   72 (225)
T PF00497_consen   26 VDLLRAIAKRLGIKIEFVP---------------MPWSRLLEMLENGKADIIIGGLSITPER   72 (225)
T ss_dssp             HHHHHHHHHHHTCEEEEEE---------------EEGGGHHHHHHTTSSSEEESSEB-BHHH
T ss_pred             HHHHHHHHhhcccccceee---------------cccccccccccccccccccccccccccc
Confidence            4899999999999999986               2699999999999999999999988775


No 8  
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional
Probab=98.61  E-value=7.1e-08  Score=59.53  Aligned_cols=47  Identities=13%  Similarity=0.305  Sum_probs=43.4

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++++++++|.+++++.               ..|+.++.++.+|++|+++++++.|++|
T Consensus        53 vdi~~~ia~~lg~~i~~~~---------------~pw~~~~~~l~~g~~D~~~~~~~~t~eR   99 (259)
T PRK15437         53 IDLAKELCKRINTQCTFVE---------------NPLDALIPSLKAKKIDAIMSSLSITEKR   99 (259)
T ss_pred             HHHHHHHHHHcCCceEEEe---------------CCHHHHHHHHHCCCCCEEEecCCCCHHH
Confidence            5899999999999999985               4699999999999999999999999887


No 9  
>PRK10859 membrane-bound lytic transglycosylase F; Provisional
Probab=98.57  E-value=9.7e-08  Score=64.18  Aligned_cols=48  Identities=21%  Similarity=0.333  Sum_probs=43.9

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++++|++++++..              ..|+.++..|.+|++|++++++++|++|
T Consensus        68 ~DLl~~ia~~LGv~~e~v~~--------------~~~~~ll~aL~~G~iDi~~~~lt~T~eR  115 (482)
T PRK10859         68 YELAKRFADYLGVKLEIKVR--------------DNISQLFDALDKGKADLAAAGLTYTPER  115 (482)
T ss_pred             HHHHHHHHHHhCCcEEEEec--------------CCHHHHHHHHhCCCCCEEeccCcCChhh
Confidence            58999999999999999853              4799999999999999999999999987


No 10 
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed
Probab=98.56  E-value=1e-07  Score=58.32  Aligned_cols=47  Identities=28%  Similarity=0.556  Sum_probs=42.7

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++++|.+++++.               ..|.+++..|.+|++|+++++++.|++|
T Consensus        51 vdl~~~ia~~lg~~~~~~~---------------~~~~~~~~~l~~G~vDi~~~~~~~t~~R   97 (247)
T PRK09495         51 IDLWAAIAKELKLDYTLKP---------------MDFSGIIPALQTKNVDLALAGITITDER   97 (247)
T ss_pred             HHHHHHHHHHhCCceEEEe---------------CCHHHHHHHHhCCCcCEEEecCccCHHH
Confidence            5899999999999999975               3699999999999999999899988876


No 11 
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional
Probab=98.55  E-value=1.2e-07  Score=58.53  Aligned_cols=47  Identities=13%  Similarity=0.316  Sum_probs=43.1

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++++|.+++++.               ..|+.++.++..|++|+++++++.|++|
T Consensus        53 vdl~~~ia~~lg~~~~~~~---------------~~~~~~~~~l~~g~~Di~~~~~~~t~eR   99 (260)
T PRK15010         53 IDLGNEMCKRMQVKCTWVA---------------SDFDALIPSLKAKKIDAIISSLSITDKR   99 (260)
T ss_pred             HHHHHHHHHHhCCceEEEe---------------CCHHHHHHHHHCCCCCEEEecCcCCHHH
Confidence            5899999999999999985               3699999999999999999999999887


No 12 
>PRK15007 putative ABC transporter arginine-biding protein; Provisional
Probab=98.52  E-value=1.7e-07  Score=56.87  Aligned_cols=47  Identities=13%  Similarity=0.313  Sum_probs=42.6

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|++++|++++|++++++.               ..|+.++..+..|++|+++++++.+++|
T Consensus        48 ~dl~~~i~~~lg~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~~~~r   94 (243)
T PRK15007         48 VDLAQALCKEIDATCTFSN---------------QAFDSLIPSLKFRRVEAVMAGMDITPER   94 (243)
T ss_pred             HHHHHHHHHHhCCcEEEEe---------------CCHHHHhHHHhCCCcCEEEEcCccCHHH
Confidence            5899999999999999975               4699999999999999998888888876


No 13 
>PRK10797 glutamate and aspartate transporter subunit; Provisional
Probab=98.43  E-value=4.2e-07  Score=57.91  Aligned_cols=47  Identities=17%  Similarity=0.159  Sum_probs=38.3

Q ss_pred             ChHHHHHHH----HcC---CeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQ----ELE---FDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~----~l~---f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      ||++++|++    ++|   ++++++.               ..|..++..|..|++|++++++++|++|
T Consensus        67 idl~~~ia~~l~~~lg~~~~~~~~v~---------------~~~~~~i~~L~~G~~Di~~~~~~~t~eR  120 (302)
T PRK10797         67 QDYSNAIVEAVKKKLNKPDLQVKLIP---------------ITSQNRIPLLQNGTFDFECGSTTNNLER  120 (302)
T ss_pred             HHHHHHHHHHHHHhhCCCCceEEEEE---------------cChHhHHHHHHCCCccEEecCCccCcch
Confidence            476666665    554   6777775               4688899999999999999999999998


No 14 
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein.
Probab=98.37  E-value=7e-07  Score=54.21  Aligned_cols=47  Identities=15%  Similarity=0.374  Sum_probs=41.8

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++.+++.+|++++++.               ..|..++..|.+|++|+++++++.+++|
T Consensus        51 ~dl~~~i~~~lg~~~~~~~---------------~~~~~~~~~l~~G~~D~~~~~~~~~~~r   97 (250)
T TIGR01096        51 VDLAKALCKRMKAKCKFVE---------------QNFDGLIPSLKAKKVDAIMATMSITPKR   97 (250)
T ss_pred             HHHHHHHHHHhCCeEEEEe---------------CCHHHHHHHHhCCCcCEEEecCccCHHH
Confidence            5899999999999999975               4699999999999999998888877765


No 15 
>PRK11260 cystine transporter subunit; Provisional
Probab=98.34  E-value=8.6e-07  Score=54.88  Aligned_cols=47  Identities=21%  Similarity=0.444  Sum_probs=42.2

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++.|++++|.+++++.               ..|..++..|.+|++|+++++++.+++|
T Consensus        68 ~dl~~~i~~~lg~~~e~~~---------------~~~~~~~~~l~~G~~D~~~~~~~~~~~r  114 (266)
T PRK11260         68 VEFAEALAKHLGVKASLKP---------------TKWDGMLASLDSKRIDVVINQVTISDER  114 (266)
T ss_pred             HHHHHHHHHHHCCeEEEEe---------------CCHHHHHHHHhcCCCCEEEeccccCHHH
Confidence            5899999999999999986               3699999999999999999888888775


No 16 
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed
Probab=98.27  E-value=1.4e-06  Score=54.18  Aligned_cols=47  Identities=17%  Similarity=0.197  Sum_probs=38.8

Q ss_pred             ChHHHHHHHHc-CCe--EEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQEL-EFD--FHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l-~f~--~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++++ |..  ++++.               ..|...+..|.+|++|++++++++|++|
T Consensus        66 vdl~~~ia~~llg~~~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~t~eR  115 (259)
T PRK11917         66 IDVAKLLAKSILGDDKKIKLVA---------------VNAKTRGPLLDNGSVDAVIATFTITPER  115 (259)
T ss_pred             HHHHHHHHHHhcCCCccEEEEE---------------cChhhHHHHHHCCCccEEEecccCChhh
Confidence            58999999995 754  55543               3577788999999999999999999988


No 17 
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
Probab=98.22  E-value=2.1e-06  Score=62.05  Aligned_cols=48  Identities=17%  Similarity=0.232  Sum_probs=43.7

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++.|++.+|.+++++..              .+|+.++..|.+|++|++.+.++.|++|
T Consensus        84 ~D~l~~ia~~lG~~~e~v~~--------------~~~~~~l~~l~~g~iDl~~~~~~~~~~r  131 (1197)
T PRK09959         84 ADYLNLLKRALNIKLTLREY--------------ADHQKAMDALEEGEVDIVLSHLVASPPL  131 (1197)
T ss_pred             HHHHHHHHHhcCCceEEEeC--------------CCHHHHHHHHHcCCCcEecCcccccccc
Confidence            58999999999999999863              3799999999999999999989888876


No 18 
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein. Members of this family are the extracellular solute-binding proteins of ABC transporters that closely resemble amino acid transporters. The member from Sinorhizobium meliloti is involved in ectoine uptake, both for osmoprotection and for catabolism. All other members of the seed alignment are found associated with ectoine catabolic genes.
Probab=98.22  E-value=1.4e-06  Score=54.25  Aligned_cols=47  Identities=19%  Similarity=0.267  Sum_probs=41.1

Q ss_pred             ChHHHHHHHHcCCe-EEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFD-FHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~-~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +||++++++++|.+ +++..               ..|+.++..|..|++|++++++++|++|
T Consensus        59 ~dl~~~i~~~lg~~~~~~~~---------------~~w~~~~~~l~~G~~Di~~~~~~~t~eR  106 (275)
T TIGR02995        59 PDVARAIFKRLGIADVNASI---------------TEYGALIPGLQAGRFDAIAAGLFIKPER  106 (275)
T ss_pred             HHHHHHHHHHhCCCceeecc---------------CCHHHHHHHHHCCCcCEEeecccCCHHH
Confidence            58999999999997 56654               4799999999999999998889988876


No 19 
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms]
Probab=98.17  E-value=2.9e-06  Score=51.79  Aligned_cols=47  Identities=26%  Similarity=0.505  Sum_probs=40.9

Q ss_pred             ChHHHHHHHHcCCe--EEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFD--FHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~--~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++++++.++..  ++++.               ..|++++..|.+|++|++++.+++|++|
T Consensus        63 vdl~~~ia~~l~~~~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~t~er  111 (275)
T COG0834          63 VDLAKAIAKRLGGDKKVEFVP---------------VAWDGLIPALKAGKVDIIIAGMTITPER  111 (275)
T ss_pred             HHHHHHHHHHhCCcceeEEec---------------cchhhhhHHHhcCCcCEEEeccccCHHH
Confidence            68999999998886  45543               5799999999999999999999999865


No 20 
>TIGR02285 conserved hypothetical protein. Members of this family are found in several Proteobacteria, including Pseudomonas putida KT2440, Bdellovibrio bacteriovorus HD100 (three members), Aeromonas hydrophila, and Chromobacterium violaceum ATCC 12472. The function is unknown.
Probab=98.05  E-value=9.4e-06  Score=50.37  Aligned_cols=45  Identities=16%  Similarity=0.307  Sum_probs=39.6

Q ss_pred             hHHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           2 DLLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         2 dll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      ++++++++.+ ++++++..               ..|+.++..| .++.|.++.++++|+||
T Consensus        45 ~i~~~i~~~~~~~~~~~~~---------------~pw~r~l~~l-~~~~d~~~~~~~~t~eR   90 (268)
T TIGR02285        45 VILQEIRRALPQYEHRFVR---------------VSFARSLKEL-QGKGGVCTVNLLRTPER   90 (268)
T ss_pred             HHHHHHHHHcCCCceeEEE---------------CCHHHHHHHH-hcCCCeEEeeccCCcch
Confidence            6788999998 88888885               4799999999 78889888899999998


No 21 
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins. bacterial proteins, eukaryotic ones are in PBPe
Probab=97.69  E-value=8.3e-05  Score=42.51  Aligned_cols=45  Identities=20%  Similarity=0.387  Sum_probs=38.4

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCcccc
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSS   60 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~   60 (62)
                      +|+++.+.+++|+++++..               ..|..++..+.+|++|+++++...+.
T Consensus        27 ~~~~~~~~~~~g~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~~~   71 (219)
T smart00062       27 VDLAKAIAKELGLKVEFVE---------------VSFDNLLTALKSGKIDVVAAGMTITP   71 (219)
T ss_pred             HHHHHHHHHHhCCeEEEEe---------------ccHHHHHHHHHCCcccEEeccccCCH
Confidence            3689999999999999975               37999999999999999998765443


No 22 
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions. PBPs have two cell-membrane translocation functions: bind substrate, and interact with the membrane bound complex. A diverse group of periplasmic transport receptors for lysine/arginine/ornithine (LAO), glutamine, histidine, sulfate, phosphate, molybdate, and methanol are included in the PBPb CD.
Probab=97.68  E-value=0.0001  Score=42.28  Aligned_cols=45  Identities=24%  Similarity=0.508  Sum_probs=38.7

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSST   61 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~e   61 (62)
                      |+++.++++++.+++++.               ..|..++..|.+|++|+++++.+.+.+
T Consensus        27 ~~~~~~~~~~g~~~~~~~---------------~~~~~~~~~l~~g~~D~~~~~~~~~~~   71 (218)
T cd00134          27 DLAKAIAKELGVKVKFVE---------------VDWDGLITALKSGKVDLIAAGMTITPE   71 (218)
T ss_pred             HHHHHHHHHhCCeEEEEe---------------CCHHHHHHHHhcCCcCEEeecCcCCHH
Confidence            789999999999988886               359999999999999999987755544


No 23 
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein. This protein family, a sister family to TIGR03870, is found more broadly. It occurs a range of PQQ-biosynthesizing species, not just in known methanotrophs. Interpretation of evidence by homology and by direct experimental work suggest two different roles. By homology, this family appears to be the periplasmic substrate-binding protein of an ABC transport family. However, mutational studies and direct characterization for some sequences related to this family suggests this family may act as a maturation chaperone or additional subunit of a methanol dehydrogenase-like enzyme.
Probab=97.55  E-value=0.00022  Score=42.95  Aligned_cols=41  Identities=12%  Similarity=0.179  Sum_probs=32.5

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +||++++++++|.+++++..+             ..|.-++..|.+|++|++++
T Consensus        23 ~el~~~i~~~~g~~i~~~~~~-------------~~~~~~~~~l~~g~~Di~~~   63 (232)
T TIGR03871        23 NKIAQLLADDLGLPLEYTWFP-------------QRRGFVRNTLNAGRCDVVIG   63 (232)
T ss_pred             HHHHHHHHHHcCCceEEEecC-------------cchhhHHHHHhcCCccEEEe
Confidence            589999999999999998532             12443567899999999876


No 24 
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional
Probab=97.18  E-value=0.00073  Score=49.23  Aligned_cols=47  Identities=19%  Similarity=0.102  Sum_probs=38.6

Q ss_pred             ChHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           1 MDLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|++++|++++|++++++..              ..|..+...|.+|++|++. +++.|++|
T Consensus       329 ~Dll~~i~~~~g~~~~~v~~--------------~~~~~~~~~l~~g~~D~i~-~~~~t~~r  375 (1197)
T PRK09959        329 GDILNIITLQTGLNFSPITV--------------SHNIHAGTQLNPGGWDIIP-GAIYSEDR  375 (1197)
T ss_pred             HHHHHHHHHHHCCeEEEEec--------------CCHHHHHHHHHCCCceEee-cccCCccc
Confidence            58999999999999998863              3577788889999999864 55678776


No 25 
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein. A subset of this model in which nearly all members exhibit genomic context with elements of phosphonate metabolism, particularly the C-P lyase system has been built (TIGR03431) as an equivalog. Nevertheless, there are members of this subfamily (TIGR01098) which show up sporadically on a phylogenetic tree that also show phosphonate context and are most likely competent to transport phosphonates.
Probab=97.07  E-value=0.0018  Score=39.54  Aligned_cols=42  Identities=14%  Similarity=0.393  Sum_probs=36.2

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++.+.+++++|++++++..              .+|+.++..+.+|++|+++++..
T Consensus        53 ~l~~~l~~~~g~~v~~~~~--------------~~~~~~~~~l~~g~~Di~~~~~~   94 (254)
T TIGR01098        53 PLADYLEKKLGIKVQLFVA--------------TDYSAVIEAMRFGRVDIAWFGPS   94 (254)
T ss_pred             HHHHHHHHHhCCcEEEEeC--------------CCHHHHHHHHHcCCccEEEECcH
Confidence            5788999999999999753              47999999999999999997653


No 26 
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane]
Probab=96.81  E-value=0.0027  Score=42.96  Aligned_cols=47  Identities=23%  Similarity=0.321  Sum_probs=41.0

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      +|+++.|+.||.+.++...              ..-+.++.+|.+|++|++.+++...++|
T Consensus        49 elak~Fa~yLgV~Lki~~~--------------~n~dqLf~aL~ng~~DL~Aagl~~~~~~   95 (473)
T COG4623          49 ELAKAFADYLGVKLKIIPA--------------DNIDQLFDALDNGNADLAAAGLLYNSER   95 (473)
T ss_pred             HHHHHHHHHhCCeEEEEec--------------CCHHHHHHHHhCCCcceecccccCChhH
Confidence            6899999999999999863              3578999999999999999999877664


No 27 
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein. Note that this model does not identify all phnD-subfamily genes with evident phosphonate context, but all sequences above the trusted context may be inferred to bind phosphonate compounds even in the absence of such context. Furthermore, there is ample evidence to suggest that many other members of the TIGR01098 subfamily have a different primary function.
Probab=96.16  E-value=0.017  Score=36.16  Aligned_cols=40  Identities=15%  Similarity=0.427  Sum_probs=33.9

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+.+++++|.+++++..              ..|..++..|.+|++|+++.+.
T Consensus        49 l~~~l~~~~g~~v~~~~~--------------~~~~~~~~al~~g~~D~~~~~~   88 (288)
T TIGR03431        49 LADYLSKKLGVKVKLFFA--------------TDYAGVIEGMRFGKVDIAWYGP   88 (288)
T ss_pred             HHHHHHHHhCCcEEEEeC--------------CCHHHHHHHHHcCCccEEEECh
Confidence            567899999999997653              5799999999999999998653


No 28 
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed
Probab=95.81  E-value=0.0085  Score=38.16  Aligned_cols=28  Identities=7%  Similarity=0.153  Sum_probs=25.2

Q ss_pred             cchhhHHHhhhcCCccEEEeCCccccCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALSVSSTR   62 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~ltit~eR   62 (62)
                      ..|..++..|.+|++|+++++++++.||
T Consensus        51 ~~~~~i~~~L~sG~vDlgi~g~~~~~er   78 (287)
T PRK00489         51 LRPDDIPGYVADGVVDLGITGEDLLEES   78 (287)
T ss_pred             ECcHHHHHHHHcCCCCEEEcchHHHHHC
Confidence            5799999999999999999998887765


No 29 
>PF12974 Phosphonate-bd:  ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A.
Probab=94.88  E-value=0.084  Score=32.24  Aligned_cols=39  Identities=18%  Similarity=0.388  Sum_probs=30.8

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +.+.|++.+|.+++++..              ..+..++..+.+|++|++..+
T Consensus        19 l~~~L~~~~g~~v~~~~~--------------~~~~~~~~~l~~g~~D~~~~~   57 (243)
T PF12974_consen   19 LADYLSKQLGVPVELVPA--------------DDYAEFIEALRSGEIDLAFMG   57 (243)
T ss_dssp             HHHHHHHHHTSEEEEE----------------SSHHHHHHHHHTTS-SEEE--
T ss_pred             HHHHHHHHhCCCEEEEEc--------------CCHHHHHHHHHcCCccEEEEC
Confidence            678899999999999864              468999999999999999864


No 30 
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein. This model identifies a cluster of ABC transporter periplasmic substrate binding proteins, apparently specific for taurine. Transport systems for taurine (NH2-CH2-CH2-SO3H), sulfonates, and sulfate esters import sulfur when sulfate levels are low. The most closely related proteins outside this family are putative aliphatic sulfonate binding proteins (TIGR01728).
Probab=94.57  E-value=0.076  Score=33.41  Aligned_cols=37  Identities=16%  Similarity=0.138  Sum_probs=29.5

Q ss_pred             HHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           7 IAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         7 la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +++++|++++++..              ..+..++..|.+|++|+++.+.+
T Consensus        21 ~~k~~Gl~Ve~~~~--------------~~~~~~~~al~~G~iD~~~~~~~   57 (300)
T TIGR01729        21 AAKEAGATIDWRKF--------------DSGADISTALASGNVPIGVIGSS   57 (300)
T ss_pred             hHHhcCCeeEEEec--------------CcHHHHHHHHHcCCCCEeccCCC
Confidence            45678999998864              35788999999999999976543


No 31 
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=93.98  E-value=0.15  Score=33.14  Aligned_cols=39  Identities=15%  Similarity=0.451  Sum_probs=33.7

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      |.+.|.+.+|+.+++...              ....+++..+.+|++|+|..+
T Consensus        57 l~~~L~~~lG~~V~~~~a--------------~dy~~vieal~~g~~D~A~~~   95 (299)
T COG3221          57 LADYLEKELGIPVEFFVA--------------TDYAAVIEALRAGQVDIAWLG   95 (299)
T ss_pred             HHHHHHHHhCCceEEEec--------------ccHHHHHHHHhCCCeeEEecC
Confidence            578899999999999875              468999999999999987643


No 32 
>cd05466 PBP2_LTTR_substrate The substrate binding domain of LysR-type transcriptional regulators (LTTRs), a member of the type 2 periplasmic binding fold protein superfamily. This model and hierarchy represent the the substrate-binding domain of the LysR-type transcriptional regulators that form the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA bin
Probab=92.04  E-value=1.2  Score=24.38  Aligned_cols=23  Identities=17%  Similarity=0.313  Sum_probs=18.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCCc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ..+..++..|.+|++|+++....
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~~~   58 (197)
T cd05466          36 GGSSELLEALLEGELDLAIVALP   58 (197)
T ss_pred             CChHHHHHHHHcCCceEEEEcCC
Confidence            35668999999999999997654


No 33 
>cd08430 PBP2_IlvY The C-terminal substrate binding of LysR-type transcriptional regulator IlvY, which activates the expression of ilvC gene that encoding acetohydroxy acid isomeroreductase for the biosynthesis of branched amino acids; contains the type 2 periplasmic binding fold. In Escherichia coli, IlvY is required for the regulation of ilvC gene expression that encodes acetohydroxy acid isomeroreductase (AHIR), a key enzyme in the biosynthesis of branched-chain amino acids (isoleucine, valine, and leucine). The ilvGMEDA operon genes encode remaining enzyme activities required for the biosynthesis of these amino acids. Activation of ilvC transcription by IlvY requires the additional binding of a co-inducer molecule (either alpha-acetolactate or alpha-acetohydoxybutyrate, the substrates for AHIR) to a preformed complex of IlvY protein-DNA.  Like many other LysR-family members, IlvY negatively auto-regulates the transcription of its own divergently transcribed ilvY gene in an inducer-i
Probab=92.01  E-value=0.75  Score=25.75  Aligned_cols=39  Identities=18%  Similarity=0.337  Sum_probs=28.9

Q ss_pred             hHHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           2 DLLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      .++..+.++. +.+++++.               +.+..+...|.+|++|+++..
T Consensus        17 ~~l~~~~~~~P~v~l~~~~---------------~~~~~~~~~l~~g~~Dl~i~~   56 (199)
T cd08430          17 PILERFRAQHPQVEIKLHT---------------GDPADAIDKVLNGEADIAIAA   56 (199)
T ss_pred             HHHHHHHHHCCCceEEEEe---------------CCHHHHHHHHHCCCCCEEEEe
Confidence            3456666665 66777764               467788999999999999975


No 34 
>PF02879 PGM_PMM_II:  Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II;  InterPro: IPR005845 The alpha-D-phosphohexomutase superfamily is composed of four related enzymes, each of which catalyses a phosphoryl transfer on their sugar substrates: phosphoglucomutase (PGM), phosphoglucomutase/phosphomannomutase (PGM/PMM), phosphoglucosamine mutase (PNGM), and phosphoacetylglucosamine mutase (PAGM) []. PGM (5.4.2.2 from EC) converts D-glucose 1-phosphate into D-glucose 6-phosphate, and participates in both the breakdown and synthesis of glucose []. PGM/PMM (5.4.2.2 from EC; 5.4.2.8 from EC) are primarily bacterial enzymes that use either glucose or mannose as substrate, participating in the biosynthesis of a variety of carbohydrates such as lipopolysaccharides and alginate [, ]. Both PNGM (5.4.2.3 from EC) and PAGM (5.4.2.10 from EC) are involved in the biosynthesis of UDP-N-acetylglucosamine [, ].  Despite differences in substrate specificity, these enzymes share a similar catalytic mechanism, converting 1-phospho-sugars to 6-phospho-sugars via a biphosphorylated 1,6-phospho-sugar. The active enzyme is phosphorylated at a conserved serine residue and binds one magnesium ion; residues around the active site serine are well conserved among family members. The reaction mechanism involves phosphoryl transfer from the phosphoserine to the substrate to create a biophosphorylated sugar, followed by a phosphoryl transfer from the substrate back to the enzyme []. The structures of PGM and PGM/PMM have been determined, and were found to be very similar in topology. These enzymes are both composed of four domains and a large central active site cleft, where each domain contains residues essential for catalysis and/or substrate recognition. Domain I contains the catalytic phosphoserine, domain II contains a metal-binding loop to coordinate the magnesium ion, domain III contains the sugar-binding loop that recognises the two different binding orientations of the 1- and 6-phospho-sugars, and domain IV contains a phosphate-binding site required for orienting the incoming phospho-sugar substrate. This entry represents domain II found in alpha-D-phosphohexomutase enzymes. This domain has a 3-layer alpha/beta/alpha topology.; GO: 0016868 intramolecular transferase activity, phosphotransferases, 0005975 carbohydrate metabolic process; PDB: 2F7L_A 3PDK_B 1KFQ_B 1KFI_A 1C47_A 1VKL_B 1LXT_A 1JDY_B 3PMG_A 1C4G_B ....
Probab=91.61  E-value=1.3  Score=23.88  Aligned_cols=53  Identities=13%  Similarity=0.188  Sum_probs=37.3

Q ss_pred             hHHHHHHHHcCCeEEEE-EecCCcccc-eeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           2 DLLENIAQELEFDFHLY-IVADGLYGT-KVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~~~~~-~~~~~~~G~-~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      .++..|.+++|+.+... ..++..|+. ..|+.....+..+...+....+|++++
T Consensus        35 ~~~~~ll~~lg~~~~~~n~~~d~~f~~~~~p~p~~~~l~~~~~~v~~~~ad~g~~   89 (104)
T PF02879_consen   35 DILPRLLERLGCDVIELNCDPDPDFPNQHAPNPEEESLQRLIKIVRESGADLGIA   89 (104)
T ss_dssp             HHHHHHHHHTTCEEEEESSS-STTGTTTSTSSTSTTTTHHHHHHHHHSTTSEEEE
T ss_pred             HHHHHHHHHcCCcEEEEecccccccccccccccccchhHHHHHHhhccCceEEEE
Confidence            46788999999966443 456777865 444322256888888889999999874


No 35 
>cd08468 PBP2_Pa0477 The C-terminal substrate biniding domain of an uncharacterized LysR-like transcriptional regulator Pa0477 related to DntR, contains the type 2 periplasmic binding fold. LysR-type transcriptional regulator Pa0477 is related to DntR, which controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their spec
Probab=91.49  E-value=0.86  Score=25.97  Aligned_cols=39  Identities=10%  Similarity=0.167  Sum_probs=28.3

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.++. +.+++++.               +..+.++..|.+|++|+++...
T Consensus        18 ~l~~~~~~~P~v~i~~~~---------------~~~~~~~~~l~~g~~Dl~i~~~   57 (202)
T cd08468          18 LMARLEELAPSVRLNLVH---------------AEQKLPLDALLAGEIDFALGYS   57 (202)
T ss_pred             HHHHHHhhCCCCEEEEEE---------------CChHhHHHHHHCCCccEEEecc
Confidence            455665554 55666653               4678899999999999998643


No 36 
>TIGR02122 TRAP_TAXI TRAP transporter solute receptor, TAXI family. This family is one of at least three major families of extracytoplasmic solute receptor (ESR) for TRAP (Tripartite ATP-independent Periplasmic Transporter) transporters. The others are the DctP (TIGR00787) and SmoM (pfam03480) families. These transporters are secondary (driven by an ion gradient) but composed of three polypeptides, although in some species the 4-TM and 12-TM integral membrane proteins are fused. Substrates for this transporter family are not fully characterized but, besides C4 dicarboxylates, may include mannitol and other compounds.
Probab=91.26  E-value=0.62  Score=29.18  Aligned_cols=40  Identities=13%  Similarity=0.081  Sum_probs=29.0

Q ss_pred             HHHHHHHHcC-CeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELE-FDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~-f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+.+++.++ ++++++..              +.....+..|.+|++|+++...
T Consensus        50 la~~~~~~~~~i~v~~~~~--------------~~~~~~~~~l~~G~~D~~~~~~   90 (320)
T TIGR02122        50 IAQLINKKSGKLRVRVQST--------------GGSVENVNLLEAGEADLAIVQS   90 (320)
T ss_pred             HHHHHhccCCCeeEEEEeC--------------cchHHHHHHHhCCCCcEEEEcc
Confidence            4566666666 77777641              3455788999999999998764


No 37 
>cd08427 PBP2_LTTR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=90.96  E-value=1.2  Score=24.88  Aligned_cols=39  Identities=8%  Similarity=0.167  Sum_probs=27.5

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.+.. +.++++..               +..+.+...|.+|++|+++..-
T Consensus        18 ~l~~~~~~~P~i~l~~~~---------------~~~~~~~~~l~~g~~Dl~i~~~   57 (195)
T cd08427          18 ALARLRRRHPDLEVHIVP---------------GLSAELLARVDAGELDAAIVVE   57 (195)
T ss_pred             HHHHHHHHCCCceEEEEe---------------CCcHHHHHHHHCCCCCEEEEcC
Confidence            444554444 56666653               4578899999999999999753


No 38 
>PF03466 LysR_substrate:  LysR substrate binding domain;  InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins []. This domain is found in members of the LysR family of prokaryotic transcriptional regulatory proteins IPR000847 from INTERPRO which share sequence similarities over approximately 280 residues including a putative helix-turn-helix DNA-binding motif at their N terminus.; PDB: 3ONM_B 3FZJ_J 3FXR_B 3N6T_A 3FXQ_A 3FXU_A 3N6U_A 2QSX_B 3HO7_B 1IZ1_B ....
Probab=90.68  E-value=1.7  Score=24.58  Aligned_cols=24  Identities=8%  Similarity=0.128  Sum_probs=20.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCCcc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALSV   58 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lti   58 (62)
                      +....++..|.+|++|+++.....
T Consensus        42 ~~~~~~~~~l~~g~~Dl~i~~~~~   65 (209)
T PF03466_consen   42 GDSDELIEALRSGELDLAITFGPP   65 (209)
T ss_dssp             ESHHHHHHHHHTTSSSEEEESSSS
T ss_pred             ccchhhhHHHhcccccEEEEEeec
Confidence            456899999999999999987654


No 39 
>cd08446 PBP2_Chlorocatechol The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of LysR-type regulators CbnR, ClcR and TfdR, which are involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR.   In soil bacterium Pseudomonas putida, the 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR for activation. TfdR is involved in the activation of tf
Probab=89.48  E-value=2.3  Score=23.85  Aligned_cols=22  Identities=18%  Similarity=0.327  Sum_probs=18.6

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+..+...|.+|++|+++...
T Consensus        37 ~~~~~~~~~l~~~~~Dl~i~~~   58 (198)
T cd08446          37 MTKDEQIEALRAGRIHIGFGRF   58 (198)
T ss_pred             CCHHHHHHHHHCCCccEEEEec
Confidence            5678899999999999999643


No 40 
>cd08448 PBP2_LTTR_aromatics_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=89.42  E-value=2.4  Score=23.54  Aligned_cols=38  Identities=16%  Similarity=0.230  Sum_probs=27.7

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.+++++.               +....+...|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~i~i~i~~---------------~~~~~~~~~l~~~~~Di~i~~   56 (197)
T cd08448          18 ILRAFRAEYPGIEVALHE---------------MSSAEQIEALLRGELDLGFVH   56 (197)
T ss_pred             HHHHHHHHCCCCeEEEEe---------------CCHHHHHHHHHcCCcceEEEe
Confidence            455555544 66666653               467889999999999999864


No 41 
>cd08456 PBP2_LysR The C-terminal substrate binding domain of LysR, transcriptional regulator for lysine biosynthesis, contains the type 2 periplasmic binding fold. LysR, the transcriptional activator of lysA encoding diaminopimelate decarboxylase, catalyses the decarboxylation of diaminopimelate to produce lysine. The LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational
Probab=88.89  E-value=2.7  Score=23.43  Aligned_cols=39  Identities=8%  Similarity=0.053  Sum_probs=26.9

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.+.. +.++++..               +....+...|.+|++|+++...
T Consensus        18 ~l~~~~~~~P~i~~~i~~---------------~~~~~~~~~l~~g~~Dl~i~~~   57 (196)
T cd08456          18 AIKAFLQRHPDVTISIHT---------------RDSPTVEQWLSAQQCDLGLVST   57 (196)
T ss_pred             HHHHHHHHCCCcEEEEEe---------------CCHHHHHHHHHcCCccEEEEec
Confidence            344555544 56666653               4566788999999999999643


No 42 
>PF09084 NMT1:  NMT1/THI5 like;  InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins. These proteins are proposed to be required for the biosynthesis of the pyrimidine moiety of thiamine [, , ]. They are regulated by thiamine []. ; PDB: 2X26_A 3E4R_A 3KSJ_A 3KSX_A 3UIF_A 4DDD_A 1US4_A 1US5_A 3IX1_B 2X7P_A ....
Probab=88.89  E-value=1.2  Score=26.43  Aligned_cols=34  Identities=21%  Similarity=0.301  Sum_probs=27.7

Q ss_pred             HHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           9 QELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         9 ~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++.|++++++..              ......+..|.+|++|++++..
T Consensus        17 ~~~gl~ve~~~~--------------~~~~~~~~~l~~G~~D~~~~~~   50 (216)
T PF09084_consen   17 KEEGLDVEIVFF--------------GGGGDVLEALASGKADIAVAGP   50 (216)
T ss_dssp             HHTTEEEEEEEE--------------SSHHHHHHHHHTTSHSEEEEEC
T ss_pred             ccCeEEEEEEEe--------------cChhHHHHHHhcCCceEEeccc
Confidence            456788888864              4578899999999999998765


No 43 
>cd08486 PBP2_CbnR The C-terminal substrate binding domain of LysR-type transcriptional regulator, CbnR, involved in the chlorocatechol catabolism, contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of LysR-type regulator CbnR which is involved in the regulation of chlorocatechol breakdown. The chlorocatechol-degradative pathway is often found in bacteria that can use chlorinated aromatic compounds as carbon and energy sources. CbnR is found in the 3-chlorobenzoate degradative bacterium Ralstonia eutropha NH9 and forms a tetramer. CbnR activates the expression of the cbnABCD genes, which are responsible for the degradation of chlorocatechol converted from 3-chlorobenzoate and are transcribed divergently from cbnR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccha
Probab=88.85  E-value=1.8  Score=24.69  Aligned_cols=21  Identities=29%  Similarity=0.420  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.+...|.+|++|+++..
T Consensus        37 ~~~~~l~~~l~~g~~D~~~~~   57 (198)
T cd08486          37 MTKDEQVEGLLAGTIHVGFSR   57 (198)
T ss_pred             CCHHHHHHHHHcCCceEEEec
Confidence            568899999999999999964


No 44 
>cd08429 PBP2_NhaR The C-terminal substrate binding domain of LysR-type transcriptional activator of the nhaA gene, encoding Na+/H+ antiporter, contains the type 2 periplasmic binding fold. NhaR is a positive regulator of the LysR family and is known to be an activator of the nhaA gene encoding a Na(+)/H(+) antiporter. In Escherichia coli, NhaA is the vital antiporter that protects against high sodium stress, and it is essential for growth in high sodium levels, while NhaB becomes essential only if NhaA is not available. The nhaA gene of nhaAR operon is induced by monovalent cations. The nhaR of the operon activates nhaAR, as well as the osmC transcription which is induced at elevated osmolarity. OsmC is transcribed from the two overlapping promoters (osmCp1 and osmP2) and that NhaR is shown to activate only the expression of osmCp1. NhaR also activates the transcription of the pgaABCD operon which is required for production of the biofilm adhesion, poly-beta-1,6-N-acetyl-d-glucosamine 
Probab=88.78  E-value=2  Score=24.93  Aligned_cols=22  Identities=23%  Similarity=0.258  Sum_probs=19.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+..++..|.+|++|+++...
T Consensus        36 ~~~~~~~~~L~~~~~D~~i~~~   57 (204)
T cd08429          36 GKLEQLLADLALHRLDMVLADR   57 (204)
T ss_pred             CCHHHHHHHHHcCCccEEEecC
Confidence            6788999999999999999644


No 45 
>cd08451 PBP2_BudR The C-terminal substrate binding domain of LysR-type transcrptional regulator BudR, which is responsible for activation of the expression of the butanediol operon genes; contains the type 2 periplasmic binding fold. This CD represents the substrate binding domain of BudR regulator, which is responsible for induction of the butanediol formation pathway under fermentative growth conditions. Three enzymes are involved in the production of 1 mol of 2,3 butanediol from the condensation of 2 mol of pyruvate with acetolactate and acetoin as intermediates: acetolactate synthetase, acetolactate decarboxylase, and acetoin reductase. In Klebsiella terrigena, BudR regulates the expression of the budABC operon genes, encoding these three enzymes of the butanediol pathway. In many bacterial species, the use of this pathway can prevent intracellular acidification by diverting metabolism from acid production to the formation of neutral compounds (acetoin and butanediol). This substra
Probab=88.51  E-value=2  Score=24.00  Aligned_cols=22  Identities=14%  Similarity=0.161  Sum_probs=18.4

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..+.+...|.+|++|+++...
T Consensus        37 ~~~~~~~~~l~~g~~Dl~i~~~   58 (199)
T cd08451          37 ANTAELLEALREGRLDAAFVRP   58 (199)
T ss_pred             CChHHHHHHHHCCCccEEEEec
Confidence            4567889999999999999754


No 46 
>cd08466 PBP2_LeuO The C-terminal substrate binding domain of LysR-type transcriptional regulator LeuO, an activator of  leucine synthesis operon, contains the type 2 periplasmic binding fold. LeuO, a LysR-type transcriptional regulator, was originally identified as an activator of the leucine synthesis operon (leuABCD). Subsequently, LeuO was found to be not a specific regulator of the leu gene but a global regulator of unrelated various genes. LeuO activates bglGFB (utilization of beta-D-glucoside) and represses cadCBA (lysine decarboxylation) and dsrA (encoding a regulatory small RNA for translational control of rpoS and hns). LeuO also regulates the yjjQ-bglJ operon which coding for a LuxR-type transcription factor. In Salmonella enterica serovar Typhi, LeuO is a positive regulator of ompS1 (encoding an outer membrane), ompS2 (encoding a pathogenicity determinant), and assT, while LeuO represses the expression of OmpX and Tpx. Both osmS1 and osmS2 influence virulence in the mouse mo
Probab=88.20  E-value=2  Score=24.08  Aligned_cols=38  Identities=13%  Similarity=0.095  Sum_probs=26.7

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.++. +.+++++.               +....+...|.+|++|+++..
T Consensus        18 ~l~~f~~~~P~v~l~~~~---------------~~~~~~~~~l~~g~~Dl~i~~   56 (200)
T cd08466          18 LLARLKQLAPNISLRESP---------------SSEEDLFEDLRLQEVDLVIDY   56 (200)
T ss_pred             HHHHHHHHCCCCEEEEec---------------CchHhHHHHHHcCCccEEEec
Confidence            344454443 56666653               456788999999999999864


No 47 
>cd08442 PBP2_YofA_SoxR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators, YofA and SoxR, contains the type 2 periplasmic binding fold. YofA is a LysR-like transcriptional regulator of cell growth in Bacillus subtillis. YofA controls cell viability and the formation of constrictions during cell division. YofaA positively regulates expression of the cell division gene ftsW, and thus is essential for cell viability during stationary-phase growth of Bacillus substilis. YofA shows significant homology to SoxR from Arthrobacter sp. TE1826. SoxR is a negative regulator for the sarcosine oxidase gene soxA. Sarcosine oxidase catalyzes the oxidative demethylation of sarcosine, which is involved in the metabolism of creatine and choline. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides
Probab=88.15  E-value=2.3  Score=23.56  Aligned_cols=38  Identities=18%  Similarity=0.292  Sum_probs=27.1

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.+++++.               +....+...|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~i~l~i~~---------------~~~~~~~~~l~~g~~Dl~i~~   56 (193)
T cd08442          18 LLAAYHARYPKVDLSLST---------------GTTGALIQAVLEGRLDGAFVA   56 (193)
T ss_pred             HHHHHHHHCCCceEEEEe---------------CCcHHHHHHHHCCCccEEEEe
Confidence            445555443 56667663               456789999999999999864


No 48 
>PF12916 DUF3834:  Protein of unknown function (DUF3834);  InterPro: IPR024533 This family is likely to be related to solute-binding lipo-proteins.; PDB: 3MST_A.
Probab=87.93  E-value=0.98  Score=28.09  Aligned_cols=39  Identities=13%  Similarity=0.130  Sum_probs=26.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +++.+.+.-|.+.++++.              ..|..++.++..|++|-|+-+
T Consensus        83 l~Ral~d~~~~~~EvVyt--------------dD~~~i~~Ml~~g~vdsAVv~  121 (201)
T PF12916_consen   83 LTRALLDLKGIKAEVVYT--------------DDMSEIVKMLNEGEVDSAVVG  121 (201)
T ss_dssp             HHHHHHHHH--T-EEEE-----------------HHHHHHHHHTT-E--EEEE
T ss_pred             HHHHHHhhccccceeEEe--------------cCHHHHHHHHhcCceeeeeec
Confidence            467778888999999984              479999999999999988865


No 49 
>PF13379 NMT1_2:  NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A.
Probab=87.88  E-value=2.1  Score=26.31  Aligned_cols=34  Identities=12%  Similarity=0.240  Sum_probs=28.8

Q ss_pred             HHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           7 IAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         7 la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +.++.|++++++..              .++..++..|.+|++|++..
T Consensus        29 ~f~~~G~~ve~~~~--------------~~g~~~~~al~~G~iD~a~~   62 (252)
T PF13379_consen   29 LFEKEGLDVEWVQF--------------ASGADILEALAAGEIDIAFV   62 (252)
T ss_dssp             HHHHTTSCEEEEEE--------------SSHHHHHHHHHCTSSSEEEE
T ss_pred             hHHHcCCEEEEEEc--------------CCHHHHHHHHHcCCCCEEEe
Confidence            55677999988864              46899999999999999987


No 50 
>cd08419 PBP2_CbbR_RubisCO_like The C-terminal substrate binding of LysR-type transcriptional regulator (CbbR) of RubisCO operon, which is involved in the carbon dioxide fixation, contains the type 2 periplasmic binding fold. CbbR, a LysR-type transcriptional regulator, is required to activate expression of RubisCO, one of two unique enzymes in the Calvin-Benson-Bassham (CBB) cycle pathway. All plants, cyanobacteria, and many autotrophic bacteria use the CBB cycle to fix carbon dioxide. Thus, this cycle plays an essential role in assimilating CO2 into organic carbon on earth. The key CBB cycle enzyme is ribulose 1,5-bisphosphate carboxylase/oxygenase (RubisCO), which catalyzes the actual CO2 fixation reaction. The CO2 concentration affects the expression of RubisCO genes.  It has also shown that NADPH enhances the DNA-binding ability of the CbbR. RubisCO is composed of eight large (CbbL) and eight small subunits (CbbS).  The topology of this substrate-binding domain is most similar to t
Probab=87.82  E-value=3.2  Score=23.01  Aligned_cols=39  Identities=13%  Similarity=0.223  Sum_probs=27.1

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.+.. +.++++..               +....+...|.+|++|+++...
T Consensus        17 ~l~~~~~~~P~i~l~i~~---------------~~~~~~~~~l~~g~~Dl~i~~~   56 (197)
T cd08419          17 LLGAFCRRHPGVEVSLRV---------------GNREQVLERLADNEDDLAIMGR   56 (197)
T ss_pred             HHHHHHHHCCCceEEEEE---------------CCHHHHHHHHhcCCccEEEecC
Confidence            445555543 56666653               4567788999999999998654


No 51 
>cd08415 PBP2_LysR_opines_like The C-terminal substrate-domain of LysR-type transcriptional regulators involved in the catabolism of opines and that of related regulators, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulators, OccR and NocR, involved in the catabolism of opines and that of LysR for lysine biosynthesis which clustered together in phylogenetic trees. Opines, such as octopine and nopaline, are low molecular weight compounds found in plant crown gall tumors that are produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. NocR and OccR belong to the family of LysR-type transcriptional regulators that positively regulates the catabolism of nopaline and octopine, respectively. Both nopaline and octopalin are arginine derivatives. In Agrobacterium tumefa
Probab=87.74  E-value=3.3  Score=23.02  Aligned_cols=22  Identities=27%  Similarity=0.388  Sum_probs=18.4

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (196)
T cd08415          36 LSSSTVVEAVLSGQADLGLASL   57 (196)
T ss_pred             cchHHHHHHHHcCCccEEEEeC
Confidence            4567899999999999999754


No 52 
>cd08413 PBP2_CysB_like The C-terminal substrate domain of LysR-type transcriptional regulators CysB-like contains type 2 periplasmic binding fold. CysB is a transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the regulation of transcription in response to sulfur source is attributed to two transcriptional regulators, CysB and Cbl. CysB, in association with Cbl, downregulates the expression of ssuEADCB operon which is required for the utilization of sulfur from aliphatic sulfonates, in the presence of cysteine. Also, Cbl and CysB together directly function as transcriptional activators of tauABCD genes, which are required for utilization of taurine as sulfur source for growth. Like many other members of the LTTR family, CysB is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-bi
Probab=87.73  E-value=2.5  Score=23.96  Aligned_cols=22  Identities=14%  Similarity=0.188  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+..+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~~   57 (198)
T cd08413          36 GTPSQIAEMVLKGEADIAIATE   57 (198)
T ss_pred             CCHHHHHHHHHcCCCCEEEEcc
Confidence            4677899999999999999743


No 53 
>cd08459 PBP2_DntR_NahR_LinR_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that are involved in the catabolism of dinitrotoluene, naphthalene and gamma-hexachlorohexane; contains the type 2 periplasmic binding fold. This CD includes LysR-like bacterial transcriptional regulators, DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  DntR from Burkholderia species controls genes encoding enzymes for oxidative degradation of the nitro-aromatic compound 2,4-dinitrotoluene. The active form of DntR is homotetrameric, consisting of a dimer of dimers. NahR is a salicylate-dependent transcription activator of the nah and sal operons for naphthalene degradation.  Salicylic acid is an intermediate o
Probab=87.65  E-value=2.9  Score=23.52  Aligned_cols=22  Identities=14%  Similarity=0.152  Sum_probs=18.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..+.+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~~   57 (201)
T cd08459          36 LPVDELEEALESGEIDLAIGYL   57 (201)
T ss_pred             cCccCHHHHhhCCCceEEEEcC
Confidence            4566788999999999999754


No 54 
>cd08420 PBP2_CysL_like C-terminal substrate binding domain of LysR-type transcriptional regulator CysL, which activates the transcription of the cysJI operon encoding sulfite reductase, contains the type 2 periplasmic binding fold. CysL, also known as YwfK, is a regular of sulfur metabolism in Bacillus subtilis. Sulfur is required for the synthesis of proteins and essential cofactors in all living organism. Sulfur can be assimilated either from inorganic sources (sulfate and thiosulfate), or from organic sources (sulfate esters, sulfamates, and sulfonates). CysL activates the transcription of the cysJI operon encoding sulfite reductase, which reduces sulfite to sulfide. Both cysL mutant and cysJI mutant are unable to grow using sulfate or sulfite as the sulfur source. Like other LysR-type regulators, CysL also negatively regulates its own transcription. In Escherichia coli, three LysR-type activators are involved in the regulation of sulfur metabolism: CysB, Cbl and MetR.  The topology
Probab=87.61  E-value=3.3  Score=22.92  Aligned_cols=40  Identities=15%  Similarity=0.257  Sum_probs=27.0

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++..+.+.. ++++++..               +.-..+...|.+|++|+++....
T Consensus        18 ~l~~~~~~~P~~~l~~~~---------------~~~~~~~~~l~~g~~D~~i~~~~   58 (201)
T cd08420          18 LLARFRKRYPEVRVSLTI---------------GNTEEIAERVLDGEIDLGLVEGP   58 (201)
T ss_pred             HHHHHHHHCCCceEEEEe---------------CCcHHHHHHHHCCCccEEEecCC
Confidence            455555544 56666653               34567888899999999997543


No 55 
>cd08434 PBP2_GltC_like The substrate binding domain of LysR-type transcriptional regulator GltC, which activates gltA expression of glutamate synthase operon, contains type 2 periplasmic binding fold. GltC, a member of the LysR family of bacterial transcriptional factors, activates the expression of gltA gene of glutamate synthase operon and is essential for cell growth in the absence of glutamate. Glutamate synthase is a heterodimeric protein that encoded by gltA and gltB, whose expression is subject to nutritional regulation. GltC also negatively auto-regulates its own expression. This substrate-binding domain has strong homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, 
Probab=87.41  E-value=3.3  Score=22.84  Aligned_cols=22  Identities=14%  Similarity=0.308  Sum_probs=17.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (195)
T cd08434          36 GSTDELLDDLKNGELDLALCSP   57 (195)
T ss_pred             CcHHHHHHHHHcCCccEEEEcc
Confidence            4466788999999999998754


No 56 
>cd08437 PBP2_MleR The substrate binding domain of LysR-type transcriptional regulator MleR which required for malolactic fermentation, contains type 2 periplasmic binidning fold. MleR, a transcription activator of malolactic fermentation system, is found in gram-positive bacteria and belongs to the lysR family of bacterial transcriptional regulators. The mleR gene is required for the expression and induction of malolactic fermentation. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex comprised of two integral membrane domains and two cytoplasmically located ATPase dom
Probab=87.20  E-value=2.9  Score=23.49  Aligned_cols=21  Identities=10%  Similarity=0.237  Sum_probs=17.8

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ...+.++..|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~   56 (198)
T cd08437          36 GGSAELLEQLLQGDLDIALLG   56 (198)
T ss_pred             cCHHHHHHHHHcCCCCEEEec
Confidence            456789999999999999864


No 57 
>cd08465 PBP2_ToxR The C-terminal substrate binding domain of LysR-type transcriptional regulator ToxR regulates the expression of the toxoflavin biosynthesis genes; contains the type 2 periplasmic bindinig fold. In soil bacterium Burkholderia glumae, ToxR regulates the toxABCDE and toxFGHI operons in the presence of toxoflavin as a coinducer. Additionally, the expression of both operons requires a transcriptional activator, ToxJ, whose expression is regulated by the TofI or TofR quorum-sensing system. The biosynthesis of toxoflavin is suggested to be synthesized in a pathway common to the synthesis of riboflavin. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After
Probab=87.14  E-value=2.6  Score=23.98  Aligned_cols=21  Identities=5%  Similarity=0.302  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +.+..++..|.+|++|+++..
T Consensus        36 ~~~~~~~~~L~~g~~Dl~i~~   56 (200)
T cd08465          36 ASREAMLAQVADGEIDLALGV   56 (200)
T ss_pred             CChHhHHHHHHCCCccEEEec
Confidence            568899999999999999964


No 58 
>PRK11480 tauA taurine transporter substrate binding subunit; Provisional
Probab=87.04  E-value=1.4  Score=28.18  Aligned_cols=35  Identities=17%  Similarity=0.144  Sum_probs=27.2

Q ss_pred             HHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           8 AQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         8 a~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .++.|++++++..              ..+..++..|.+|++|++..+.
T Consensus        46 ~~~~Gl~Ve~~~~--------------~~~~~~~~al~~G~~D~a~~~~   80 (320)
T PRK11480         46 AKESGATVDWRKF--------------DSGASIVRALASGDVQIGNLGS   80 (320)
T ss_pred             HHHcCCeeEEEEe--------------CCHHHHHHHHHCCCCCEECcCc
Confidence            4567888888764              3578899999999999986543


No 59 
>cd08439 PBP2_LrhA_like The C-terminal substrate domain of LysR-like regulator LrhA (LysR homologue A) and that of closely related homologs, contains the type 2 periplasmic binding fold. This CD represents the LrhA subfamily of LysR-like bacterial transcriptional regulators, including LrhA, HexA, PecT, and DgdR.  LrhA is involved in control of the transcription of flagellar, motility, and chemotaxis genes by regulating the synthesis and concentration of FlhD(2)C(2), the master regulator for the expression of flagellar and chemotaxis genes. The LrhA protein has strong homology to HexA and PecT from plant pathogenic bacteria, in which HexA and PecT act as repressors of motility and of virulence factors, such as exoenzymes required for lytic reactions. DgdR also shares similar characteristics to those of LrhA, HexA and PecT. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a vari
Probab=87.02  E-value=3.2  Score=23.19  Aligned_cols=21  Identities=10%  Similarity=0.192  Sum_probs=17.3

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+..+|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~   56 (185)
T cd08439          36 KRTPRLMEMLERGEVDLALIT   56 (185)
T ss_pred             CChHHHHHHHHCCCCcEEEEe
Confidence            345688999999999999863


No 60 
>cd08418 PBP2_TdcA The C-terminal substrate binding domain of LysR-type transcriptional regulator TdcA, which is involved in the degradation of L-serine and L-threonine, contains the type 2 periplasmic binding fold. TdcA, a member of the LysR family, activates the expression of the anaerobically-regulated tdcABCDEFG operon which is involved in the degradation of L-serine and L-threonine to acetate and propionate, respectively. The tdc operon is comprised of one regulatory gene tdcA and six structural genes, tdcB to tdcG. The expression of the tdc operon is affected by several transcription factors including the cAMP receptor protein (CRP), integration host factor (IHF), histone-like protein (HU), and the operon specific regulators TdcA and TcdR. TcdR is divergently transcribed from the operon and encodes a small protein that is required for efficient expression of the Escherichia coli tdc operon.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding
Probab=87.01  E-value=3.1  Score=23.23  Aligned_cols=22  Identities=14%  Similarity=0.354  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~~   57 (201)
T cd08418          36 GQLSSLLPELRDGRLDFAIGTL   57 (201)
T ss_pred             CcHHHHHHHHHcCCCcEEEEec
Confidence            4567899999999999999753


No 61 
>cd08421 PBP2_LTTR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=86.88  E-value=3.8  Score=22.85  Aligned_cols=39  Identities=15%  Similarity=0.119  Sum_probs=26.9

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.+.. +.++++..               +....++..|.+|++|+++...
T Consensus        18 ~l~~~~~~~P~i~i~~~~---------------~~~~~~~~~l~~~~~D~~i~~~   57 (198)
T cd08421          18 DLASFLAAHPDVRIDLEE---------------RLSADIVRAVAEGRADLGIVAG   57 (198)
T ss_pred             HHHHHHHHCCCceEEEEe---------------cCcHHHHHHHhcCCceEEEEec
Confidence            455555543 55566653               4567889999999999998643


No 62 
>cd08440 PBP2_LTTR_like_4 TThe C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse funct
Probab=86.82  E-value=3.7  Score=22.64  Aligned_cols=22  Identities=9%  Similarity=0.139  Sum_probs=18.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~~   57 (197)
T cd08440          36 VSAEQVIEAVRSGEVDFGIGSE   57 (197)
T ss_pred             CChHHHHHHHHcCCccEEEEeC
Confidence            4567889999999999999754


No 63 
>cd08450 PBP2_HcaR The C-terminal substrate binding domain of LysR-type transcriptional regulator HcaR in involved in 3-phenylpropionic acid catabolism, contains the type2 periplasmic binding fold. HcaR, a member of the LysR family of transcriptional regulators, controls the expression of the hcA1, A2, B, C, and D operon, encoding for the 3-phenylpropionate dioxygenase complex and 3-phenylpropionate-2',3'-dihydrodiol dehydrogenase, that oxidizes 3-phenylpropionate to 3-(2,3-dihydroxyphenyl) propionate.  Dioxygenases play an important role in protecting the cell against the toxic effects of dioxygen. The expression of hcaR is negatively auto-regulated, as for other members of the LysR family, and is strongly repressed in the presence of glucose. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=86.76  E-value=3.8  Score=22.79  Aligned_cols=22  Identities=14%  Similarity=0.088  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (196)
T cd08450          36 LFSPQLAEALMRGKLDVAFMRP   57 (196)
T ss_pred             cChHHHHHHHhcCCccEEEEeC
Confidence            4567888999999999998643


No 64 
>cd08411 PBP2_OxyR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator OxyR, a member of the type 2 periplasmic binding fold protein superfamily. OxyR senses hydrogen peroxide and is activated through the formation of an intramolecular disulfide bond. The OxyR activation induces the transcription of genes necessary for the bacterial defense against oxidative stress. The OxyR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repre
Probab=86.66  E-value=3.3  Score=23.21  Aligned_cols=21  Identities=19%  Similarity=0.298  Sum_probs=17.7

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus        37 ~~~~~~~~~l~~~~~Dl~i~~   57 (200)
T cd08411          37 DQTERLLEKLRSGELDAALLA   57 (200)
T ss_pred             CcHHHHHHHHHcCCccEEEEe
Confidence            456788999999999999864


No 65 
>cd08453 PBP2_IlvR The C-terminal substrate binding domain of LysR-type transcriptional regulator, IlvR, involved in the biosynthesis of isoleucine, leucine and valine; contains type 2 periplasmic binding fold. The IlvR is an activator of the upstream and divergently transcribed ilvD gene, which encodes dihydroxy acid dehydratase that participates in isoleucine, leucine, and valine biosynthesis. As in the case of other members of the LysR family, the expression of ilvR gene is repressed in the presence of its own gene product. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport
Probab=86.56  E-value=3.4  Score=23.23  Aligned_cols=21  Identities=10%  Similarity=0.115  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+...|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~   56 (200)
T cd08453          36 ATSDVQLEALLAGEIDAGIVI   56 (200)
T ss_pred             CCHHHHHHHHHcCCCCEEEEe
Confidence            456678999999999999864


No 66 
>cd03770 SR_TndX_transposase Serine Recombinase (SR) family, TndX-like transposase subfamily, catalytic domain; composed of large serine recombinases similar to Clostridium TndX and TnpX transposases. Serine recombinases catalyze site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and the enzyme. They are functionally versatile and include resolvases, invertases, integrases, and transposases. TndX mediates the excision and circularization of the conjugative transposon Tn5397 from Clostridium difficile. TnpX is responsible for the movement of the nonconjugative chloramphenicol resistance elements of the Tn4451/3 family. Mobile genetic elements such as transposons are important vehicles for the transmission of virulence and antibiotic resistance in many microorganisms.
Probab=86.50  E-value=4.2  Score=23.16  Aligned_cols=49  Identities=22%  Similarity=0.396  Sum_probs=32.7

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      .++..|+..|+...-++.+++.-|....   --.|..|+..+..|++|..+.
T Consensus        26 ~l~~~a~~~g~~i~~~~~D~~~SG~~~~---Rp~l~~ll~~~~~g~vd~vvv   74 (140)
T cd03770          26 ILEEYAKENGLENIRHYIDDGFSGTTFD---RPGFNRMIEDIEAGKIDIVIV   74 (140)
T ss_pred             HHHHHHHHCCCEEEEEEEcCCCcCCcCC---CHHHHHHHHHHHcCCCCEEEE
Confidence            4667788889876444444444443221   135999999999999997664


No 67 
>cd08431 PBP2_HupR The C-terminal substrate binding domain of LysR-type transcriptional regulator, HupR, which regulates expression of the heme uptake receptor HupA; contains the type 2 periplasmic binding fold. HupR, a member of the LysR family, activates hupA transcription under low-iron conditions in the presence of hemin. The expression of many iron-uptake genes, such as hupA,  is regulated at the transcriptional level by iron and an iron-binding repressor protein called Fur (ferric uptake regulation). Under iron-abundant conditions with heme, the active Fur repressor protein represses transcription of the iron-uptake gene hupA, and prevents transcriptional activation via HupR. Under low-iron conditions with heme, the Fur repressor is inactive and transcription of the hupA is allowed. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, p
Probab=86.45  E-value=2.7  Score=23.52  Aligned_cols=38  Identities=21%  Similarity=0.238  Sum_probs=26.7

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.++++..               +..+.++.+|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~v~i~i~~---------------~~~~~~~~~l~~g~~D~~i~~   56 (195)
T cd08431          18 LIAEFYQLNKATRIRLSE---------------EVLGGTWDALASGRADLVIGA   56 (195)
T ss_pred             HHHHHHHHCCCCceEEEE---------------eccchHHHHHhCCCCCEEEEe
Confidence            445555554 56666653               345678899999999999964


No 68 
>cd08425 PBP2_CynR The C-terminal substrate-binding domain of the LysR-type transcriptional regulator CynR, contains the type 2 periplasmic binding fold. CynR is a LysR-like transcriptional regulator of the cyn operon, which encodes genes that allow cyanate to be used as a sole source of nitrogen. The operon includes three genes in the following order: cynT (cyanate permease), cynS (cyanase), and cynX (a protein of unknown function).  CynR negatively regulates its own expression independently of cyanate. CynR binds to DNA and induces bending of DNA in the presence or absence of cyanate, but the amount of bending is decreased by cyanate. The CynR of LysR-type transcriptional regulator family is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding 
Probab=86.41  E-value=4.1  Score=22.76  Aligned_cols=22  Identities=9%  Similarity=0.022  Sum_probs=17.8

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....+...|.+|++|+++...
T Consensus        37 ~~~~~~~~~l~~g~~Dl~i~~~   58 (197)
T cd08425          37 MPQERIEAALADDRLDLGIAFA   58 (197)
T ss_pred             CcHHHHHHHHHcCCccEEEEec
Confidence            3456788999999999999643


No 69 
>cd08416 PBP2_MdcR The C-terminal substrate-binding domian of LysR-type transcriptional regulator MdcR, which involved in the malonate catabolism contains the type 2 periplasmic binding fold. This family includes the C-terminal substrate binding domain of LysR-type transcriptional regulator (LTTR) MdcR that controls the expression of the malonate decarboxylase (mdc) genes. Like other members of the LTTRs, MdcR is a positive regulatory protein for its target promoter and composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins (PBP2). The PBP2 are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these dom
Probab=86.27  E-value=3.4  Score=23.09  Aligned_cols=39  Identities=15%  Similarity=0.248  Sum_probs=26.7

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..+.++. +.++++..               +....+...|.+|++|+++...
T Consensus        18 ~l~~~~~~~P~i~l~i~~---------------~~~~~~~~~l~~~~~Dl~i~~~   57 (199)
T cd08416          18 IIMGLKLRRPELDIELTL---------------GSNKDLLKKLKDGELDAILVAT   57 (199)
T ss_pred             HHHHHHHhCCCeEEEEEE---------------cCcHHHHHHHhCCCCCEEEEec
Confidence            344455444 56666653               4566788899999999999753


No 70 
>cd08467 PBP2_SyrM The C-terminal substrate binding of LysR-type symbiotic regulator SyrM, which activates expression of nodulation gene NodD3, contains the type 2 periplasmic binding fold. Rhizobium is a nitrogen fixing bacteria present in the roots of leguminous plants, which fixes atmospheric nitrogen to the soil. Most Rhizobium species possess multiple nodulation (nod) genes for the development of nodules. For example, Rhizobium meliloti possesses three copies of nodD genes. NodD1 and NodD2 activate nod operons when  Rhizobium is exposed to inducers synthesized by the host plant, while NodD3 acts independent of plant inducers and requires the symbiotic regulator SyrM for nod gene expression. SyrM activates the expression of the regulatory nodulation gene nodD3. In turn, NodD3 activates expression of syrM. In addition, SyrM is involved in exopolysaccharide synthesis. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are 
Probab=86.26  E-value=2.5  Score=24.00  Aligned_cols=21  Identities=14%  Similarity=-0.002  Sum_probs=17.6

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~   56 (200)
T cd08467          36 IGDDLAERGLEQGTIDLAVGR   56 (200)
T ss_pred             CCcccHHHHhhCCCcCEEEec
Confidence            456678999999999999964


No 71 
>cd08438 PBP2_CidR The C-terminal substrate binding domain of LysR-like transcriptional regulator CidR, contains the type 2 periplasmic binding fold. This CD includes the substrate binding domain of CidR which positively up-regulates the expression of cidABC operon in the presence of acetic acid produced by the metabolism of excess glucose. The CidR affects the control of murein hydrolase activity by enhancing cidABC expression in the presence of acetic acid. Thus, up-regulation of cidABC expression results in increased murein hydrolase activity. This substrate binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate 
Probab=86.25  E-value=4.1  Score=22.59  Aligned_cols=22  Identities=14%  Similarity=0.146  Sum_probs=18.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~L~~~~~Dl~i~~~   57 (197)
T cd08438          36 YGGKKVEQAVLNGELDVGITVL   57 (197)
T ss_pred             cCcHHHHHHHHcCCCCEEEEec
Confidence            4567888999999999999754


No 72 
>cd08449 PBP2_XapR The C-terminal substrate binding domain of LysR-type transcriptional regulator XapR involved in xanthosine catabolism, contains the type 2 periplasmic binding fold. In Escherichia coli, XapR is a positive regulator for the expression of xapA gene, encoding xanthosine phosphorylase, and xapB gene, encoding a polypeptide similar to the nucleotide transport protein NupG. As an operon, the expression of both xapA and xapB is fully dependent on the presence of both XapR and the inducer xanthosine. Expression of the xapR is constitutive but not auto-regulated, unlike many other LysR family proteins. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their 
Probab=86.05  E-value=3.6  Score=22.88  Aligned_cols=22  Identities=9%  Similarity=0.105  Sum_probs=18.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (197)
T cd08449          36 LSPEAQKAALLSKRIDLGFVRF   57 (197)
T ss_pred             CCHHHHHHHHhCCCccEEEecc
Confidence            4567889999999999999644


No 73 
>cd08452 PBP2_AlsR The C-terminal substrate binding domain of LysR-type trnascriptional regulator AlsR, which regulates acetoin formation under stationary phase growth conditions; contains the type 2 periplasmic binding fold. AlsR is responsible for activating the expression of the acetoin operon (alsSD) in response to inducing signals such as glucose and acetate.  Like many other LysR family proteins, AlsR is transcribed divergently from the alsSD operon. The alsS gene encodes acetolactate synthase, an enzyme involved in the production of acetoin in cells of stationary-phase. AlsS catalyzes the conversion of two pyruvate molecules to acetolactate and carbon dioxide. Acetolactate is then converted to acetoin at low pH by acetolactate decarboxylase which encoded by the alsD gene. Acetoin is an important physiological metabolite excreted by many microorganisms grown on glucose or other fermentable carbon sources. This substrate-binding domain shows significant homology to the type 2 perip
Probab=85.94  E-value=3.7  Score=23.20  Aligned_cols=38  Identities=13%  Similarity=0.227  Sum_probs=26.6

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.++. +.++++..               +....+...|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~v~i~i~~---------------~~~~~~~~~l~~~~~Dl~i~~   56 (197)
T cd08452          18 IVREYRKKFPSVKVELRE---------------LSSPDQVEELLKGRIDIGFLH   56 (197)
T ss_pred             HHHHHHHHCCCcEEEEEe---------------cChHHHHHHHHCCCccEEEee
Confidence            445555443 55666653               456788999999999999864


No 74 
>cd08444 PBP2_Cbl The C-terminal substrate binding domain of LysR-type transcriptional regulator Cbl, which is required for expression of sulfate starvation-inducible (ssi) genes, contains the type 2 periplasmic binding fold. Cbl is a member of the LysR transcriptional regulators that comprise the largest family of prokaryotic transcription factor. Cbl shows high sequence similarity to CysB, the LysR-type transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the function of Cbl is required for expression of sulfate starvation-inducible (ssi) genes, coupled with the biosynthesis of cysteine from the organic sulfur sources (sulfonates). The ssi genes include the ssuEADCB and tauABCD operons encoding uptake systems for organosulfur compounds, aliphatic sulfonates, and taurine. The genes in these operons encode an ABC-type transport system required for uptake of aliphatic sulfonates and a desulfonati
Probab=85.78  E-value=3.7  Score=23.25  Aligned_cols=21  Identities=19%  Similarity=0.268  Sum_probs=17.7

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.++..|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~   56 (198)
T cd08444          36 GSPEEIASMLANGQADIGIAT   56 (198)
T ss_pred             CCHHHHHHHHHCCCccEEEec
Confidence            456778999999999999964


No 75 
>cd08447 PBP2_LTTR_aromatics_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to regulators involved in the catabolism of aromatic compounds, contains type 2 periplasmic binding fold. This CD represents the substrate binding domain of an uncharacterized LysR-type regulator similar to CbnR which is involved in the regulation of chlorocatechol breakdown. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Ve
Probab=84.80  E-value=4.4  Score=22.58  Aligned_cols=21  Identities=10%  Similarity=0.096  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.+...|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~   56 (198)
T cd08447          36 MVTTDQIEALESGRIDLGLLR   56 (198)
T ss_pred             CCHHHHHHHHHcCCceEEEec
Confidence            467789999999999999964


No 76 
>cd08436 PBP2_LTTR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=84.72  E-value=4.3  Score=22.41  Aligned_cols=23  Identities=13%  Similarity=0.329  Sum_probs=18.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCCc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +....+...|.+|++|+++....
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~~   58 (194)
T cd08436          36 AGSDDLLAAVREGRLDLAFVGLP   58 (194)
T ss_pred             CCHHHHHHHHHcCCccEEEEecC
Confidence            34567889999999999997543


No 77 
>cd08412 PBP2_PAO1_like The C-terminal substrate-binding domain of putative LysR-type transcriptional regulator PAO1-like, a member of the type 2 periplasmic binding fold protein superfamily. This family includes the C-terminal substrate domain of a putative LysR-type transcriptional regulator from the plant pathogen Pseudomonas aeruginosa PAO1and its closely related homologs. The LysR-type transcriptional regulators (LTTRs) are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controll
Probab=84.31  E-value=5.3  Score=22.20  Aligned_cols=38  Identities=11%  Similarity=0.199  Sum_probs=26.4

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.++++..               +....++..|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~i~l~i~~---------------~~~~~~~~~l~~~~~D~~i~~   56 (198)
T cd08412          18 LLRRFREAYPGVEVRVVE---------------GNQEELEEGLRSGELDLALTY   56 (198)
T ss_pred             HHHHHHHHCCCcEEEEEE---------------CCHHHHHHHHHcCCCcEEEEc
Confidence            444454443 56666653               456778899999999999874


No 78 
>cd08417 PBP2_Nitroaromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators that involved in the catabolism of nitroaromatic/naphthalene compounds and that of related regulators; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of dinitrotoluene and similar compounds, such as DntR, NahR, and LinR. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded. Also included are related LysR-type regulators clustered together in phylogenetic trees, including NodD, ToxR, LeuO, SyrM, TdcA, and PnbR. This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrate
Probab=84.28  E-value=4.9  Score=22.42  Aligned_cols=22  Identities=9%  Similarity=0.202  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~D~~i~~~   57 (200)
T cd08417          36 LDRDDLEEALESGEIDLAIGVF   57 (200)
T ss_pred             CCHHHHHHHHHcCCCCEEEeec
Confidence            4567899999999999999754


No 79 
>cd08441 PBP2_MetR The C-terminal substrate binding domain of LysR-type transcriptional regulator metR, which regulates the expression of methionine biosynthetic genes, contains type 2 periplasmic binding fold. MetR, a member of the LysR family, is a positive regulator for the metA, metE, metF, and metH genes. The sulfur-containing amino acid methionine is the universal initiator of protein synthesis in all known organisms and its derivative S-adenosylmethionine (SAM) and autoinducer-2 (AI-2) are involved in various cellular processes. SAM plays a central role as methyl donor in methylation reactions, which are essential for the biosynthesis of phospholipids, proteins, DNA and RNA.  The interspecies signaling molecule AI-2 is involved in cell-cell communication process (quorum sensing) and gene regulation in bacteria. Although methionine biosynthetic enzymes and metabolic pathways are well conserved in bacteria, the regulation of methionine biosynthesis involves various regulatory mecha
Probab=84.22  E-value=5.5  Score=22.31  Aligned_cols=21  Identities=10%  Similarity=0.112  Sum_probs=17.7

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+...|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~   56 (198)
T cd08441          36 GFHFDPLPALLRGELDLVITS   56 (198)
T ss_pred             CCchhHHHHHHcCCceEEEec
Confidence            456788999999999999864


No 80 
>cd08463 PBP2_DntR_like_4 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=84.14  E-value=4.5  Score=23.23  Aligned_cols=40  Identities=10%  Similarity=0.112  Sum_probs=27.2

Q ss_pred             hHHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           2 DLLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +++..+.+.. +.++++...              +.++.+...|.+|++|+++..
T Consensus        17 ~~l~~~~~~~P~~~v~~~~~--------------~~~~~l~~~L~~g~lDl~i~~   57 (203)
T cd08463          17 ELVARFRREAPGARLEIHPL--------------GPDFDYERALASGELDLVIGN   57 (203)
T ss_pred             HHHHHHHHHCCCCEEEEEeC--------------CcchhHHHHHhcCCeeEEEec
Confidence            3455555543 456666531              246789999999999999964


No 81 
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family. Members of this family are substrate-binding periplasmic proteins of ABC transporters. This subfamily includes SsuA, a member of a transporter operon needed to obtain sulfur from aliphatic sulfonates. Related proteins outside the scope of this model include taurine (NH2-CH2-CH2-S03H) binding proteins, the probable sulfate ester binding protein AtsR, and the probable aromatic sulfonate binding protein AsfC. All these families make sulfur available when Cys and sulfate levels are low. Please note that phylogenetic analysis by neighbor-joining suggests that a number of sequences belonging to this family have been excluded because of scoring lower than taurine-binding proteins.
Probab=84.04  E-value=1.7  Score=26.47  Aligned_cols=22  Identities=9%  Similarity=0.114  Sum_probs=18.1

Q ss_pred             chhhHHHhhhcCCccEEEeCCc
Q psy2313          36 KWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .+..++..|.+|++|+++.+..
T Consensus        38 ~~~~~~~~l~~G~~D~~~~~~~   59 (288)
T TIGR01728        38 AGPPALEALGAGSLDFGYIGPG   59 (288)
T ss_pred             CCcHHHHHHhcCCccccccCCc
Confidence            5678899999999999876553


No 82 
>PF03401 TctC:  Tripartite tricarboxylate transporter family receptor;  InterPro: IPR005064  Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth []. Periplasmic binding proteins of a new family, particularly well represented in this organism (and more generally in beta-proteobacteria), have been called Bug receptors []. They adopt a characteristic Venus flytrap fold with two globular domains bisected by a ligand-binding cleft. The family is specific for carboxylated solutes, with a characteristic mode of binding involving two highly conserved beta strand-beta turn-alpha helix motifs originating from each domain. These two motifs form hydrogen bonds with a carboxylate group of the ligand, both directly and via conserved water molecules, and have thus been termed the carboxylate pincers. Domain 1 recognises the ligand and the carboxylate group serves as an initial anchoring point. Domain 2 discriminates between productively and non-productively bound ligands as proper interactions with this domain is needed for the of the closed conformation []. BugE has a glutamate bound ligand. No charged residues are involved in glutamate binding by BugE, unlike what has been described for all glutamate receptors reported so far. The Bug architecture is highly conserved despite limited sequence identity [].; GO: 0030288 outer membrane-bounded periplasmic space; PDB: 2QPQ_C 2DVZ_A 2F5X_A.
Probab=83.47  E-value=2.6  Score=26.71  Aligned_cols=39  Identities=15%  Similarity=0.166  Sum_probs=27.4

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ...+++.+|++++++..              ..-...+.+|..|++|+++..+
T Consensus       122 ~~~l~~~~G~~~~~Vpy--------------~G~~~~~~allgG~vd~~~~~~  160 (274)
T PF03401_consen  122 AALLAKAAGIKFTHVPY--------------DGGAEALTALLGGHVDAAFGSP  160 (274)
T ss_dssp             HHHHHHHHT---EEEE---------------SSHHHHHHHHHTTSSSEEEEEH
T ss_pred             HHHHHHHhCCceEEEEe--------------CCccHHHHHHhCCeeeEEeecH
Confidence            35678889999888753              2456789999999999988764


No 83 
>cd08423 PBP2_LTTR_like_6 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=83.41  E-value=5.8  Score=21.99  Aligned_cols=38  Identities=11%  Similarity=0.107  Sum_probs=26.0

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.++++..               +.-..+...|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~i~i~~~~---------------~~~~~~~~~l~~~~~Dl~i~~   56 (200)
T cd08423          18 ALAALRARHPGLEVRLRE---------------AEPPESLDALRAGELDLAVVF   56 (200)
T ss_pred             HHHHHHHhCCCCeEEEEe---------------CCHHHHHHHHhcCCccEEEEe
Confidence            445555543 56666653               345678899999999999964


No 84 
>cd08461 PBP2_DntR_like_3 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=83.18  E-value=6.1  Score=22.05  Aligned_cols=38  Identities=16%  Similarity=0.215  Sum_probs=25.7

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.+.. +.++++..               +..+.+...|.+|++|+++..
T Consensus        18 ~l~~f~~~~P~v~i~i~~---------------~~~~~~~~~l~~~~~Di~i~~   56 (198)
T cd08461          18 LLAALRQEAPGVRVAIRD---------------LESDNLEAQLERGEVDLALTT   56 (198)
T ss_pred             HHHHHHHHCCCcEEEEee---------------CCcccHHHHHhcCCCcEEEec
Confidence            344444443 56666653               345678889999999999864


No 85 
>cd08445 PBP2_BenM_CatM_CatR The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in benzoate catabolism; contains the type 2 periplasmic binding fold. This CD includes the C-terminal of LysR-type transcription regulators, BenM, CatM, and CatR, which are involved in the benzoate catabolism. The BenM and CatM are paralogs with overlapping functions. BenM responds synergistically to two effectors, benzoate and cis,cis-muconate, to activate expression of the benABCDE operon which is involved in benzoate catabolism, while CatM responses only to muconate. BenM and CatM share high protein sequence identity and bind to the operator-promoter regions that have similar DNA sequences. In Pseudomonas species, phenolic compounds are converted by different enzymes to central intermediates, such as protocatechuate and catechols. Generally, unsubstituted compounds, such as benzoate, are metabolized by an ortho-cleavage pathway. The catBCA operon encodes three enzymes
Probab=82.97  E-value=6.5  Score=22.21  Aligned_cols=22  Identities=18%  Similarity=0.184  Sum_probs=18.2

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++...
T Consensus        37 ~~~~~~~~~l~~~~~Dl~i~~~   58 (203)
T cd08445          37 MTTVQQIEALKEGRIDVGFGRL   58 (203)
T ss_pred             CChHHHHHHHHcCCCcEEEecC
Confidence            4567899999999999999643


No 86 
>cd08460 PBP2_DntR_like_1 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=82.80  E-value=4.9  Score=22.66  Aligned_cols=20  Identities=15%  Similarity=0.157  Sum_probs=16.2

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +.. .++..|.+|++|+++..
T Consensus        36 ~~~-~~~~~l~~g~~D~~i~~   55 (200)
T cd08460          36 ESD-KDVDALREGRIDLEIGV   55 (200)
T ss_pred             Cch-hHHHHHHCCCccEEEec
Confidence            344 67889999999999964


No 87 
>PRK03601 transcriptional regulator HdfR; Provisional
Probab=82.74  E-value=7.4  Score=24.08  Aligned_cols=22  Identities=9%  Similarity=0.092  Sum_probs=18.7

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|++++..
T Consensus       125 ~~~~~~~~~l~~g~~Dl~i~~~  146 (275)
T PRK03601        125 AQRQSLVKQLHERQLDLLITTE  146 (275)
T ss_pred             CChHHHHHHHHcCCCCEEEEcC
Confidence            4567899999999999999754


No 88 
>cd08464 PBP2_DntR_like_2 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator similar to DntR, which is involved in the catabolism of dinitrotoluene; contains the type 2 periplasmic binding fold. This CD includes an uncharacterized LysR-type transcriptional regulator similar to DntR, NahR, and LinR, which are involved in the degradation of aromatic compounds. The transcription of the genes encoding enzymes involved in such degradation is regulated and expression of these enzymes is enhanced by inducers, which are either an intermediate in the metabolic pathway or compounds to be degraded.  This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytra
Probab=82.44  E-value=4.5  Score=22.58  Aligned_cols=38  Identities=16%  Similarity=0.081  Sum_probs=25.8

Q ss_pred             HHHHHHHHc-CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQEL-EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l-~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++..+.++. +.++++..               +....+...|.+|++|+++..
T Consensus        18 ~l~~~~~~~P~v~l~i~~---------------~~~~~~~~~l~~g~~D~~i~~   56 (200)
T cd08464          18 LLAALRAEAPGVRLVFRQ---------------VDPFNVGDMLDRGEIDLAIGV   56 (200)
T ss_pred             HHHHHHHHCCCcEEEEec---------------CCcccHHHHHhcCcccEEEec
Confidence            344455443 56666653               345678889999999999864


No 89 
>cd08414 PBP2_LTTR_aromatics_like The C-terminal substrate binding domain of LysR-type transcriptional regulators involved in the catabolism of aromatic compounds and that of other related regulators, contains type 2 periplasmic binding fold. This CD includes the C-terminal substrate binding domain of LTTRs involved in degradation of aromatic compounds, such as CbnR, BenM, CatM, ClcR and TfdR, as well as that of other transcriptional regulators clustered together in phylogenetic trees, including XapR, HcaR, MprR, IlvR, BudR, AlsR, LysR, and OccR. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they ca
Probab=82.43  E-value=6.2  Score=21.83  Aligned_cols=22  Identities=14%  Similarity=0.095  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (197)
T cd08414          36 MTTAEQLEALRAGRLDVGFVRP   57 (197)
T ss_pred             CChHHHHHHHHcCCccEEEEcC
Confidence            4457889999999999999643


No 90 
>cd08469 PBP2_PnbR The C-terminal substrate binding domain of LysR-type transcriptional regulator PnbR, which is involved in regulating the pnb genes encoding enzymes for 4-nitrobenzoate catabolism, contains the type 2 periplasmic binding fold. PnbR is the regulator of one or both of the two pnb genes that encoding enzymes for 4-nitrobenzoate catabolism. In Pseudomonas putida strain, pnbA encodes a 4-nitrobenzoate  reductase, which is responsible for catalyzing the direct reduction of 4-nitrobenzoate to 4-hydroxylaminobenzoate, and pnbB encodes a 4-hydroxylaminobenzoate lyase, which catalyzes the conversion of 4-hydroxylaminobenzoate to 3, 4-dihydroxybenzoic acid and ammonium. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft bet
Probab=82.33  E-value=5.9  Score=22.74  Aligned_cols=22  Identities=9%  Similarity=0.078  Sum_probs=18.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~Di~i~~~   57 (221)
T cd08469          36 VTRLDLAEQLDLGRIDLVIGIF   57 (221)
T ss_pred             CChhhHHHHHHCCCccEEEecC
Confidence            4566789999999999999743


No 91 
>PRK00072 hemC porphobilinogen deaminase; Reviewed
Probab=82.01  E-value=7.9  Score=25.39  Aligned_cols=51  Identities=14%  Similarity=0.251  Sum_probs=30.4

Q ss_pred             HHHHHHHc-CCeEEEEEecCCcccceecc------CCCcchhh-HHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQEL-EFDFHLYIVADGLYGTKVRE------NQKDKWNG-VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l-~f~~~~~~~~~~~~G~~~~~------~~~~~w~g-~ig~l~~g~~D~av~~l   56 (62)
                      .+.|.+.. +++++++...  +-|-+..+      .+.|-|.- +=.+|.+|++|+||-++
T Consensus        23 ~~~L~~~~p~~~~ei~~i~--T~GD~~~~~~L~~iggkG~Ftkele~aLl~g~iDiAVHSl   81 (295)
T PRK00072         23 KDRLKAAHPGLEVELVPIK--TKGDKILDVPLAKIGGKGLFVKELEEALLEGEIDIAVHSL   81 (295)
T ss_pred             HHHHHHHCCCCeEEEEEee--ccCcccccccHHHcCCcceeHHHHHHHHHcCCCCEEEecc
Confidence            34555543 5777777543  22322211      12467764 44789999999999776


No 92 
>cd08485 PBP2_ClcR The C-terminal substrate binding domain of LysR-type transcriptional regulator ClcR involved in the chlorocatechol catabolism, contains type 2 periplasmic binding fold. In soil bacterium Pseudomonas putida, the ortho-pathways of catechol and 3-chlorocatechol are central catabolic pathways that convert aromatic and chloroaromaric compounds to tricarboxylic acid (TCA) cycle intermediates. The 3-chlorocatechol-degradative pathway is encoded by clcABD operon, which requires the divergently transcribed clcR and an intermediate of the pathway, 2-chloromuconate, as an inducer for activation. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding th
Probab=81.88  E-value=7.1  Score=22.12  Aligned_cols=21  Identities=24%  Similarity=0.273  Sum_probs=17.2

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +.-+.++.+|.+|++|+++..
T Consensus        37 ~~~~~~~~~l~~~~~D~~i~~   57 (198)
T cd08485          37 MSKNRQIEALDAGTIDIGFGR   57 (198)
T ss_pred             CCHHHHHHHHHcCCccEEEec
Confidence            345678999999999999864


No 93 
>cd08443 PBP2_CysB The C-terminal substrate domain of LysR-type transcriptional regulator CysB contains type 2 periplasmic binding fold. CysB is a transcriptional activator of genes involved in sulfate and thiosulfate transport, sulfate reduction, and cysteine synthesis. In Escherichia coli, the regulation of transcription in response to sulfur source is attributed to two transcriptional regulators, CysB and Cbl. CysB, in association with Cbl, downregulates the expression of ssuEADCB operon which is required for the utilization of sulfur from aliphatic sulfonates, in the presence of cysteine. Also, Cbl and CysB together directly function as transcriptional activators of tauABCD genes, which are required for utilization of taurine as sulfur source for growth. Like many other members of the LTTR family, CysB is composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding speci
Probab=81.84  E-value=6.6  Score=22.25  Aligned_cols=21  Identities=10%  Similarity=0.121  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.+...|.+|++|+++..
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~   56 (198)
T cd08443          36 GSPTQIAEMVSKGLVDFAIAT   56 (198)
T ss_pred             CCHHHHHHHHHCCCccEEEEe
Confidence            456688999999999999964


No 94 
>smart00857 Resolvase Resolvase, N terminal domain. The N-terminal domain of the resolvase family contains the active site and the dimer interface. The extended arm at the C-terminus of this domain connects to the C-terminal helix-turn-helix domain of resolvase.
Probab=81.77  E-value=7.1  Score=21.85  Aligned_cols=50  Identities=16%  Similarity=0.266  Sum_probs=33.5

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +.++..|+..|+...-++.+.+.-|....   -..|..|+..+..|++|..+.
T Consensus        22 ~~~~~~a~~~g~~i~~~~~d~~~Sg~~~~---Rp~l~~ll~~~~~g~~~~ivv   71 (148)
T smart00857       22 EALRAYAKANGWEVVRIYEDEGVSGKKAD---RPGLQRLLADLRAGDIDVLVV   71 (148)
T ss_pred             HHHHHHHHHCCCEEEEEEEeCCCcCCCCC---CHHHHHHHHHHHcCCCCEEEE
Confidence            34667788889886544444434444321   146999999999999987664


No 95 
>cd03087 PGM_like1 This archaeal PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=81.56  E-value=5.3  Score=26.84  Aligned_cols=52  Identities=13%  Similarity=0.168  Sum_probs=34.7

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+.+++|+++..+ ..+|+.++...|+.....+..+...+...++|++++
T Consensus       179 ~~~~~l~~lg~~v~~~~~~~d~~f~~~~p~p~~~~l~~l~~~v~~~~adlgia  231 (439)
T cd03087         179 TTPYLLRELGCKVITLNANPDGFFPGRPPEPTPENLSELMELVRATGADLGIA  231 (439)
T ss_pred             HHHHHHHHcCCEEEEECCcCCCCCCCCCCCCCHHHHHHHHHHHHhcCCCEEEE
Confidence            5678888999987654 345667653333211244667777777889999885


No 96 
>cd08462 PBP2_NodD The C-terminal substsrate binding domain of NodD family of LysR-type transcriptional regulators that regulates the expression of nodulation (nod) genes; contains the type 2 periplasmic binding fold. The nodulation (nod) genes in soil bacteria play important roles in the development of nodules. nod genes are involved in synthesis of Nod factors that are required for bacterial entry into root hairs. Thirteen nod genes have been identified and are classified into five transcription units: nodD, nodABCIJ, nodFEL, nodMNT, and nodO. NodD is negatively auto-regulates its own expression of nodD gene, while other nod genes are inducible and positively regulated by NodD in the presence of flavonoids released by plant roots. This substrate-binding domain has significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. T
Probab=80.76  E-value=6.5  Score=22.21  Aligned_cols=17  Identities=18%  Similarity=0.075  Sum_probs=15.5

Q ss_pred             hHHHhhhcCCccEEEeC
Q psy2313          39 GVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        39 g~ig~l~~g~~D~av~~   55 (62)
                      .++..|.+|++|+++..
T Consensus        39 ~~~~~l~~g~~D~~i~~   55 (200)
T cd08462          39 QPHELLERGEVDLLIAP   55 (200)
T ss_pred             hHHHHHhcCCeeEEEec
Confidence            89999999999999964


No 97 
>cd08426 PBP2_LTTR_like_5 The C-terminal substrate binding domain of an uncharacterized LysR-type transcriptional regulator, contains the type 2 periplasmic binding fold. LysR-transcriptional regulators comprise the largest family of prokaryotic transcription factor. Homologs of some of LTTRs with similar domain organizations are also found in the archaea and eukaryotic organisms. The LTTRs are composed of two functional domains joined by a linker helix involved in oligomerization: an N-terminal HTH (helix-turn-helix) domain, which is responsible for the DNA-binding specificity, and a C-terminal substrate-binding domain, which is structurally homologous to the type 2 periplasmic binding proteins. As also observed in the periplasmic binding proteins, the C-terminal domain of the bacterial transcriptional repressor undergoes a conformational change upon substrate binding which in turn changes the DNA binding affinity of the repressor.  The genes controlled by the LTTRs have diverse functi
Probab=80.06  E-value=8.2  Score=21.48  Aligned_cols=22  Identities=18%  Similarity=0.267  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..+.+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~D~~i~~~   57 (199)
T cd08426          36 ASTADVLEAVLSGEADIGLAFS   57 (199)
T ss_pred             CCcHHHHHHHHCCCccEEEecC
Confidence            4457789999999999999754


No 98 
>cd08435 PBP2_GbpR The C-terminal substrate binding domain of galactose-binding protein regulator contains the type 2 periplasmic binding fold. Galactose-binding protein regulator (GbpR), a member of the LysR family of bacterial transcriptional regulators, regulates the expression of chromosomal virulence gene chvE.   The chvE gene is involved in the uptake of specific sugars, in chemotaxis to these sugars, and in the VirA-VirG two-component signal transduction system. In the presence of an inducing sugar such as L-arabinose, D-fucose, or D-galactose, GbpR activates chvE expression, while in the absence of an inducing sugar, GbpR represses expression. The topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a ma
Probab=79.44  E-value=8.5  Score=21.32  Aligned_cols=22  Identities=14%  Similarity=0.279  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.-..+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~~~~Dl~i~~~   57 (201)
T cd08435          36 GTSDELLEGLRAGELDLAIGRL   57 (201)
T ss_pred             CCHHHHHHHHHcCCccEEEEec
Confidence            3456788899999999998643


No 99 
>cd08428 PBP2_IciA_ArgP The C-terminal substrate binding domain of LysR-type transcriptional regulator, ArgP (IciA), for arginine exporter (ArgO); contains the type 2 periplasmic binding fold. The inhibitor of chromosomal replication (iciA) protein encoded by Mycobacterium tuberculosis, which is implicated in chromosome replication initiation in vitro, has been identified as arginine permease (ArgP), a LysR-type transcriptional regulator for arginine outward transport, based on the same amino sequence and similar DNA binding targets. Arp has been shown to regulate various targets including DnaA (replication), ArgO (arginine export), dapB (lysine biosynthesis), and gdhA (glutamate biosynthesis). With abundant nutrition, ArgP activates the DnaA gene (to increase replication) and the ArgO (to export redundant molecules). However, when nutrition supply is limited, it is suggested that ArgP might function as an inhibitor of chromosome replication in order to slow replication. This substrate-
Probab=79.36  E-value=6.5  Score=21.98  Aligned_cols=21  Identities=14%  Similarity=0.036  Sum_probs=16.6

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+...|.+|++|+++..
T Consensus        35 ~~~~~~~~~l~~~~~D~~i~~   55 (195)
T cd08428          35 DDEDRTHDLLRDGEVVGCIST   55 (195)
T ss_pred             CCchhHHHHHHcCcceEEEEe
Confidence            345678899999999988753


No 100
>PRK11242 DNA-binding transcriptional regulator CynR; Provisional
Probab=79.23  E-value=12  Score=23.01  Aligned_cols=23  Identities=9%  Similarity=-0.032  Sum_probs=18.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCCc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .....++..|.+|++|+++....
T Consensus       127 ~~~~~~~~~l~~g~~Dl~i~~~~  149 (296)
T PRK11242        127 MSQERIEALLADDELDVGIAFAP  149 (296)
T ss_pred             CCHHHHHHHHHCCCCcEEEEecC
Confidence            34577889999999999997543


No 101
>PRK12683 transcriptional regulator CysB-like protein; Reviewed
Probab=78.95  E-value=8.6  Score=24.30  Aligned_cols=21  Identities=19%  Similarity=0.272  Sum_probs=18.7

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +.++.++..|.+|++|+++..
T Consensus       129 ~~~~~~~~~L~~~~~D~~i~~  149 (309)
T PRK12683        129 GSPQEIAEMLLNGEADIGIAT  149 (309)
T ss_pred             CCHHHHHHHHHcCCccEEEec
Confidence            568899999999999999864


No 102
>PRK01066 porphobilinogen deaminase; Provisional
Probab=78.65  E-value=12  Score=23.87  Aligned_cols=51  Identities=10%  Similarity=0.139  Sum_probs=29.4

Q ss_pred             HHHHHHHc-CCeEEEEEecCCcccceecc------CCCcchhh-HHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQEL-EFDFHLYIVADGLYGTKVRE------NQKDKWNG-VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l-~f~~~~~~~~~~~~G~~~~~------~~~~~w~g-~ig~l~~g~~D~av~~l   56 (62)
                      .+.|.+.. +++++++...  +-|-...+      .+.|-|.- +=.+|.+|++|+||-++
T Consensus        36 ~~~L~~~~p~~~~ei~~i~--T~GD~~~~~~L~~iGgkGlFtkele~aLl~g~iDiAVHSl   94 (231)
T PRK01066         36 LRLLRSFFPKLWFQISTTT--TQGDLDQKTPLHLVENTGFFTDDVDFLVLSGQCDLAIHSA   94 (231)
T ss_pred             HHHHHHhCCCCcEEEEEEe--ccCcccccccHHHcCCceeeHHHHHHHHHcCCCCEEEecC
Confidence            34555544 6677777543  22322211      11355543 55588999999999776


No 103
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional
Probab=78.60  E-value=4.7  Score=25.45  Aligned_cols=20  Identities=10%  Similarity=0.119  Sum_probs=16.9

Q ss_pred             chhhHHHhhhcCCccEEEeC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~   55 (62)
                      ....++..|.+|++|+++..
T Consensus        65 ~~~~~~~aL~~G~iDia~~~   84 (314)
T PRK11553         65 AGPQMLEALNVGSIDLGSTG   84 (314)
T ss_pred             CcHHHHHHHHcCCCCEEccC
Confidence            34689999999999999864


No 104
>PRK09508 leuO leucine transcriptional activator; Reviewed
Probab=78.56  E-value=8.1  Score=24.35  Aligned_cols=22  Identities=5%  Similarity=-0.083  Sum_probs=18.2

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++...
T Consensus       148 ~~~~~~~~~l~~g~~Di~i~~~  169 (314)
T PRK09508        148 SLNQNIEHQLRYQETEFVISYE  169 (314)
T ss_pred             CcchhHHHHHhcCCccEEEecC
Confidence            4457789999999999999754


No 105
>TIGR02136 ptsS_2 phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975.
Probab=78.27  E-value=3.2  Score=26.24  Aligned_cols=22  Identities=14%  Similarity=0.154  Sum_probs=18.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++..-
T Consensus        71 ~~s~~l~~~L~~G~iDlai~~~   92 (287)
T TIGR02136        71 AGSGTGIKALINGTVDIGNSSR   92 (287)
T ss_pred             CCchHHHHHHHcCCCchhhccC
Confidence            5688999999999999988653


No 106
>cd08433 PBP2_Nac The C-teminal substrate binding domain of LysR-like nitrogen assimilation control (NAC) protein, contains the type 2 periplasmic binding fold. The NAC is a LysR-type transcription regulator that activates expression of operons such as hut (histidine utilization) and ure (urea utilization), allowing use of non-preferred (poor) nitrogen sources, and represses expression of operons, such as glutamate dehydrogenase (gdh), allowing assimilation of the preferred nitrogen source.  The expression of the nac gene is fully dependent on the nitrogen regulatory system (NTR) and the sigma54-containing RNA polymerase (sigma54-RNAP). In response to nitrogen starvation, NTR system activates the expression of nac, and NAC activates the expression of hut, ure, and put (proline utilization). NAC is not involved in the transcription of Sigma70-RNAP operons such as glnA, which directly respond by the NTR system, but activates the transcription of sigma70-RNAP dependent operons such as hut.
Probab=78.25  E-value=9.6  Score=21.23  Aligned_cols=21  Identities=10%  Similarity=0.021  Sum_probs=16.8

Q ss_pred             chhhHHHhhhcCCccEEEeCC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .-..+...|.+|++|+++...
T Consensus        37 ~~~~~~~~l~~~~~D~~i~~~   57 (198)
T cd08433          37 LSGHLLEWLLNGRLDLALLYG   57 (198)
T ss_pred             CcHHHHHHHhCCCCcEEEEeC
Confidence            346788899999999998643


No 107
>cd00494 HMBS Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12.  HMBS catalyzes the conversion of porphobilinogen (PBG) into hydroxymethylbilane (HMB).  HMBS consists of three domains, and is believed to bind substrate through a hinge-bending motion of domains I and II.  HMBS is found in all organisms except viruses.
Probab=77.85  E-value=12  Score=24.50  Aligned_cols=51  Identities=16%  Similarity=0.342  Sum_probs=29.8

Q ss_pred             HHHHHHHc-CCeEEEEEecCCcccceecc------CCCcchhh-HHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQEL-EFDFHLYIVADGLYGTKVRE------NQKDKWNG-VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l-~f~~~~~~~~~~~~G~~~~~------~~~~~w~g-~ig~l~~g~~D~av~~l   56 (62)
                      .+.|.+.. +++++++...  +-|-...+      .+.|-|.- +=.+|.+|++|+||-++
T Consensus        19 ~~~L~~~~p~~~~ei~~i~--T~GD~~~~~~L~~iggkG~Ftkele~aLl~g~iDiAVHSl   77 (292)
T cd00494          19 IEKLKELCPGIEVEIVIIK--TTGDKILDKPLAKIGGKGLFTKELEEALLNGEIDLAVHSL   77 (292)
T ss_pred             HHHHHHhCCCCeEEEEEEE--ecCcccccccHHHcCCcceeHHHHHHHHHcCCCCEEEecc
Confidence            34555544 5677777542  22222110      12366764 44589999999999776


No 108
>TIGR00212 hemC porphobilinogen deaminase. Biosynthesis of cofactors, prosthetic groups, and carriers: Heme and porphyrin
Probab=77.73  E-value=12  Score=24.51  Aligned_cols=51  Identities=20%  Similarity=0.367  Sum_probs=30.1

Q ss_pred             HHHHHHHc-CCeEEEEEecCCcccceecc------CCCcchh-hHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQEL-EFDFHLYIVADGLYGTKVRE------NQKDKWN-GVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l-~f~~~~~~~~~~~~G~~~~~------~~~~~w~-g~ig~l~~g~~D~av~~l   56 (62)
                      .+.|.+.. +++++++...  +-|-+..+      .+.|-|. .+=.+|.+|++|+||-++
T Consensus        19 ~~~L~~~~p~~~~ei~~i~--T~GD~~~~~~L~~iGgkGlFtkele~aLl~g~iDiAVHSl   77 (292)
T TIGR00212        19 REQLKAVYPELDTEIVIIK--TTGDKIQDKPLYDIGGKGLFTKELEQALLDGEIDLAVHSL   77 (292)
T ss_pred             HHHHHHhCCCceEEEEEEe--eeCcccccCcHHHcCCceeeHHHHHHHHhcCCCCEEEecc
Confidence            34555544 5777777442  22322110      1236675 455789999999999776


No 109
>PRK10341 DNA-binding transcriptional activator TdcA; Provisional
Probab=76.99  E-value=12  Score=23.54  Aligned_cols=22  Identities=9%  Similarity=0.259  Sum_probs=18.7

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..+.++..|.+|++|+++...
T Consensus       133 ~~~~~~~~~l~~g~~Dl~i~~~  154 (312)
T PRK10341        133 AQLSSFLPAIRDGRLDFAIGTL  154 (312)
T ss_pred             CCHHHHHHHHHcCCCcEEEecC
Confidence            4567899999999999999754


No 110
>PF03480 SBP_bac_7:  Bacterial extracellular solute-binding protein, family 7;  InterPro: IPR018389 This family of proteins are involved in binding extracellular solutes for transport across the bacterial cytoplasmic membrane. This family includes a C4-dicarboxylate-binding protein DctP [, ] and the sialic acid-binding protein SiaP. The structure of the SiaP receptor has revealed an overall topology similar to ATP binding cassette ESR (extracytoplasmic solute receptors) proteins []. Upon binding of sialic acid, SiaP undergoes domain closure about a hinge region and kinking of an alpha-helix hinge component [].; GO: 0006810 transport, 0030288 outer membrane-bounded periplasmic space; PDB: 2HZK_C 2HZL_B 2HPG_C 2XWI_A 2XWK_A 2WX9_A 2CEY_A 2WYP_A 3B50_A 2CEX_B ....
Probab=76.45  E-value=16  Score=22.91  Aligned_cols=46  Identities=15%  Similarity=0.208  Sum_probs=35.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ..+.+.++.+=++++...+.++.         +.-..++..|..|.+|++..+..
T Consensus        18 fa~~v~e~t~G~v~i~v~~~g~l---------g~~~e~~~~v~~G~vdm~~~~~~   63 (286)
T PF03480_consen   18 FAEEVEERTGGRVKIEVFPAGQL---------GKEAEVLEAVQDGAVDMAVVSPS   63 (286)
T ss_dssp             HHHHHHHHTTTSEEEEEEETTSS---------SSHHHHHHHHHTTSSSEEEEEGG
T ss_pred             HHHHHHHHcCCeEEEEEecCccc---------CCHHHHHHHHhCCCccEEeecch
Confidence            56778888888888876554443         34568999999999999987664


No 111
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator. This group of sequences represents a number of related clades with numerous examples of members adjacent to operons for the degradation of 2-aminoethylphosphonate (AEP) in Pseudomonas, Ralstonia, Bordetella and Burkholderia species. These are transcriptional regulators of the LysR family which contain a helix-turn-helix (HTH) domain (pfam00126) and a periplasmic substrate-binding protein-like domain (pfam03466).
Probab=76.14  E-value=15  Score=22.30  Aligned_cols=21  Identities=10%  Similarity=0.108  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus       120 ~~~~~~~~~l~~g~~Dl~i~~  140 (279)
T TIGR03339       120 GNSQEVLQALQSYRVDVAVSS  140 (279)
T ss_pred             CCHHHHHHHHHcCCCcEEEEe
Confidence            456678899999999999964


No 112
>PRK11716 DNA-binding transcriptional regulator IlvY; Provisional
Probab=75.89  E-value=12  Score=22.53  Aligned_cols=22  Identities=23%  Similarity=0.285  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.-..+...|.+|++|+++...
T Consensus       103 ~~~~~~~~~l~~~~~D~~i~~~  124 (269)
T PRK11716        103 GDAADAVEKVQSGEADLAIAAK  124 (269)
T ss_pred             CCHHHHHHHHHCCCccEEEEec
Confidence            3446788999999999999643


No 113
>PRK12684 transcriptional regulator CysB-like protein; Reviewed
Probab=75.81  E-value=12  Score=23.70  Aligned_cols=21  Identities=14%  Similarity=0.235  Sum_probs=17.8

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.++..|.+|++|+++..
T Consensus       129 ~~~~~~~~~L~~g~~D~~i~~  149 (313)
T PRK12684        129 GSPTQIAEMVLHGQADLAIAT  149 (313)
T ss_pred             CChHHHHHHHHCCCcCEEEee
Confidence            456789999999999999964


No 114
>cd08516 PBP2_NikA_DppA_OppA_like_11 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=75.80  E-value=9.5  Score=25.18  Aligned_cols=39  Identities=10%  Similarity=0.295  Sum_probs=27.9

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ++..-.+++|+++++..               ..|+.+...+..++.|+++.+.
T Consensus       337 ~i~~~l~~~Gi~v~~~~---------------~~~~~~~~~~~~~~~d~~~~~w  375 (457)
T cd08516         337 VIQAQLAAIGINVEIEL---------------VEWATWLDDVNKGDYDATIAGT  375 (457)
T ss_pred             HHHHHHHHcCceEEEEE---------------ecHHHHHHHHhCCCcceeeecc
Confidence            34444556799888875               3577778888888999887654


No 115
>PRK11233 nitrogen assimilation transcriptional regulator; Provisional
Probab=75.61  E-value=17  Score=22.77  Aligned_cols=21  Identities=14%  Similarity=0.170  Sum_probs=17.1

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+...|.+|++|+++..
T Consensus       128 ~~~~~~~~~l~~g~~Di~i~~  148 (305)
T PRK11233        128 NSGATLNEKLMNGQLDMAVIY  148 (305)
T ss_pred             CCcHHHHHHHHCCCCCEEEEc
Confidence            345678889999999999964


No 116
>PRK12680 transcriptional regulator CysB-like protein; Reviewed
Probab=74.39  E-value=13  Score=23.84  Aligned_cols=21  Identities=14%  Similarity=0.166  Sum_probs=18.2

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.++..|.+|++|+++..
T Consensus       129 ~~~~~~~~~l~~g~~Dl~i~~  149 (327)
T PRK12680        129 AAESAALDLLGQGDADIAIVS  149 (327)
T ss_pred             CChHHHHHHHHCCCCcEEEEe
Confidence            457889999999999999965


No 117
>PRK07377 hypothetical protein; Provisional
Probab=74.32  E-value=10  Score=23.37  Aligned_cols=41  Identities=15%  Similarity=0.185  Sum_probs=33.2

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.++.+.+..+.+.|++..+              .-..+..+|.+|++|.+.+.-
T Consensus        97 ~~l~~~~~~y~~rlElv~y~--------------~~~~l~~aL~~~eVh~~c~~~  137 (184)
T PRK07377         97 DQLRTILDKYHLRLELVVYP--------------DLQALEQALRDKEVHAICLES  137 (184)
T ss_pred             HHHHHHHHHhCceeeEEecC--------------CHHHHHHHHhcCCccEEecCC
Confidence            45677888899999998753              467899999999999887654


No 118
>cd00338 Ser_Recombinase Serine Recombinase family, catalytic domain; a DNA binding domain may be present either N- or C-terminal to the catalytic domain. These enzymes perform site-specific recombination of DNA molecules by a concerted, four-strand cleavage and rejoining mechanism which involves a transient phosphoserine linkage between DNA and serine recombinase. Serine recombinases demonstrate functional versatility and include resolvases, invertases, integrases, and transposases. Resolvases and invertases (i.e. Tn3, gamma-delta, Tn5044 resolvases, Gin and Hin invertases) in this family contain a C-terminal DNA binding domain and comprise a major phylogenic group. Also included are phage- and bacterial-encoded recombinases such as phiC31 integrase, SpoIVCA excisionase, and Tn4451 TnpX transposase. These integrases and transposases have larger C-terminal domains compared to resolvases/invertases and are referred to as large serine recombinases. Also belonging to this family are protei
Probab=74.10  E-value=12  Score=20.46  Aligned_cols=50  Identities=12%  Similarity=0.132  Sum_probs=32.2

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      .++..|+..|+...-++.+.+.-|....  .-..|..|+..+..++.|..+.
T Consensus        22 ~~~~~a~~~g~~i~~~~~d~~~s~~~~~--~R~~~~~ll~~~~~~~~d~ivv   71 (137)
T cd00338          22 ALREYAARNGLEVVGEYEDAGSSATSLV--DRPGLQRLLADVKAGKIDVVLV   71 (137)
T ss_pred             HHHHHHHHCCCEEEEEEEeCCCCccccc--CCHHHHHHHHHHHcCCCCEEEE
Confidence            4567777778876555544443332011  1246999999999999997663


No 119
>PRK12681 cysB transcriptional regulator CysB; Reviewed
Probab=74.06  E-value=14  Score=23.68  Aligned_cols=21  Identities=14%  Similarity=0.199  Sum_probs=18.3

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.++..|.+|++|+++..
T Consensus       129 ~~~~~~~~~L~~g~iDl~i~~  149 (324)
T PRK12681        129 GSPTQIAEAAAKGNADFAIAT  149 (324)
T ss_pred             CCHHHHHHHHHcCCCCEEEec
Confidence            567889999999999999964


No 120
>PRK11151 DNA-binding transcriptional regulator OxyR; Provisional
Probab=73.61  E-value=19  Score=22.42  Aligned_cols=22  Identities=18%  Similarity=0.271  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ..-+.++..|.+|++|+++...
T Consensus       127 ~~~~~~~~~l~~g~~Dl~i~~~  148 (305)
T PRK11151        127 AQTHQLLAQLDSGKLDCAILAL  148 (305)
T ss_pred             CCHHHHHHHHHcCCccEEEEec
Confidence            3457899999999999999643


No 121
>PRK10837 putative DNA-binding transcriptional regulator; Provisional
Probab=72.57  E-value=19  Score=22.04  Aligned_cols=21  Identities=5%  Similarity=0.126  Sum_probs=17.4

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus       125 ~~~~~~~~~l~~g~~Di~i~~  145 (290)
T PRK10837        125 GNSQDVINAVLDFRVDIGLIE  145 (290)
T ss_pred             CCHHHHHHHHHhCCceEEEec
Confidence            455678999999999999864


No 122
>PF04069 OpuAC:  Substrate binding domain of ABC-type glycine betaine transport system;  InterPro: IPR007210 This domain is a part of a high affinity multicomponent binding-protein-dependent transport system involved in bacterial osmoregulation. This domain is often fused to the permease component of the transporter complex. It is often found in integral membrane proteins or proteins predicted to be attached to the membrane by a lipid anchor. Glycine betaine is involved in protection from high osmolarity environments for example in Bacillus subtilis []. OpuBC is closely related and involved in choline transport. Choline is necessary for the biosynthesis of glycine betaine []. L-carnitine is important for osmoregulation in Listeria monocytogenes. This domain is found also in proteins binding l-proline (ProX), histidine (HisX) and taurine (TauA).; GO: 0005215 transporter activity, 0005488 binding, 0006810 transport; PDB: 3R6U_A 3TMG_C 3MAM_A 1SW5_C 1SW4_B 1SW1_A 1SW2_A 3O66_A 1R9Q_A 1R9L_A ....
Probab=72.16  E-value=16  Score=22.62  Aligned_cols=40  Identities=5%  Similarity=0.094  Sum_probs=30.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      |+..+-+..|+..++...              +...-+..+|.+|++|+.....
T Consensus        19 i~~~~Le~~G~~v~~~~~--------------~~~~~~~~al~~G~iD~~~~~w   58 (257)
T PF04069_consen   19 IYAQLLEAAGYVVEVVNL--------------GSTPVIFAALASGDIDIYPEEW   58 (257)
T ss_dssp             HHHHHHHHTTEEEEEEEE--------------SSHHHHHHHHHTTSSSEEEEEE
T ss_pred             HHHHHHHHCCCeEEEecC--------------CchHHHHHHHHCCCCeEEhhhc
Confidence            556667777998877753              3456788999999999987443


No 123
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed
Probab=72.04  E-value=14  Score=22.87  Aligned_cols=21  Identities=5%  Similarity=-0.029  Sum_probs=17.4

Q ss_pred             chhhHHHhhhcCCccEEEeCC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....+.+|.+|++|.++++-
T Consensus       181 ~~~~~~~~l~~GrvDa~~~d~  201 (259)
T PRK11917        181 DYPSIKAALDAKRVDAFSVDK  201 (259)
T ss_pred             CHHHHHHHHHcCCCcEEEecH
Confidence            467788999999999987764


No 124
>cd08490 PBP2_NikA_DppA_OppA_like_3 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=72.02  E-value=13  Score=24.63  Aligned_cols=39  Identities=13%  Similarity=0.399  Sum_probs=27.4

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +..-.+++|+++++...               .|+.+...+..++.|+++.+..
T Consensus       341 i~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~d~~~~~~~  379 (470)
T cd08490         341 IQAQLKKIGIDVEIRVV---------------EYDAIEEDLLDGDFDLALYSRN  379 (470)
T ss_pred             HHHHHHHcCceEEEEEe---------------ehhhhhhHhhcCCccEEEeccc
Confidence            33334557999998753               4666777777888998887654


No 125
>cd08457 PBP2_OccR The C-terminal substrate-domain of LysR-type transcriptional regulator, OccR, involved in the catabolism of octopine, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator OccR, which is involved in the catabolism of octopine. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  OccR protein activates the occQ operon of the Ti plasmid in response to octopine. This operon encodes proteins required for the uptake and catabolism of octopine, an arginine derivative. The occ operon also encodes the TraR protein, which is a quorum-sensing transcriptional regulator of the Ti plasmid tra regulon.  This substrate-binding domain shows significant h
Probab=71.75  E-value=15  Score=20.46  Aligned_cols=21  Identities=19%  Similarity=0.245  Sum_probs=16.8

Q ss_pred             chhhHHHhhhcCCccEEEeCC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .-..+...|.+|++|+++...
T Consensus        37 ~~~~~~~~l~~~~~Dl~i~~~   57 (196)
T cd08457          37 SSSQVLEAVASGRADLGIADG   57 (196)
T ss_pred             CcHHHHHHHHcCCccEEEecc
Confidence            346788889999999999754


No 126
>cd05800 PGM_like2 This PGM-like (phosphoglucomutase-like) protein of unknown function belongs to the alpha-D-phosphohexomutase superfamily and is found in both archaea and bacteria. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four structural domains (subdomains) with a centrally located active site formed by four loops, one from each subdomain. All four subdomains are included in this alignment model.
Probab=70.48  E-value=14  Score=25.05  Aligned_cols=53  Identities=19%  Similarity=0.248  Sum_probs=33.5

Q ss_pred             hHHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           2 DLLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      .++..+-+++|+++... ..+|+.++...|+.....-..+...+....+|++++
T Consensus       187 ~~~~~il~~lg~~v~~~~~~~dg~F~~~~p~p~~~~l~~l~~~v~~~~ad~Gia  240 (461)
T cd05800         187 GYLEELLRGAGVDVEEIRAERDPLFGGIPPEPIEKNLGELAEAVKEGGADLGLA  240 (461)
T ss_pred             HHHHHHHHHcCCCEEEeeCCcCCCCCCCCCCCCHHHHHHHHHHHHhcCCCEEEE
Confidence            35677888999877443 456777654433311223345666777888999875


No 127
>PRK12682 transcriptional regulator CysB-like protein; Reviewed
Probab=70.11  E-value=17  Score=22.79  Aligned_cols=22  Identities=14%  Similarity=0.238  Sum_probs=17.7

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.-+.+...|..|++|+++..-
T Consensus       129 ~~~~~~~~~l~~g~~D~~i~~~  150 (309)
T PRK12682        129 GSPDEIARMVISGEADIGIATE  150 (309)
T ss_pred             CCHHHHHHHHHcCCccEEEecC
Confidence            3446788999999999999753


No 128
>CHL00180 rbcR LysR transcriptional regulator; Provisional
Probab=69.76  E-value=21  Score=22.34  Aligned_cols=21  Identities=5%  Similarity=0.185  Sum_probs=18.2

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus       131 ~~~~~~~~~l~~g~~Dl~i~~  151 (305)
T CHL00180        131 HSTRRIAWNVANGQIDIAIVG  151 (305)
T ss_pred             CCHHHHHHHHHcCCccEEEEc
Confidence            457889999999999999974


No 129
>cd08507 PBP2_SgrR_like The C-terminal solute-binding domain of DNA-binding transcriptional regulator SgrR is related to the ABC-type oligopeptide-binding proteins and contains the type 2 periplasmic-binding fold. A novel family of SgrR transcriptional regulator contains a two-domain structure with an N terminal DNA-binding domain of the winged helix family and a C-terminal solute-binding domain. The C-terminal domain shows strong homology with the ABC-type oligopeptide-binding protein family, a member of the type 2 periplasmic-binding fold protein (PBP2) superfamily that also includes the C-terminal substrate-binding domain of LysR-type transcriptional regulators. SgrR (SugaR transport-related Regulator) is negatively autoregulated and activates transcription of divergent operon SgrS, which encodes a small RNA required for recovery from glucose-phosphate stress.  Hence, the small RNA SgrS and SgrR, the transcription factor that controls sgrS expression, are both required for recovery f
Probab=69.18  E-value=12  Score=24.98  Aligned_cols=40  Identities=5%  Similarity=0.147  Sum_probs=27.8

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++.+..+..|+++++...               .|+.+...+..|..|+.+.+.+
T Consensus       316 ~l~~~l~~~Gi~v~l~~~---------------~~~~~~~~~~~g~~d~~~~~~~  355 (448)
T cd08507         316 WIQQRLAKHGIRLEIHIL---------------SYEELLEGDADSMADLWLGSAN  355 (448)
T ss_pred             HHHHHHHHcCcEEEEEee---------------cccchhhhhhhhccCeeecccc
Confidence            455555678999999764               4566666667788888776654


No 130
>COG1638 DctP TRAP-type C4-dicarboxylate transport system, periplasmic component [Carbohydrate transport and metabolism]
Probab=68.93  E-value=22  Score=23.45  Aligned_cols=47  Identities=13%  Similarity=0.232  Sum_probs=38.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCcc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSV   58 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lti   58 (62)
                      +.+.+.++.|=++++..-|+++-|.         =..++..|..|.+|+.+.+.+.
T Consensus        49 fa~~v~ekt~G~l~i~vfP~~qLG~---------~~~~ie~l~~G~id~~~~s~~~   95 (332)
T COG1638          49 FAELVEEKTGGRLKIEVFPNSQLGG---------EAEMIEQLRSGTLDIGVVSLGF   95 (332)
T ss_pred             HHHHHHHHhCCeEEEEECCCcccCc---------HHHHHHHHhcCCeeEEeccchh
Confidence            5678888999999999888777663         3578999999999999887643


No 131
>PRK11063 metQ DL-methionine transporter substrate-binding subunit; Provisional
Probab=68.91  E-value=17  Score=23.20  Aligned_cols=36  Identities=14%  Similarity=0.194  Sum_probs=26.5

Q ss_pred             HHHHH-HHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           4 LENIA-QELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         4 l~~la-~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      ++.+. ++.|++++++..              ..+..+..+|.+|++|+..
T Consensus        49 ~~~~l~~~~G~~Vel~~f--------------~~~~~~~~ALa~GdID~~~   85 (271)
T PRK11063         49 AQKVAKEKYGLDVELVTF--------------NDYVLPNEALSKGDIDANA   85 (271)
T ss_pred             HHHHHHHhcCCeEEEEEe--------------cCcHHHHHHHHcCCcceec
Confidence            33444 445999999864              3577888999999999854


No 132
>TIGR00363 lipoprotein, YaeC family. This family of putative lipoproteins contains a consensus site for lipoprotein signal sequence cleavage. Included in this family is the E. coli hypothetical protein yaeC. About half of the proteins between the noise and trusted cutoffs contain the consensus lipoprotein signature and may belong to this family.
Probab=68.82  E-value=21  Score=22.71  Aligned_cols=31  Identities=10%  Similarity=0.080  Sum_probs=25.2

Q ss_pred             HcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313          10 ELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus        10 ~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +.|++++++..              ..|..+..+|.+|++|+...
T Consensus        43 ~~G~~Ve~~~f--------------~d~~~~~~Al~~G~ID~~~~   73 (258)
T TIGR00363        43 KYGLDVELVEF--------------NDYALPNEAVSKGDLDANAF   73 (258)
T ss_pred             hcCCEEEEEEe--------------CCcHHHHHHHHcCCCCeEec
Confidence            46999999864              35888999999999998754


No 133
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein. The model describes the molybdate ABC transporter periplasmic binding protein in bacteria and archae. Several of the periplasmic receptors constitute a diverse class of binding proteins that differ widely in size, sequence and ligand specificity. It has been shown experimentally by radioactive labeling that ModA represent hydrophylioc periplasmic-binding protein in gram-negative organisms and its counterpart in gram-positive organisms is a lipoprotein. The other components of the system include the ModB, an integral membrane protein and ModC the ATP-binding subunit. Invariably almost all of them display a common beta/alpha folding motif and have similar tertiary structures consisting of two globular domains.
Probab=68.49  E-value=22  Score=21.04  Aligned_cols=39  Identities=8%  Similarity=0.136  Sum_probs=24.8

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC-CccEEEeC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG-TAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g-~~D~av~~   55 (62)
                      +++++..++.+++++++.               +.=..++..|..| ++|+.+++
T Consensus        10 ~~~~~f~~~~gi~V~~~~---------------~gs~~l~~~l~~~~~aDv~~~~   49 (216)
T TIGR01256        10 EIAKQFEKRTGNKVVFSF---------------GSSGTLYTQIENGAPADLFISA   49 (216)
T ss_pred             HHHHHHHHhhCCeEEEEe---------------CChHHHHHHHHcCCCCcEEEEC
Confidence            355666677788887764               2223455666655 59998874


No 134
>cd08512 PBP2_NikA_DppA_OppA_like_7 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=68.19  E-value=19  Score=23.94  Aligned_cols=38  Identities=5%  Similarity=0.122  Sum_probs=27.1

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+-.+++|+++++..               ..|+.+...+..|+.|+++.+.
T Consensus       354 i~~~l~~~Gi~v~~~~---------------~~~~~~~~~~~~~~~d~~~~~w  391 (476)
T cd08512         354 LQASLAQIGIKVEIEP---------------VPWAQLLEAARSREFDIFIGGW  391 (476)
T ss_pred             HHHHHHHhCCeEEEEE---------------cCHHHHHHHhhCCCccEEEEec
Confidence            3444455788888875               3577777888888999887654


No 135
>cd08504 PBP2_OppA The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an ATP-binding cassette (ABC)-type oligopeptide transport system comprised of 5 subunits. The transport system OppABCDEF contains two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which 
Probab=68.19  E-value=16  Score=24.41  Aligned_cols=40  Identities=13%  Similarity=0.240  Sum_probs=28.1

Q ss_pred             HHHHHHHH-cCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQE-LEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~-l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++....++ .|+++++...               .|+.+...+..++.|+++.+..
T Consensus       362 ~i~~~l~~~iGI~v~i~~~---------------~~~~~~~~~~~~~~d~~~~~~~  402 (498)
T cd08504         362 AIQQMWKKNLGVKVTLKNV---------------EWKVFLDRRRKGDFDIARSGWG  402 (498)
T ss_pred             HHHHHHHHcCCCeEEEEec---------------chHHhhhhccCCCeeEEecccc
Confidence            45556677 8999998753               4666666677788888876553


No 136
>TIGR02424 TF_pcaQ pca operon transcription factor PcaQ. Members of this family are LysR-family transcription factors associated with operons for catabolism of protocatechuate. Members occur only in Proteobacteria.
Probab=68.19  E-value=25  Score=21.73  Aligned_cols=22  Identities=14%  Similarity=0.160  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....++.+|.+|++|++++..
T Consensus       129 ~~~~~~~~~l~~g~~D~~i~~~  150 (300)
T TIGR02424       129 GPNAYLLDQLRVGALDLVVGRL  150 (300)
T ss_pred             CchHHHHHHHHCCCCCEEEEec
Confidence            4557789999999999999644


No 137
>TIGR03414 ABC_choline_bnd choline ABC transporter, periplasmic binding protein. Partial phylogenetic profiling (PubMed:16930487) vs. the genome property of glycine betaine biosynthesis from choline consistently reveals a member of this ABC transporter periplasmic binding protein as the best match, save for the betaine biosynthesis enzymes themselves. Genomes often carry several paralogs, one encoded together with the permease and ATP-binding components and another encoded next to a choline-sulfatase gene, suggesting that different members of this protein family interact with shared components and give some flexibility in substrate. Of two members from Sinorhizobium meliloti 1021, one designated ChoX has been shown experimentally to bind choline (though not various related compounds such as betaine) and to be required for about 60 % of choline uptake. Members of this protein have an invariant Cys residue near the N-terminus and likely are lipoproteins.
Probab=68.14  E-value=14  Score=23.73  Aligned_cols=38  Identities=11%  Similarity=0.089  Sum_probs=27.6

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      |++.+-+.+|++++++.               +.-.-+...|.+|++|+.+..
T Consensus        26 i~~~iLE~~Gy~Ve~~~---------------~~~~~~~~al~~GdiD~~~e~   63 (290)
T TIGR03414        26 LASVLLEGLGYQPKVTL---------------LSVPVTYAGLKDGDLDVFLGN   63 (290)
T ss_pred             HHHHHHHHcCCcceeEE---------------ccHHHHHHHHHcCCceEeccc
Confidence            56667777899888864               233556778889999987644


No 138
>cd06353 PBP1_BmpA_Med_like Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea. Periplasmic binding domain of the basic membrane lipoprotein Med in Bacillus and its close homologs from other bacteria and Archaea.  Med, a cell-surface localized protein, which regulates the competence transcription factor gene comK in Bacillus subtilis, lacks the DNA binding domain when compared with structures of transcription regulators from the LacI family. Nevertheless, Med has significant overall sequence homology to various periplasmic substrate-binding proteins. Moreover, the structure of Med shows a striking similarity to PnrA, a periplasmic nucleoside binding protein of an ATP-binding cassette transport system. Members of this group contain the type I periplasmic sugar-binding protein-like fold.
Probab=68.01  E-value=18  Score=22.58  Aligned_cols=41  Identities=10%  Similarity=0.070  Sum_probs=30.7

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++++++.+|.+++++....      .    ...|...+.++.+..+|++++
T Consensus        23 ~~~~~~~~gv~~~~~e~~~------~----~~~~~~~i~~~~~~g~dlIi~   63 (258)
T cd06353          23 RKAAEKALGVEVTYVENVP------E----GADAERVLRELAAQGYDLIFG   63 (258)
T ss_pred             HHHHHHhcCCeEEEEecCC------c----hHhHHHHHHHHHHcCCCEEEE
Confidence            4567777899888876431      1    246889999999888999886


No 139
>PRK09791 putative DNA-binding transcriptional regulator; Provisional
Probab=67.66  E-value=22  Score=22.11  Aligned_cols=21  Identities=10%  Similarity=0.303  Sum_probs=17.8

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....+...|.+|++|+++..
T Consensus       131 ~~~~~~~~~l~~g~~Di~i~~  151 (302)
T PRK09791        131 GQLVSMINELRQGELDFTINT  151 (302)
T ss_pred             CChHHHHHHHHCCCccEEEEe
Confidence            456789999999999999874


No 140
>cd03089 PMM_PGM The phosphomannomutase/phosphoglucomutase (PMM/PGM) bifunctional enzyme catalyzes the reversible conversion of 1-phospho to 6-phospho-sugars (e.g. between mannose-1-phosphate and mannose-6-phosphate or glucose-1-phosphate and glucose-6-phosphate) via a bisphosphorylated sugar intermediate. The reaction involves two phosphoryl transfers, with an intervening 180 degree reorientation of the reaction intermediate during catalysis. Reorientation of the intermediate occurs without dissociation from the active site of the enzyme and is thus, a simple example of processivity, as defined by multiple rounds of catalysis without release of substrate. Glucose-6-phosphate and glucose-1-phosphate are known to be utilized for energy metabolism and cell surface construction, respectively. PMM/PGM belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other membe
Probab=67.17  E-value=19  Score=24.27  Aligned_cols=52  Identities=10%  Similarity=0.250  Sum_probs=35.0

Q ss_pred             HHHHHHHHcCCeEEE-EEecCCcccceeccCC-CcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHL-YIVADGLYGTKVRENQ-KDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~-~~~~~~~~G~~~~~~~-~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++.. ...+|+.++...|+.. ...+..+...+...++|++++
T Consensus       178 ~~~~ll~~lG~~v~~i~~~~d~~F~~~~p~p~~~~~l~~l~~~v~~~~adlgia  231 (443)
T cd03089         178 IAPQLLEALGCEVIPLFCEPDGTFPNHHPDPTDPENLEDLIAAVKENGADLGIA  231 (443)
T ss_pred             HHHHHHHHCCCEEEEecCCCCCCCCCCCcCCCCHHHHHHHHHHHHHcCCCEEEE
Confidence            567788889997533 3557777765444311 134677788888889999885


No 141
>PRK09906 DNA-binding transcriptional regulator HcaR; Provisional
Probab=66.65  E-value=28  Score=21.50  Aligned_cols=23  Identities=13%  Similarity=0.001  Sum_probs=18.7

Q ss_pred             cchhhHHHhhhcCCccEEEeCCc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ...+.++..|.+|++|+++....
T Consensus       126 ~~~~~~~~~l~~~~~D~~i~~~~  148 (296)
T PRK09906        126 LITTQQEEKLRRGELDVGFMRHP  148 (296)
T ss_pred             CCcHHHHHHHHcCCeeEEEecCC
Confidence            34678999999999999997543


No 142
>cd08498 PBP2_NikA_DppA_OppA_like_2 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=64.88  E-value=25  Score=23.56  Aligned_cols=38  Identities=8%  Similarity=0.049  Sum_probs=26.6

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..-.+++|+++++..               ..|+.+...+..|+.|+++.+.
T Consensus       351 i~~~l~~~Gi~v~i~~---------------~~~~~~~~~~~~~~~d~~~~~w  388 (481)
T cd08498         351 VAGMLARIGIKVNLET---------------MPKSVYFPRATKGEADFYLLGW  388 (481)
T ss_pred             HHHHHHHhCceEEEEE---------------ecHHHHHHHhhCCCcCEEEEcc
Confidence            3334455788888865               3577777778888899887654


No 143
>COG2113 ProX ABC-type proline/glycine betaine transport systems, periplasmic components [Amino acid transport and metabolism]
Probab=64.58  E-value=15  Score=24.12  Aligned_cols=39  Identities=15%  Similarity=0.116  Sum_probs=30.8

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +++.+-+.+|++.+++.               +...-|...|.+|++|+....-
T Consensus        49 v~~~iLk~~Gy~v~~~~---------------~~~~~~~~sla~gd~D~~~~~W   87 (302)
T COG2113          49 VAKKILKGLGYTVELVT---------------LDTAVMYQSLAKGDLDVFPEAW   87 (302)
T ss_pred             HHHHHHHhCCCcceeee---------------ccHHHHHHHHHcCCCcccccee
Confidence            45566699999998875               5678888899999999876544


No 144
>PRK10918 phosphate ABC transporter periplasmic substrate-binding protein PstS; Provisional
Probab=63.96  E-value=21  Score=23.74  Aligned_cols=25  Identities=16%  Similarity=0.284  Sum_probs=20.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCCcccc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALSVSS   60 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~ltit~   60 (62)
                      |+-.| +.++.+|.+||+.++..+++
T Consensus        62 GSG~G-i~~~~~g~vd~a~ssr~l~~   86 (346)
T PRK10918         62 GSSGG-VKQIIANTVDFGASDAPLSD   86 (346)
T ss_pred             ccHHH-HHHHHhCCCcEEecCccCCH
Confidence            56566 57789999999999887764


No 145
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism]
Probab=63.77  E-value=10  Score=24.00  Aligned_cols=31  Identities=16%  Similarity=0.191  Sum_probs=24.6

Q ss_pred             HHcCC-eEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           9 QELEF-DFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         9 ~~l~f-~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      ++.|. .++++..              ..|...+..|..|++|+++
T Consensus        56 ~~~Gl~~v~~~~~--------------~~~~~~~~~l~~G~~D~a~   87 (335)
T COG0715          56 KKEGLDDVELVEF--------------TGGAPVLEALAAGALDFAV   87 (335)
T ss_pred             hHhCCCceEEEEc--------------CCChHHHHHHhcCCcCccc
Confidence            44566 4777763              4799999999999999994


No 146
>cd08520 PBP2_NikA_DppA_OppA_like_21 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=63.59  E-value=26  Score=23.38  Aligned_cols=38  Identities=3%  Similarity=0.070  Sum_probs=27.2

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..-.+++|+++++..               ..|+.+...+..++.|+++.+.
T Consensus       349 i~~~l~~iGi~v~i~~---------------~~~~~~~~~~~~~~~d~~~~~~  386 (468)
T cd08520         349 IKEQLERVGIKVNVKS---------------LESKTLDSAVKDGDYDLAISGH  386 (468)
T ss_pred             HHHHHHHcCceEEEEe---------------cChHHHHHHHhCCCeeEEEecc
Confidence            4444456899988875               3577777778888899887654


No 147
>PRK10082 cell density-dependent motility repressor; Provisional
Probab=63.58  E-value=20  Score=22.41  Aligned_cols=22  Identities=18%  Similarity=0.166  Sum_probs=18.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .....++..|.+|++|+++...
T Consensus       134 ~~~~~~~~~l~~g~~Dlai~~~  155 (303)
T PRK10082        134 IDVDEAVDKLREGQSDCIFSFH  155 (303)
T ss_pred             CCHHHHHHHHHCCCCCEEEEec
Confidence            4567899999999999999753


No 148
>PRK11482 putative DNA-binding transcriptional regulator; Provisional
Probab=63.27  E-value=26  Score=22.26  Aligned_cols=22  Identities=9%  Similarity=-0.005  Sum_probs=18.1

Q ss_pred             chhhHHHhhhcCCccEEEeCCc
Q psy2313          36 KWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .++.++..|.+|++|+++....
T Consensus       152 ~~~~~~~~l~~g~~Dl~i~~~~  173 (317)
T PRK11482        152 PISDAENQLSQFQTDLIIDTHS  173 (317)
T ss_pred             cchhHHHHHHCCCcCEEEeccC
Confidence            4567899999999999997543


No 149
>PRK13348 chromosome replication initiation inhibitor protein; Provisional
Probab=62.93  E-value=30  Score=21.38  Aligned_cols=22  Identities=14%  Similarity=0.051  Sum_probs=18.0

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +..+.+...|.+|++|+++...
T Consensus       125 ~~~~~~~~~L~~~~~d~~i~~~  146 (294)
T PRK13348        125 DDQDHTFALLERGEVVGCVSTQ  146 (294)
T ss_pred             cchHHHHHHHhcCCeEEEEecC
Confidence            4567888999999999998654


No 150
>cd08497 PBP2_NikA_DppA_OppA_like_14 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=62.79  E-value=28  Score=23.55  Aligned_cols=39  Identities=18%  Similarity=-0.009  Sum_probs=27.7

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +..-.+++|+++++..               ..|+.+...+..|..|+++....
T Consensus       366 i~~~l~~iGi~v~i~~---------------~~~~~~~~~~~~g~~d~~~~~~~  404 (491)
T cd08497         366 YVRNLKKLGIDASLRL---------------VDSAQYQKRLRSFDFDMITAAWG  404 (491)
T ss_pred             HHHHHHhcCceEEEee---------------ccHHHHHHHhhcCCeeEEEeccC
Confidence            3444456899999875               35777777778888888876653


No 151
>PRK12679 cbl transcriptional regulator Cbl; Reviewed
Probab=62.65  E-value=29  Score=21.96  Aligned_cols=22  Identities=18%  Similarity=0.155  Sum_probs=17.6

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.-+.+...|.+|++|+++...
T Consensus       129 ~~~~~~~~~L~~g~~Dl~i~~~  150 (316)
T PRK12679        129 GTPQEIATLLQNGEADIGIASE  150 (316)
T ss_pred             CCHHHHHHHHHcCCCCEEEecc
Confidence            4456788999999999998643


No 152
>cd08458 PBP2_NocR The C-terminal substrate-domain of LysR-type transcriptional regulator, NocR, involved in the catabolism of nopaline, contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate-domain of LysR-type transcriptional regulator NocR, which is involved in the catabolism of nopaline. Opines are low molecular weight compounds found in plant crown gall tumors produced by the parasitic bacterium Agrobacterium. There are at least 30 different opines identified so far. Opines are utilized by tumor-colonizing bacteria as a source of carbon, nitrogen, and energy. In Agrobacterium tumefaciens,  NocR regulates expression of the divergently transcribed nocB and nocR genes of the nopaline catabolism (noc) region.   This substrate-binding domain shows significant homology to the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, an
Probab=62.07  E-value=26  Score=19.58  Aligned_cols=22  Identities=9%  Similarity=-0.026  Sum_probs=17.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.-..+...|.+|++|+++...
T Consensus        36 ~~~~~~~~~l~~g~~Dl~i~~~   57 (196)
T cd08458          36 VPSQTVLELVSLQHYDLGISIL   57 (196)
T ss_pred             cChHHHHHHHHcCCCCEEEEec
Confidence            3455688889999999998743


No 153
>cd08493 PBP2_DppA_like The substrate-binding component of an ABC-type dipeptide import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an ATP-binding cassette (ABC)-type dipeptide import system. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis.  Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine.  The PBP2 bind their li
Probab=61.82  E-value=30  Score=23.10  Aligned_cols=39  Identities=5%  Similarity=0.211  Sum_probs=26.8

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +....++.|+++++...               .|+.+...+..++.|++..+..
T Consensus       359 i~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~dl~~~~~~  397 (482)
T cd08493         359 IQADLAKVGIKVEIVTY---------------EWGEYLERTKAGEHDLYLLGWT  397 (482)
T ss_pred             HHHHHHHhCCEEEEEEe---------------eHHHHHHHhhCCCCCEEEEccc
Confidence            34444668898888753               4667777777888888775543


No 154
>cd08492 PBP2_NikA_DppA_OppA_like_15 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=61.38  E-value=25  Score=23.39  Aligned_cols=39  Identities=10%  Similarity=0.262  Sum_probs=26.5

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +..-.+++|+++++...               .|+.+...+.+++.|+++.+.+
T Consensus       364 i~~~l~~iGi~v~i~~~---------------~~~~~~~~~~~~~~d~~~~~~~  402 (484)
T cd08492         364 IQAQLKEVGIDLQLKVL---------------DAGTLTARRASGDYDLALSYYG  402 (484)
T ss_pred             HHHHHHhhCeEEEEEEe---------------chHHHHHhhhcCCceEEEEecc
Confidence            34444668999998764               4666666667788888776543


No 155
>cd05799 PGM2 This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and deoxyribose-1-phosphate to the corresponding 5-phosphopentoses. PGM2L1 is thought to catalyze the 1,3-bisphosphoglycerate-dependent synthesis of glucose 1,6-bisphosphate and other aldose-bisphosphates that serve as cofactors for several sugar phosphomutases and possibly also as regulators of glycolytic enzymes. PGM2 and PGM2L1 belong to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/ph
Probab=60.91  E-value=21  Score=24.40  Aligned_cols=52  Identities=13%  Similarity=0.054  Sum_probs=34.2

Q ss_pred             hHHHHHHHHcCCe----EEEEEecCCcccc---eeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           2 DLLENIAQELEFD----FHLYIVADGLYGT---KVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~----~~~~~~~~~~~G~---~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      .++..+.+.||++    +++...+|+.|+.   ++|. ....+..+...+....+|++++
T Consensus       200 ~~~~~il~~LG~~~v~~~~~~~~~d~~F~~~~~p~p~-~~~~l~~l~~~v~~~~ad~Gia  258 (487)
T cd05799         200 KFVPRALKEAGFTNVIVVEEQAEPDPDFPTVKFPNPE-EPGALDLAIELAKKVGADLILA  258 (487)
T ss_pred             HHHHHHHHHcCCCCcEEeeeccCCCcCCCCCCCCCCC-CHHHHHHHHHHHHHhCCCEEEE
Confidence            3577888899988    4444556777753   3331 0134666777777889999875


No 156
>cd08511 PBP2_NikA_DppA_OppA_like_5 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is mos
Probab=60.55  E-value=41  Score=22.36  Aligned_cols=38  Identities=16%  Similarity=0.262  Sum_probs=25.4

Q ss_pred             HHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           5 ENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         5 ~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +.-.+.+|+++++...               .++.+...+..|+.|+++.+..
T Consensus       339 ~~~l~~~Gi~v~i~~~---------------~~~~~~~~~~~~~~di~~~~w~  376 (467)
T cd08511         339 QAMAAEAGFTVKLRPT---------------EFATLLDRALAGDFQATLWGWS  376 (467)
T ss_pred             HHHHHhcCcEeEEEEc---------------cHHHHHHHHhCCCccEEEeccc
Confidence            3334557888877653               4666667777889998876543


No 157
>cd08489 PBP2_NikA The substrate-binding component of an ABC-type nickel import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel transport system, which functions in the import of nickel and in the control of chemotactic response away from nickel. The ATP-binding cassette (ABC) type nickel transport system is comprised of five subunits NikABCDE: the two pore-forming integral inner membrane proteins NikB and NikC; the two inner membrane-associated proteins with ATPase activity NikD and NikE; and the periplasmic nickel binding NikA, the initial nickel receptor. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides,
Probab=60.48  E-value=28  Score=23.33  Aligned_cols=34  Identities=9%  Similarity=0.131  Sum_probs=24.6

Q ss_pred             HHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           5 ENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         5 ~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      ..-.+++|+++++...               .|+.+...+..|..|+++
T Consensus       355 ~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~d~~~  388 (488)
T cd08489         355 QSELKKIGIDLNIIGE---------------EEQAYYDRQKDGDFDLIF  388 (488)
T ss_pred             HHHHHHcCcEEEEeec---------------cHHHHHhHhhCCcccEEE
Confidence            3344557999998763               566777777888888876


No 158
>PRK10094 DNA-binding transcriptional activator AllS; Provisional
Probab=60.31  E-value=32  Score=21.69  Aligned_cols=19  Identities=16%  Similarity=0.225  Sum_probs=15.8

Q ss_pred             chhhHHHhhhcCCccEEEe
Q psy2313          36 KWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~   54 (62)
                      .-..+...|.+|++|++++
T Consensus       130 ~~~~~~~~l~~g~~D~~i~  148 (308)
T PRK10094        130 IYMGVWDSLLYEGFSLAIG  148 (308)
T ss_pred             hhhhHHHHHhCCCccEEEe
Confidence            3467888999999999885


No 159
>PRK15092 DNA-binding transcriptional repressor LrhA; Provisional
Probab=59.79  E-value=37  Score=21.58  Aligned_cols=20  Identities=5%  Similarity=0.023  Sum_probs=16.6

Q ss_pred             chhhHHHhhhcCCccEEEeC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~   55 (62)
                      ....++..|.+|++|+++..
T Consensus       136 ~~~~~~~~l~~g~~Di~i~~  155 (310)
T PRK15092        136 RNAFMMEMLESQEVDLAVTT  155 (310)
T ss_pred             CcHHHHHHHhCCCeeEEEEe
Confidence            45678889999999999864


No 160
>PF00496 SBP_bac_5:  Bacterial extracellular solute-binding proteins, family 5 Middle;  InterPro: IPR000914 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins and a high affinity periplasmic solute-binding protein. The latter are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into Gram-positive bacteria which are surrounded by a single membrane and therefore have no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homologue proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system. In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways. On the basis of sequence similarities, the vast majority of these solute-binding proteins can be grouped [] into eight families of clusters, which generally correlate with the nature of the solute bound. Family 5 currently includes periplasmic oligopeptide-binding proteins (oppA) of Gram-negative bacteria and homologous lipoproteins in Gram-positive bacteria (oppA, amiA or appA); periplasmic dipeptide-binding proteins of Escherichia coli (dppA) and Bacillus subtilis (dppE); periplasmic murein peptide-binding protein of E. coli (mppA); periplasmic peptide-binding proteins sapA of E. coli, Salmonella typhimurium and Haemophilus influenzae; periplasmic nickel-binding protein (nikA) of E. coli; haem-binding lipoprotein (hbpA or dppA) from H. influenzae; lipoprotein xP55 from Streptomyces lividans; and hypothetical proteins from H. influenzae (HI0213) and Rhizobium sp. (strain NGR234) symbiotic plasmid (y4tO and y4wM).; GO: 0005215 transporter activity, 0006810 transport; PDB: 1B51_A 1B0H_A 1QKA_A 1B9J_A 1B6H_A 1OLA_A 1B3L_C 1JEV_A 1B5H_A 1JET_A ....
Probab=59.64  E-value=30  Score=21.97  Aligned_cols=39  Identities=15%  Similarity=0.252  Sum_probs=28.8

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcch-hhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKW-NGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w-~g~ig~l~~g~~D~av~~lt   57 (62)
                      +..-.+++|+++++...               .| +.....+..|+.|+++...+
T Consensus       314 l~~~l~~~Gi~v~i~~~---------------~~~~~~~~~~~~~~~d~~~~~~~  353 (374)
T PF00496_consen  314 LQEQLKKIGIKVEIKPV---------------DFNDTYDKRLRAGDFDMALSGWS  353 (374)
T ss_dssp             HHHHHHHTTEEEEEEEE---------------SHHHHHHHHHHCTSESEEEEEEE
T ss_pred             HHHHHhhcceeEEEEEe---------------ChHHHHHHHhhCCCcCEEEEecC
Confidence            44444568999999874               57 56667788999999987654


No 161
>PLN02371 phosphoglucosamine mutase family protein
Probab=59.14  E-value=22  Score=25.18  Aligned_cols=52  Identities=15%  Similarity=0.366  Sum_probs=34.8

Q ss_pred             HHHHHHHHcCCeEE--EEEecCCcccceeccCC-CcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFH--LYIVADGLYGTKVRENQ-KDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~--~~~~~~~~~G~~~~~~~-~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++.  +...+|+.|+...|+.. ...+..+...+...++|++++
T Consensus       278 ~~~~lL~~LG~~v~~~~~~~pDg~Fp~~~P~P~~~~~l~~l~~~v~~~~aDlGia  332 (583)
T PLN02371        278 FAEKVLEPLGADTSGSLFLEPDGMFPNHIPNPEDKAAMSATTQAVLANKADLGII  332 (583)
T ss_pred             HHHHHHHHcCCCeEeeccCCCCCCCCCcCCCCCCHHHHHHHHHHHHhcCCCEEEE
Confidence            46677788998754  44557787764444311 123667777888899999885


No 162
>cd08499 PBP2_Ylib_like The substrate-binding component of an uncharacterized ABC-type peptide import system Ylib contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding component of an uncharacterized ATP-binding cassette (ABC)-type peptide transport system YliB. Although the ligand specificity of Ylib protein is not known, it shares significant sequence similarity to the ABC-type dipeptide and oligopeptide binding proteins. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine.  The PBP2 bind their ligand in the cleft between these domains in a manner resembling
Probab=58.43  E-value=36  Score=22.68  Aligned_cols=38  Identities=11%  Similarity=0.356  Sum_probs=25.6

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCC-ccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGT-AHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~-~D~av~~l   56 (62)
                      +.+-.+++|+++++...               .|+.+...+..++ .|+++.+.
T Consensus       338 i~~~l~~~GI~v~i~~~---------------~~~~~~~~~~~~~~~dl~~~~w  376 (474)
T cd08499         338 IQQQLAQIGIDVEIEVM---------------EWGAYLEETGNGEEHQMFLLGW  376 (474)
T ss_pred             HHHHHHHcCceEEEEec---------------cHHHHHHHhcCCCcccEEEEec
Confidence            33334557888888753               5777777777777 88877544


No 163
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region. Members of this family are ABC transporter periplasmic binding proteins associated with the urea carboxylase/allophanate hydrolase pathway, an alternative to urease for urea degradation. The protein is restricted to bacteria with the pathway, with its gene close to the urea carboxylase and allophanate hydrolase genes. The substrate for this transporter therefore is likely to be urea or a compound from which urea is easily derived.
Probab=58.00  E-value=32  Score=22.52  Aligned_cols=32  Identities=3%  Similarity=0.100  Sum_probs=23.1

Q ss_pred             HHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           9 QELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         9 ~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +..|++++++..+              .....+.++.+|++|++..
T Consensus        31 ~~~Gl~Ve~~~f~--------------~~~~~l~Al~aG~iD~~~~   62 (328)
T TIGR03427        31 DKYGITIEVVQIN--------------DYVESINQYTAGKFDGCTM   62 (328)
T ss_pred             HHcCCeEEEEECC--------------ChHHHHHHHHcCCCCEEee
Confidence            4567788887532              3567778888999998653


No 164
>cd08494 PBP2_NikA_DppA_OppA_like_6 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=57.77  E-value=37  Score=22.35  Aligned_cols=37  Identities=8%  Similarity=0.079  Sum_probs=25.2

Q ss_pred             HHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC-CccEEEeCC
Q psy2313           5 ENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG-TAHMSFAAL   56 (62)
Q Consensus         5 ~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g-~~D~av~~l   56 (62)
                      ..-.+++|+++++..               ..|+.+...+..+ +.|+++...
T Consensus       336 ~~~l~~~GI~v~i~~---------------~~~~~~~~~~~~~~~~d~~~~~~  373 (448)
T cd08494         336 ASQLAEVGITVKIEV---------------VEPATWLQRVYKGKDYDLTLIAH  373 (448)
T ss_pred             HHHHHhcCcEEEEEE---------------eeHHHHHHHhccCCceeEEEecc
Confidence            333455788888875               3577777766666 889887654


No 165
>cd08501 PBP2_Lpqw The substrate-binding domain of mycobacterial lipoprotein Lpqw contains type 2 periplasmic binding fold. LpqW is one of key players in synthesis and transport of the unique components of the mycobacterial cell wall which is a complex structure rich in two related lipoglycans, the phosphatidylinositol mannosides (PIMs) and lipoarabinomannans (LAMs).  Lpqw is a highly conserved lipoprotein that transport intermediates from a pathway for mature PIMs production into a pathway for LAMs biosynthesis, thus controlling the relative abundance of these two essential components of cell wall.   LpqW is thought to have been adapted by the cell-wall biosynthesis machinery of mycobacteria and other closely related pathogens, evolving to play an important role in PIMs/LAMs biosynthesis.  Most of periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the LpqW protein. The structural topology of these domains is most similar to 
Probab=57.40  E-value=27  Score=23.37  Aligned_cols=39  Identities=8%  Similarity=0.108  Sum_probs=26.4

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC-CccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG-TAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g-~~D~av~~lt   57 (62)
                      +..-.+++|+++++..               ..|+.+...+..+ ..|+++.+..
T Consensus       366 i~~~l~~iGi~v~i~~---------------~~~~~~~~~~~~~~~~d~~~~~~~  405 (486)
T cd08501         366 IQDMLAKAGIKVTVVS---------------VPSNDFSKTLLSGGDYDAVLFGWQ  405 (486)
T ss_pred             HHHHHHhcCCEEEecc---------------cCchHHhhccCCCCceEEEEeccc
Confidence            3444455799998875               3577777776666 7888876543


No 166
>TIGR00975 3a0107s03 phosphate ABC transporter, phosphate-binding protein. This family represents one type of (periplasmic, in Gram-negative bacteria) phosphate-binding protein found in phosphate ABC (ATP-binding cassette) transporters. This protein is accompanied, generally in the same operon, by an ATP binding protein and (usually) two permease proteins.
Probab=56.47  E-value=31  Score=22.30  Aligned_cols=25  Identities=16%  Similarity=0.311  Sum_probs=19.2

Q ss_pred             cchhhHHHhhhcCCccEEEeCCcccc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALSVSS   60 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~ltit~   60 (62)
                      |+-.| +.+|.+|++|++.++-.+++
T Consensus        35 GSg~G-i~~l~~g~~dia~ssr~l~~   59 (314)
T TIGR00975        35 GSGAG-IAQFAAGTVDFGASDAPLSE   59 (314)
T ss_pred             CCHHH-HHHHHcCCCCEEecCCCCCH
Confidence            55445 67788999999999877764


No 167
>cd05803 PGM_like4 This PGM-like (phosphoglucomutase-like) domain is located C-terminal to a mannose-1-phosphate guanyltransferase domain in a protein of unknown function that is found in both prokaryotes and eukaryotes. This domain belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=56.43  E-value=41  Score=22.72  Aligned_cols=51  Identities=16%  Similarity=0.292  Sum_probs=31.4

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+.+++|+++... ..+|+.+|. .|+.....-..+...+...++|++++
T Consensus       188 ~~~~ll~~lg~~v~~~~~~~d~~F~~-~p~p~~~~l~~l~~~v~~~~adlgi~  239 (445)
T cd05803         188 LIPRLLEKLGCEVIVLNCEPTGLFPH-TPEPLPENLTQLCAAVKESGADVGFA  239 (445)
T ss_pred             HHHHHHHHcCCEEEEeCCcCCCCCCC-CCCCChHHHHHHHHHHHhcCCCEEEe
Confidence            5677888899986433 456777762 33211122345566677788999875


No 168
>PRK11119 proX glycine betaine transporter periplasmic subunit; Provisional
Probab=56.05  E-value=23  Score=23.31  Aligned_cols=38  Identities=18%  Similarity=0.295  Sum_probs=27.6

Q ss_pred             HHHHHHHHcCCeE-EEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           3 LLENIAQELEFDF-HLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~-~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +++.+-+.+|+++ +++..               .=.-+...|.+|.+|+.+..
T Consensus        47 v~~~iLe~~GY~V~e~~~~---------------~~~~~~~ala~GdiDv~~~~   85 (331)
T PRK11119         47 LVSRALEKLGYDVNKPKEV---------------DYNVFYTSIANGDATFTAVN   85 (331)
T ss_pred             HHHHHHHHcCCceeeeccc---------------CcHHHHHHHHcCCCeEehhh
Confidence            5677778889988 77643               22566778889999987644


No 169
>PRK03635 chromosome replication initiation inhibitor protein; Validated
Probab=55.90  E-value=40  Score=20.95  Aligned_cols=19  Identities=11%  Similarity=-0.020  Sum_probs=15.7

Q ss_pred             hhhHHHhhhcCCccEEEeC
Q psy2313          37 WNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~   55 (62)
                      -+..+..|.+|++|+++..
T Consensus       127 ~~~~~~~l~~~~~d~~i~~  145 (294)
T PRK03635        127 QDHTAELLRRGEVVGAVTT  145 (294)
T ss_pred             cHHHHHHHhCCCceEEEec
Confidence            3568889999999999864


No 170
>PRK11074 putative DNA-binding transcriptional regulator; Provisional
Probab=54.88  E-value=38  Score=21.11  Aligned_cols=21  Identities=29%  Similarity=0.542  Sum_probs=17.3

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +....++..|.+|++|+++..
T Consensus       128 ~~~~~~~~~l~~g~~Dl~i~~  148 (300)
T PRK11074        128 EVFNGVWDALADGRVDIAIGA  148 (300)
T ss_pred             hhhhHHHHHHHCCCCCEEEec
Confidence            345678899999999999964


No 171
>TIGR03298 argP transcriptional regulator, ArgP family. ArgP used to be known as IciA. ArgP is a positive regulator of argK. It is a negative autoregulator in presence of arginine. It competes with DnaA for oriC iteron (13-mer) binding. It activates dnaA and nrd transcription. It has been demonstrated to be part of the pho regulon (PubMed:10589831). ArgP mutants convey canavanine (an L-arginine structural homolog) sensitivity (PubMed: 15150242).
Probab=54.80  E-value=42  Score=20.67  Aligned_cols=18  Identities=11%  Similarity=0.062  Sum_probs=15.1

Q ss_pred             hhHHHhhhcCCccEEEeC
Q psy2313          38 NGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        38 ~g~ig~l~~g~~D~av~~   55 (62)
                      ..++..|.+|++|+++..
T Consensus       128 ~~~~~~l~~g~~d~~i~~  145 (292)
T TIGR03298       128 DHTAELLRSGEVLGAVTT  145 (292)
T ss_pred             hhHHHHHhCCCceEEEec
Confidence            457889999999999865


No 172
>COG0583 LysR Transcriptional regulator [Transcription]
Probab=54.41  E-value=46  Score=20.06  Aligned_cols=21  Identities=24%  Similarity=0.336  Sum_probs=17.2

Q ss_pred             hhhHHHhhhcCCccEEEeCCc
Q psy2313          37 WNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .+.+..++.+|++|+++....
T Consensus       128 ~~~~~~~l~~~~~D~~i~~~~  148 (297)
T COG0583         128 SDRLLEDLVEGELDLAIRAGP  148 (297)
T ss_pred             hHHHHHHHHcCCCCEEEecCC
Confidence            445788999999999998764


No 173
>PRK09542 manB phosphomannomutase/phosphoglucomutase; Reviewed
Probab=54.16  E-value=46  Score=22.54  Aligned_cols=52  Identities=10%  Similarity=0.076  Sum_probs=33.1

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCC-CcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQ-KDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~-~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|.+.+++++... ..+|+.|+...|+.. ......+...+...++|++++
T Consensus       179 ~~~~ll~~lg~~vv~~~~~~d~~Fp~~~p~P~~~~~l~~l~~~v~~~~adlGia  232 (445)
T PRK09542        179 TVPAVLGGLPITLLPLYFELDGTFPNHEANPLDPANLVDLQAFVRETGADIGLA  232 (445)
T ss_pred             HHHHHHHhCCCEEEEEecCcCCCCCCCCcCCCCHHHHHHHHHHHHHcCCCEEEE
Confidence            5667778888775433 456777765444311 123456666778889999885


No 174
>PRK15421 DNA-binding transcriptional regulator MetR; Provisional
Probab=53.38  E-value=56  Score=20.74  Aligned_cols=20  Identities=10%  Similarity=-0.037  Sum_probs=16.2

Q ss_pred             hhhHHHhhhcCCccEEEeCC
Q psy2313          37 WNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~l   56 (62)
                      -..+...|.+|++|+++..-
T Consensus       127 ~~~~~~~L~~g~~Dl~i~~~  146 (317)
T PRK15421        127 TFDPQPALQQGELDLVMTSD  146 (317)
T ss_pred             cHHHHHHHHCCCcCEEEecC
Confidence            35678899999999999653


No 175
>cd03084 phosphohexomutase The alpha-D-phosphohexomutase superfamily includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this family include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). These enzymes play important and diverse roles in carbohydrate metabolism in organisms from bacteria to humans. Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=53.03  E-value=55  Score=21.33  Aligned_cols=52  Identities=12%  Similarity=0.185  Sum_probs=32.6

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCC-CcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQ-KDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~-~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|+++..+ ..+|+.|+...|+.. ......+...+...++|++++
T Consensus       127 ~~~~ll~~lg~~v~~~n~~~d~~F~~~~p~p~~~~~l~~l~~~v~~~~adlG~a  180 (355)
T cd03084         127 IAPQLLEKLGAEVIPLNCEPDGNFGNINPDPGSETNLKQLLAVVKAEKADFGVA  180 (355)
T ss_pred             HHHHHHHHcCCcEEEEcCcCCCCCCCCCCCCCchhhHHHHHHHHHhcCCCEEEE
Confidence            4566777888766433 345666655444211 134667777888889999874


No 176
>PRK06034 hypothetical protein; Provisional
Probab=52.89  E-value=20  Score=23.44  Aligned_cols=22  Identities=14%  Similarity=0.190  Sum_probs=20.5

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .++...+.+|.+|++|++|-|+
T Consensus       126 ~s~~dVf~AV~~g~adyGVVPI  147 (279)
T PRK06034        126 FSAQAVVEAVARSKGDLGLVSL  147 (279)
T ss_pred             CCHHHHHHHHHcCCCCEEEEEC
Confidence            5799999999999999999888


No 177
>PLN02691 porphobilinogen deaminase
Probab=52.76  E-value=65  Score=21.81  Aligned_cols=22  Identities=9%  Similarity=0.321  Sum_probs=16.9

Q ss_pred             cchhh-HHHhhhcCCccEEEeCC
Q psy2313          35 DKWNG-VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g-~ig~l~~g~~D~av~~l   56 (62)
                      |-|.- +=.+|.+|++|+||-++
T Consensus       102 GlFtkele~aLl~g~iDiAVHSl  124 (351)
T PLN02691        102 GLFTKEIDDALLSGRIDIAVHSM  124 (351)
T ss_pred             eEeHHHHHHHHHcCCCCEEEecc
Confidence            55644 44589999999999776


No 178
>TIGR02294 nickel_nikA nickel ABC transporter, periplasmic nickel-binding protein. Members of this family are periplasmic nickel-binding proteins of nickel ABC transporters. Nickel is bound specifically, albeit weakly, through water molecules positioned in the binding site. The amino acids whose side chains line the binding site include Tyr-44, Met-49, Trp-122, Arg-159, Trp-420, and Tyr-424 (numbering based on the precursor sequence of E. coli NikA) with the Arg contributing a hydrogen bond indirectly through a water molecule. Sequences that exactly (or mostly) have the same binding site residues score above the trusted (or noise) cutoffs to this model. Most appear to be lipoproteins.
Probab=52.75  E-value=38  Score=22.85  Aligned_cols=35  Identities=14%  Similarity=0.153  Sum_probs=23.7

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      +....+++|+++++...               .|+.+...+..|+.|+++
T Consensus       362 l~~~l~~~GI~v~i~~~---------------~~~~~~~~~~~g~~d~~~  396 (500)
T TIGR02294       362 LQAEWRKIGIKLSLIGE---------------EEDKIAARRRDGDFDMMF  396 (500)
T ss_pred             HHHHHHHcCCeEEEeec---------------ChhhHhhhhhcCCeeEEE
Confidence            44445568999999864               455556666677778765


No 179
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism]
Probab=52.58  E-value=21  Score=22.68  Aligned_cols=20  Identities=15%  Similarity=0.180  Sum_probs=15.6

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      |+|.|++.. ..|++|+|-.-
T Consensus        26 GS~gG~~~i-~~G~adiag~h   45 (223)
T COG1910          26 GSMGGLLAI-KRGEADIAGIH   45 (223)
T ss_pred             ccccchHhh-hhcccceeeee
Confidence            789887764 99999997543


No 180
>PRK15414 phosphomannomutase CpsG; Provisional
Probab=52.35  E-value=46  Score=22.68  Aligned_cols=47  Identities=13%  Similarity=0.146  Sum_probs=30.0

Q ss_pred             HHHcCCeEE---EEEecCCcccceeccCC-CcchhhHHHhhhcCCccEEEe
Q psy2313           8 AQELEFDFH---LYIVADGLYGTKVRENQ-KDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         8 a~~l~f~~~---~~~~~~~~~G~~~~~~~-~~~w~g~ig~l~~g~~D~av~   54 (62)
                      -+++|+.++   +...+|+.|+...|+.. ......+...+...++|++++
T Consensus       193 l~~lG~~v~v~~~~~~pdg~F~~~~p~P~~~~~l~~l~~~v~~~~adlGia  243 (456)
T PRK15414        193 FKALGAPVELIKVHNTPDGNFPNGIPNPLLPECRDDTRNAVIKHGADMGIA  243 (456)
T ss_pred             HHhcCCCeEEEEeecCCCCCCCCCCCCCCCHHHHHHHHHHHHHcCCCEEEE
Confidence            567887444   44456777755444311 124667777888899999885


No 181
>cd03085 PGM1 Phosphoglucomutase 1 (PGM1) catalyzes the bidirectional interconversion of glucose-1-phosphate (G-1-P) and glucose-6-phosphate (G-6-P) via a glucose 1,6-diphosphate intermediate, an important metabolic step in prokaryotes and eukaryotes. In one direction, G-1-P produced from sucrose catabolism is converted to G-6-P, the first intermediate in glycolysis. In the other direction, conversion of G-6-P to G-1-P generates a substrate for synthesis of UDP-glucose which is required for synthesis of a variety of cellular constituents including cell wall polymers and glycoproteins. The PGM1 family also includes a non-enzymatic PGM-related protein (PGM-RP) thought to play a structural role in eukaryotes, as well as pp63/parafusin, a phosphoglycoprotein that plays an important role in calcium-regulated exocytosis in ciliated protozoans. PGM1 belongs to the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl t
Probab=51.88  E-value=39  Score=23.79  Aligned_cols=52  Identities=13%  Similarity=0.024  Sum_probs=32.0

Q ss_pred             HHHHHHH-HcCCeE--EEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQ-ELEFDF--HLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~-~l~f~~--~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+ .+|++.  .+...+|+.|+...|+.....-..+...+...++|++++
T Consensus       222 ~~~~lL~~~LG~~~v~~i~~~pDg~Fp~~~P~P~~~~l~~L~~~V~~~~ADlGia  276 (548)
T cd03085         222 YAKKIFVEELGAPESSVVNCTPLPDFGGGHPDPNLTYAKDLVELMKSGEPDFGAA  276 (548)
T ss_pred             HHHHHHHHhcCCCceEEEeCeeCCCCCCCCCCCcHHHHHHHHHHHhccCCCEEEE
Confidence            4555664 789864  455667888765444311222345666677788999885


No 182
>cd08502 PBP2_NikA_DppA_OppA_like_16 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=51.87  E-value=59  Score=21.80  Aligned_cols=39  Identities=13%  Similarity=0.211  Sum_probs=27.7

Q ss_pred             HHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC--CccEEEeCCcc
Q psy2313           5 ENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG--TAHMSFAALSV   58 (62)
Q Consensus         5 ~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g--~~D~av~~lti   58 (62)
                      ..-.+++|+++++...               .|+.+...+..+  +.|+++.+...
T Consensus       353 ~~~l~~iGI~v~v~~~---------------~~~~~~~~~~~~~~~~d~~~~~~~~  393 (472)
T cd08502         353 AQQLKAAGFNVDLQVM---------------DWATLVQRRAKPDGGWNIFITSWSG  393 (472)
T ss_pred             HHHHHhcCcEEEEEEe---------------chHHHHHHHhCCCCceeEEEecccc
Confidence            3334557999888753               577888877777  88988876544


No 183
>cd08514 PBP2_AppA_like The substrate-binding component of the oligopeptide-binding protein, AppA, from Bacillus subtilis contains the type 2 periplasmic-binding fold. This family represents the substrate-binding domain of the oligopeptide-binding protein, AppA, from Bacillus subtilis and its closest homologs from other bacteria and archaea. Bacillus subtilis has three ABC-type peptide transport systems, a dipeptide-binding protein (DppA) and two oligopeptide-binding proteins (OppA and AppA) with overlapping specificity. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and also is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains correspondin
Probab=51.82  E-value=18  Score=24.17  Aligned_cols=36  Identities=8%  Similarity=0.350  Sum_probs=21.7

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      ++.+-.+.+|+++++...               .|..+...+..|+.|+++
T Consensus       358 ~i~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~d~~~  393 (483)
T cd08514         358 IIQQQLKEIGIDVKIRVL---------------EWAAFLEKVDDKDFDAVL  393 (483)
T ss_pred             HHHHHHHhcCcEEEEEEe---------------cHHHHHHHhccccHHHhh
Confidence            344445568999998864               345555555555555544


No 184
>cd00995 PBP2_NikA_DppA_OppA_like The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold. This family represents the periplasmic substrate-binding domain of nickel/dipeptide/oligopeptide transport systems, which function in the import of nickel and peptides, and other closely related proteins. The oligopeptide-binding protein OppA is a periplasmic component of an ATP-binding cassette (ABC) transport system OppABCDEF consisting of five subunits: two homologous integral membrane proteins OppB and OppF that form the translocation pore; two homologous nucleotide-binding domains OppD and OppF that drive the transport process through binding and hydrolysis of ATP; and the substrate-binding protein or receptor OppA that determines the substrate specificity of the transport system. The dipeptide (DppA) and oligopeptide (OppA) binding proteins differ in several ways. The DppA binds dipeptides and some tripeptides and is inv
Probab=51.57  E-value=58  Score=21.33  Aligned_cols=38  Identities=8%  Similarity=0.200  Sum_probs=25.2

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCC-ccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGT-AHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~-~D~av~~l   56 (62)
                      +..-.+++|+++++...               .|+.+...+..++ .|+++.+.
T Consensus       343 i~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~~d~~~~~~  381 (466)
T cd00995         343 IQAQLKEIGIKVEIEPL---------------DFATLLDALDAGDDFDLFLLGW  381 (466)
T ss_pred             HHHHHHHcCceEEEEEe---------------chHHHHHHhhcCcccceeeecc
Confidence            34444557888888753               4666666677777 78877554


No 185
>PRK11013 DNA-binding transcriptional regulator LysR; Provisional
Probab=51.56  E-value=58  Score=20.39  Aligned_cols=20  Identities=5%  Similarity=-0.134  Sum_probs=16.1

Q ss_pred             hhhHHHhhhcCCccEEEeCC
Q psy2313          37 WNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~l   56 (62)
                      -..+...|.+|++|+++...
T Consensus       132 ~~~~~~~l~~~~~Dl~i~~~  151 (309)
T PRK11013        132 SPLLEEWLSAQRHDLGLTET  151 (309)
T ss_pred             HHHHHHHHHcCCCCEEEEcC
Confidence            45677899999999998643


No 186
>PRK14321 glmM phosphoglucosamine mutase; Provisional
Probab=51.09  E-value=65  Score=21.88  Aligned_cols=50  Identities=12%  Similarity=0.062  Sum_probs=33.2

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccc-eeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGT-KVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~-~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+.+++|+++... ..+|+.++. +.|+  ......+...+....+|++++
T Consensus       180 ~~~~il~~lg~~v~~i~~~~d~~f~~~p~p~--~~~l~~l~~~v~~~~adlGia  231 (449)
T PRK14321        180 LSPYLQRELGNKVISLNSHPSGFFVRELEPN--AKSLSMLAKTVKVLKADVGIA  231 (449)
T ss_pred             HHHHHHHHcCCEEEEeCccCCCCCCCCCCCc--hhhHHHHHHHHHHCCCCEEEE
Confidence            5677888899986544 345666652 3332  245666777778888999875


No 187
>PRK11062 nhaR transcriptional activator NhaR; Provisional
Probab=50.59  E-value=58  Score=20.27  Aligned_cols=21  Identities=10%  Similarity=0.115  Sum_probs=17.6

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      +..+.+...|.+|++|+++..
T Consensus       129 ~~~~~~~~~l~~g~~D~~i~~  149 (296)
T PRK11062        129 STHEMLLEQLSQHKLDMILSD  149 (296)
T ss_pred             CCHHHHHHHHHcCCCCEEEec
Confidence            456788899999999999964


No 188
>PTZ00150 phosphoglucomutase-2-like protein; Provisional
Probab=50.50  E-value=23  Score=24.99  Aligned_cols=52  Identities=10%  Similarity=0.024  Sum_probs=32.0

Q ss_pred             HHHHHHHHcCCeE----EEEEecCCcccc---eeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDF----HLYIVADGLYGT---KVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~----~~~~~~~~~~G~---~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|++.    .....+|+.|+.   ++|......++.+...+...++|++++
T Consensus       243 ~~~~iL~~lG~~~~~~v~~~~~pDg~Fp~~~~PnPe~~~~~l~~~~~~v~~~~adlgia  301 (584)
T PTZ00150        243 FVQKALHTVGLPNLLSVAQQAEPDPEFPTVTFPNPEEGKGALKLSMETAEAHGSTVVLA  301 (584)
T ss_pred             HHHHHHHhcCCCCceEeccccccCcCCCCCCCcChhhhHHHHHHHHHHHHHhCCCEEEE
Confidence            5667778899962    223346777653   333100123666777777888999885


No 189
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=50.30  E-value=42  Score=22.36  Aligned_cols=40  Identities=13%  Similarity=0.022  Sum_probs=29.9

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ...+++..|+++.++..+              .-.-++.+|..|++|+++..++
T Consensus       166 ~~~~~k~~Gi~~~~Vpy~--------------g~gea~taLlgg~v~a~~~~~s  205 (319)
T COG3181         166 GALFAKAAGIKITYVPYK--------------GGGEALTALLGGHVDAGSTNLS  205 (319)
T ss_pred             HHHHHHHhCCceeEEeec--------------CccHHHHHHhcCceeeeecChh
Confidence            457888999988888542              2345778888999999887764


No 190
>PF06345 Drf_DAD:  DRF Autoregulatory Domain;  InterPro: IPR010465 This domain is found in Diaphanous-related formins (Drfs). It binds the N-terminal GTPase-binding domain; this link is broken when GTP-bound Rho binds to the GBD and activates the protein. The addition of diaphanous activating domains (DAD) to mammalian cells induces actin filament formation, stabilises microtubules, and activates serum-response mediated transcription [].; PDB: 3O4X_H 3OBV_E 2BAP_C 2F31_B.
Probab=48.07  E-value=14  Score=13.48  Aligned_cols=13  Identities=31%  Similarity=0.504  Sum_probs=8.8

Q ss_pred             hhhHHHhhhcCCc
Q psy2313          37 WNGVVGDLVTGTA   49 (62)
Q Consensus        37 w~g~ig~l~~g~~   49 (62)
                      .+.++.+|..|++
T Consensus         3 mdsllealqtg~a   15 (15)
T PF06345_consen    3 MDSLLEALQTGSA   15 (15)
T ss_dssp             HHHHHHHHHHSTT
T ss_pred             HHHHHHHHHccCC
Confidence            4567777777754


No 191
>cd08517 PBP2_NikA_DppA_OppA_like_13 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=48.01  E-value=78  Score=21.04  Aligned_cols=36  Identities=11%  Similarity=0.187  Sum_probs=22.9

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC-CccEEEe
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG-TAHMSFA   54 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g-~~D~av~   54 (62)
                      +..-.+++|+++++...               .|+.+...+..+ +.|+++.
T Consensus       354 i~~~l~~iGi~v~i~~~---------------~~~~~~~~~~~~~~~d~~~~  390 (480)
T cd08517         354 VKQALKEVGIDVELRSQ---------------DFATWLKRVYTDRDFDLAMN  390 (480)
T ss_pred             HHHHHHHcCCEEEEEEe---------------cHHHHHHhhcccCCceEEEe
Confidence            33444557888888753               466666666555 7777764


No 192
>PF12849 PBP_like_2:  PBP superfamily domain;  InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily []. It is often associated with a helix-turn-helix domain.; PDB: 1QUL_A 1OIB_A 1A54_A 1IXH_A 1A40_A 1QUJ_A 1A55_A 1IXI_A 2ABH_A 1QUK_A ....
Probab=47.90  E-value=42  Score=20.69  Aligned_cols=23  Identities=9%  Similarity=0.280  Sum_probs=18.0

Q ss_pred             hhhHHHhhhcCCccEEEeCCccc
Q psy2313          37 WNGVVGDLVTGTAHMSFAALSVS   59 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~ltit   59 (62)
                      -..-+.+|.+|++|+++++-.++
T Consensus        47 S~~g~~~l~~g~~di~~~sr~l~   69 (281)
T PF12849_consen   47 SGAGIQALINGKVDIAISSRPLT   69 (281)
T ss_dssp             HHHHHHHHHTTSSSEEEESSHHH
T ss_pred             CHHHHHHHHhCCCEEEEeCCCCc
Confidence            35677888999999999885544


No 193
>PRK09861 cytoplasmic membrane lipoprotein-28; Provisional
Probab=47.56  E-value=52  Score=21.04  Aligned_cols=37  Identities=14%  Similarity=0.046  Sum_probs=26.3

Q ss_pred             HHHHHHHH-cCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           3 LLENIAQE-LEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         3 ll~~la~~-l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      +.+.+.++ .|++++++..              ..+.....+|.+|++|+..
T Consensus        49 ~a~~~~k~~~G~~Velv~f--------------sd~~~~n~AL~~G~ID~n~   86 (272)
T PRK09861         49 VAKKVAKEKYGLDVELVGF--------------SGSLLPNDATNHGELDANV   86 (272)
T ss_pred             HHHHHHHHcCCCeEEEEec--------------CchhhHHHHHHcCCcceeh
Confidence            45556655 4999999853              2355666899999999865


No 194
>smart00094 TR_FER Transferrin.
Probab=47.37  E-value=64  Score=21.40  Aligned_cols=20  Identities=10%  Similarity=0.077  Sum_probs=17.8

Q ss_pred             cchhhHHHhhhcCCccEEEe
Q psy2313          35 DKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~   54 (62)
                      .+-...+..|.+|+||++..
T Consensus        35 ~s~~~Ci~~I~~g~AD~a~l   54 (332)
T smart00094       35 SSTEECIKAIQKGEADAVTL   54 (332)
T ss_pred             CCHHHHHHHHHCCCCCEEEE
Confidence            46889999999999999875


No 195
>PF03480 SBP_bac_7:  Bacterial extracellular solute-binding protein, family 7;  InterPro: IPR018389 This family of proteins are involved in binding extracellular solutes for transport across the bacterial cytoplasmic membrane. This family includes a C4-dicarboxylate-binding protein DctP [, ] and the sialic acid-binding protein SiaP. The structure of the SiaP receptor has revealed an overall topology similar to ATP binding cassette ESR (extracytoplasmic solute receptors) proteins []. Upon binding of sialic acid, SiaP undergoes domain closure about a hinge region and kinking of an alpha-helix hinge component [].; GO: 0006810 transport, 0030288 outer membrane-bounded periplasmic space; PDB: 2HZK_C 2HZL_B 2HPG_C 2XWI_A 2XWK_A 2WX9_A 2CEY_A 2WYP_A 3B50_A 2CEX_B ....
Probab=47.00  E-value=56  Score=20.47  Aligned_cols=22  Identities=18%  Similarity=0.211  Sum_probs=18.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      -.|+.+...|.+|.+|-+..+.
T Consensus       161 ip~~evy~aLq~G~vDg~~~~~  182 (286)
T PF03480_consen  161 IPWSEVYQALQQGVVDGAENSA  182 (286)
T ss_dssp             -TGGGHHHHHHTTSSSEEEEEH
T ss_pred             CcHHHHHHHHhcCCcCeEecCH
Confidence            4799999999999999888765


No 196
>PRK11890 phosphate acetyltransferase; Provisional
Probab=46.58  E-value=40  Score=22.28  Aligned_cols=47  Identities=15%  Similarity=0.116  Sum_probs=30.6

Q ss_pred             HHHHHHHHcCCe---EEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCccc
Q psy2313           3 LLENIAQELEFD---FHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALSVS   59 (62)
Q Consensus         3 ll~~la~~l~f~---~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~ltit   59 (62)
                      -++++++.+|++   |+++.+++..          .--..-+..+..|++|+.+.+..-|
T Consensus        58 ~I~~~a~~~g~dl~~~eII~~~~~~----------~~a~~av~mV~~G~AD~lmkG~i~T  107 (312)
T PRK11890         58 RIEAVAAECGLDLSGYEIVDAPHSH----------AAAAKAVELVREGEAEALMKGSLHT  107 (312)
T ss_pred             HHHHHHHHcCCCcCCCEEECCCChH----------HHHHHHHHHHHcCCCCEEecCCccc
Confidence            467788888886   5666543211          0112345688899999999887654


No 197
>PF03180 Lipoprotein_9:  NLPA lipoprotein;  InterPro: IPR004872 This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence. Their precise function is unknown. However they are probably distantly related to IPR001638 from INTERPRO which are solute binding proteins.; PDB: 4EF2_A 4EF1_B 3GXA_C 3IR1_D 3TQW_A 3K2D_B 3UP9_A 1XS5_A 1P99_A.
Probab=46.19  E-value=69  Score=20.18  Aligned_cols=37  Identities=11%  Similarity=0.167  Sum_probs=28.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      .++..+++.|++.+++...              .+...-.+|.+|++|+-+
T Consensus        16 ~v~~~~~~~Gi~vevv~f~--------------D~~~~N~AL~~G~iDaN~   52 (237)
T PF03180_consen   16 AVKEKLKKKGIDVEVVEFS--------------DYVQPNEALADGEIDANF   52 (237)
T ss_dssp             HHHHHHHHTTEEEEEEEES--------------STTHHHHHHHTTSSSEEE
T ss_pred             HHHHHHHhcCCeEEEEEec--------------chhhcChHHHCCCcceec
Confidence            3456677789999998753              466777789999999754


No 198
>COG3888 Predicted transcriptional regulator [Transcription]
Probab=46.13  E-value=16  Score=24.08  Aligned_cols=20  Identities=20%  Similarity=0.371  Sum_probs=17.7

Q ss_pred             hhhHHHhhhcCCccEEEeCC
Q psy2313          37 WNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~~l   56 (62)
                      --.+..+|+.|..|++++|+
T Consensus       111 aisit~DLv~g~ld~~lSPi  130 (321)
T COG3888         111 AISITRDLVEGKLDFGLSPI  130 (321)
T ss_pred             HHHHHHHHHhhhhhhcccHH
Confidence            45788999999999999987


No 199
>cd08500 PBP2_NikA_DppA_OppA_like_4 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=45.82  E-value=68  Score=21.77  Aligned_cols=39  Identities=13%  Similarity=0.185  Sum_probs=26.8

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCC-ccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGT-AHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~-~D~av~~lt   57 (62)
                      +..-.+++|+++++...               .|+.+...+..++ .|+++.+..
T Consensus       364 i~~~l~~~Gi~v~~~~~---------------~~~~~~~~~~~~~~~d~~~~~~~  403 (499)
T cd08500         364 IKDDWRKIGIKVNLQPI---------------DFNLLVTRLSANEDWDAILLGLT  403 (499)
T ss_pred             HHHHHHHhCCceEEEec---------------cHHHHHHHHhcCCCceEEEEecc
Confidence            33444568999998853               5777777777775 888876554


No 200
>cd05805 MPG1_transferase GTP-mannose-1-phosphate guanyltransferase (MPG1 transferase), also known as GDP-mannose pyrophosphorylase, is a bifunctional enzyme with both phosphomannose isomerase (PMI) activity and GDP-mannose phosphorylase (GMP) activity.  The protein contains an N-terminal NTP transferase domain, an L-beta-H domain, and a C-terminal PGM-like domain that belongs to the alpha-D-phosphohexomutase superfamily.  This subfamily is limited to bacteria and archaea. The alpha-D-phosphohexomutases include several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Members of this group appear to lack conserved residues necessary for metal binding and catalytic activity. Other members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, the bacterial phosphoglucosamine mutase GlmM, and the bifunctional 
Probab=45.69  E-value=77  Score=21.37  Aligned_cols=51  Identities=10%  Similarity=0.063  Sum_probs=31.7

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|.+++|+++..+ ..+|+.. .+.++........+...+...++|++++
T Consensus       183 ~~~~ll~~lG~~v~~i~~~~d~~~-~~~~~~~~~~l~~l~~~v~~~~adlgia  234 (441)
T cd05805         183 VLPGLLSRLGCDVVILNARLDEDA-PRTDTERQRSLDRLGRIVKALGADFGVI  234 (441)
T ss_pred             HHHHHHHHcCCEEEEEecccCCcc-CCCCccchhHHHHHHHHHHhCCCCEEEE
Confidence            5677888999987643 3344431 1112111235677888888889999885


No 201
>PF13531 SBP_bac_11:  Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A ....
Probab=44.93  E-value=66  Score=19.12  Aligned_cols=39  Identities=15%  Similarity=0.187  Sum_probs=24.4

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC-CccEEEeC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG-TAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g-~~D~av~~   55 (62)
                      ++.+...++-+++++++..               .-..+...|..| ++|+.+++
T Consensus        15 ~l~~~f~~~~g~~v~v~~~---------------~s~~~~~~l~~g~~~Dv~~~~   54 (230)
T PF13531_consen   15 ELAEAFEKQPGIKVEVSFG---------------GSGELVRRLQAGKKPDVFIPA   54 (230)
T ss_dssp             HHHHHHHHHHCEEEEEEEE---------------CHHHHHHHHHTT-S-SEEEES
T ss_pred             HHHHHHHhccCCeEEEEEC---------------ChHHHHHHHhcCCCceEEEEC
Confidence            3556666777888888863               223455555554 78887765


No 202
>TIGR00787 dctP tripartite ATP-independent periplasmic transporter solute receptor, DctP family. TRAP-T (Tripartite ATP-independent Periplasmic Transporter) family proteins generally consist of three components, and these systems have so far been found in Gram-negative bacteria, Gram-postive bacteria and archaea. The best characterized example is the DctPQM system of Rhodobacter capsulatus, a C4 dicarboxylate (malate, fumarate, succinate) transporter. This model represents the DctP family, one of at least three major families of extracytoplasmic solute receptor for TRAP family transporters. Other are the SnoM family (see pfam03480) and TAXI (TRAP-associated extracytoplasmic immunogenic) family.
Probab=44.59  E-value=75  Score=19.63  Aligned_cols=45  Identities=7%  Similarity=0.119  Sum_probs=31.6

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+.|.++-+=++++...+.++.         +.-..++..+..|.+|++....
T Consensus        18 f~~~v~e~t~G~v~v~~~~~g~L---------g~~~e~~~~v~~G~~d~~~~~~   62 (257)
T TIGR00787        18 FAKLVNEKTNGEIKISVFPSSQL---------GSDRAMLEALQGGALDMTAPSS   62 (257)
T ss_pred             HHHHHHHHcCCeEEEEEcCCCCC---------CChHHHHHHHhCCCccEEeccc
Confidence            45677777776677665544332         3356789999999999988654


No 203
>PRK14315 glmM phosphoglucosamine mutase; Provisional
Probab=44.49  E-value=99  Score=20.98  Aligned_cols=50  Identities=10%  Similarity=0.044  Sum_probs=31.3

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|+++..+ ..+|+.+....+.  ...-..+...+...++|++++
T Consensus       191 ~~~~ll~~lG~~v~~i~~~~dg~~~~~~~~--~~~l~~l~~~v~~~~adlGia  241 (448)
T PRK14315        191 VAPEALWELGAEVITIGVEPNGFNINEECG--STHPEALAKKVREVRADIGIA  241 (448)
T ss_pred             HHHHHHHHcCCeEEEeccCCCCCCCCCCCC--CCCHHHHHHHHHHcCCCEEEE
Confidence            4566778889876433 3455555422221  123456888888889999885


No 204
>PF11834 DUF3354:  Domain of unknown function (DUF3354);  InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement. Inward rectifying potassium (K(+)in) channels play an important role in turgor regulation and ion uptake in higher plants. All of them comprise, from their N-terminal to their C-terminal ends: a short hydrophilic region, a hydrophobic region structurally analogous and partially homologous to the transmembrane domain of voltage-gated animal channels from the Shaker superfamily, a putative cyclic nucleotide-binding domain, and a conserved C-terminal KHA domain. Between these last two regions, some of them (AKT1, AKT2 and SKT1) contain an ankyrin-repeat domain with six repeats homologous to those of human erythrocyte ankyrin.  This entry represents the KHA domain which is unique to plant K(+)in channels. The KHA domain contains two high-homology blocks enriched for hydrophobic and acidic residues, respectively. The KHA domain is essential for interaction of plant K(+)in channels. The KHA domain mediates tetramerization and/or stabilisation of the heteromers [, , ]. 
Probab=44.24  E-value=38  Score=17.48  Aligned_cols=21  Identities=19%  Similarity=0.327  Sum_probs=16.4

Q ss_pred             hHHHHHHHHcCCeEEEEEecC
Q psy2313           2 DLLENIAQELEFDFHLYIVAD   22 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~   22 (62)
                      ||++..++++++....+...|
T Consensus        30 eLl~ia~~kfg~~~~~v~~~d   50 (69)
T PF11834_consen   30 ELLKIASEKFGFSATKVLNED   50 (69)
T ss_pred             HHHHHHHHHhCCCceEEEcCC
Confidence            678888999999877776544


No 205
>cd08505 PBP2_NikA_DppA_OppA_like_18 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=44.18  E-value=93  Score=21.45  Aligned_cols=38  Identities=13%  Similarity=0.156  Sum_probs=25.7

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+-.+++|+++++..               ..|+.+...+..|+.|+.....
T Consensus       400 iq~~l~~iGI~v~i~~---------------~d~~~~~~~~~~~~~d~~~~~w  437 (528)
T cd08505         400 WRKQFAKLGIQLNVRA---------------TDYNRFQDKLRKGNAQLFSWGW  437 (528)
T ss_pred             HHHHHHHcCceEEEEe---------------ccHHHHHHHHhCCCCCeEEecc
Confidence            3344455788888875               3577777777778888876544


No 206
>KOG0024|consensus
Probab=43.83  E-value=29  Score=23.51  Aligned_cols=19  Identities=5%  Similarity=0.216  Sum_probs=17.0

Q ss_pred             CcchhhHHHhhhcCCccEE
Q psy2313          34 KDKWNGVVGDLVTGTAHMS   52 (62)
Q Consensus        34 ~~~w~g~ig~l~~g~~D~a   52 (62)
                      ++.|...+..+.+|++|+-
T Consensus       301 ~~~y~~ai~li~sGki~~k  319 (354)
T KOG0024|consen  301 NGDYPTAIELVSSGKIDVK  319 (354)
T ss_pred             cccHHHHHHHHHcCCcCch
Confidence            4789999999999999974


No 207
>PRK09986 DNA-binding transcriptional activator XapR; Provisional
Probab=43.40  E-value=77  Score=19.41  Aligned_cols=18  Identities=6%  Similarity=-0.186  Sum_probs=15.4

Q ss_pred             hhhHHHhhhcCCccEEEe
Q psy2313          37 WNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus        37 w~g~ig~l~~g~~D~av~   54 (62)
                      -+..+..|.+|++|+++.
T Consensus       135 ~~~~~~~l~~g~~D~~i~  152 (294)
T PRK09986        135 PSMQMAALERRELDAGIW  152 (294)
T ss_pred             HHHHHHHHHcCCCCEEEe
Confidence            356888999999999995


No 208
>PRK14317 glmM phosphoglucosamine mutase; Provisional
Probab=43.28  E-value=89  Score=21.34  Aligned_cols=50  Identities=14%  Similarity=0.051  Sum_probs=31.3

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++... ..+|+.+..+++.  ......+...+...++|++++
T Consensus       203 ~~~~ll~~LG~~v~~l~~~~dg~~~~~~~~--~~~l~~l~~~v~~~~adlGia  253 (465)
T PRK14317        203 CAPEVFKALGAEVICLHDQPDGDRINVNCG--STHLEPLQAAVLEHGADMGFA  253 (465)
T ss_pred             HHHHHHHHcCCeEEEEecccCCCCCCCCCc--hHhHHHHHHHHHhcCCCEEEE
Confidence            4667778899877543 3455554332221  123566777777888999875


No 209
>TIGR00067 glut_race glutamate racemase. The most closely related proteins differing in function are aspartate racemases.
Probab=43.23  E-value=30  Score=21.78  Aligned_cols=53  Identities=23%  Similarity=0.201  Sum_probs=32.1

Q ss_pred             HHHHHHHHcCCeEEEEEecCCc---ccceeccCCCcchhhHHHhhh-cCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGL---YGTKVRENQKDKWNGVVGDLV-TGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~---~G~~~~~~~~~~w~g~ig~l~-~g~~D~av~~l   56 (62)
                      ++++|.+.+. ..++++..|..   ||.+.+..-...--.++..|. +..+|+++.+.
T Consensus        13 v~~~l~~~~p-~~~~iy~~D~~~~PYG~ks~~~i~~~~~~~~~~L~~~~g~d~ivIaC   69 (251)
T TIGR00067        13 VLKEIRKQLP-KEHYIYVGDTKRFPYGEKSPEFILEYVLELLTFLKERHNIKLLVVAC   69 (251)
T ss_pred             HHHHHHHHCC-CCCEEEEecCCCCCCCCCCHHHHHHHHHHHHHHHHHhCCCCEEEEeC
Confidence            5788888885 33555566653   888765211112235666777 77799776543


No 210
>PRK11899 prephenate dehydratase; Provisional
Probab=42.57  E-value=24  Score=22.85  Aligned_cols=22  Identities=9%  Similarity=0.335  Sum_probs=20.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .++..++.+|.+|++|++|-|+
T Consensus        34 ~s~~~vf~av~~g~~d~gVvPi   55 (279)
T PRK11899         34 ATFEDAFEAVESGEADLAMIPI   55 (279)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEe
Confidence            4799999999999999999887


No 211
>PRK15109 antimicrobial peptide ABC transporter periplasmic binding protein SapA; Provisional
Probab=41.52  E-value=1e+02  Score=21.32  Aligned_cols=40  Identities=8%  Similarity=0.057  Sum_probs=24.8

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++.+..++.|+++++...               .|+.....+..|+.|+++.+.+
T Consensus       399 ~iq~~l~~iGI~v~i~~~---------------~~~~~~~~~~~g~~dl~~~~w~  438 (547)
T PRK15109        399 LIQADLAQVGVKVVIVPV---------------EGRFQEARLMDMNHDLTLSGWA  438 (547)
T ss_pred             HHHHHHHHcCCEEEEEEc---------------chHHHHHHhhcCCCCeEEEccc
Confidence            344455667888888754               3444444456778888776553


No 212
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism]
Probab=41.38  E-value=25  Score=22.94  Aligned_cols=22  Identities=14%  Similarity=0.231  Sum_probs=20.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .+....+.++.+|++|++|-|+
T Consensus        33 ~ti~evf~ave~g~aD~gVVPI   54 (279)
T COG0077          33 STIEDVFKAVENGEADYGVVPI   54 (279)
T ss_pred             CCHHHHHHHHHcCCCceEEEEe
Confidence            5789999999999999999887


No 213
>COG1428 Deoxynucleoside kinases [Nucleotide transport and metabolism]
Probab=41.20  E-value=28  Score=22.00  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=18.1

Q ss_pred             HHHHHHHHcCCeEEEEEecCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGL   24 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~   24 (62)
                      |.+.||+++++...+..++++.
T Consensus        20 La~~La~~l~~~~~~E~vednp   41 (216)
T COG1428          20 LAQALAEHLGFKVFYELVEDNP   41 (216)
T ss_pred             HHHHHHHHhCCceeeecccCCh
Confidence            6789999999888887777764


No 214
>PRK09755 putative ABC transporter periplasmic-binding protein; Provisional
Probab=41.06  E-value=1e+02  Score=21.29  Aligned_cols=32  Identities=16%  Similarity=0.186  Sum_probs=23.5

Q ss_pred             cCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313          11 LEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        11 l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +|+++++..               ..|+.+...+..|+.|+...+..
T Consensus       404 iGI~v~i~~---------------~d~~~~~~~~~~~~~d~~~~~w~  435 (535)
T PRK09755        404 LGAQVTLRT---------------MEWKTYLDARRAGDFMLSRQSWD  435 (535)
T ss_pred             hCCeeEEEe---------------ccHHHHHHHhhCCCceEEecccC
Confidence            788888875               35777777777888888765543


No 215
>cd08496 PBP2_NikA_DppA_OppA_like_9 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA can bind peptides of a wide range of lengths (2-35 amino-acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most
Probab=41.04  E-value=1.1e+02  Score=20.38  Aligned_cols=40  Identities=3%  Similarity=0.091  Sum_probs=24.3

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhh-hcCCccEEEeCCcc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDL-VTGTAHMSFAALSV   58 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l-~~g~~D~av~~lti   58 (62)
                      +..-.+.+|+++++...               .|+.+...+ ..++.|+++.+...
T Consensus       334 i~~~l~~iGi~v~~~~~---------------~~~~~~~~~~~~~~~d~~~~~w~~  374 (454)
T cd08496         334 VQQQLAKVGIKVTIKPL---------------TGANAAGEFFAAEKFDLAVSGWVG  374 (454)
T ss_pred             HHHHHHHcCceEEEEEe---------------chHHHHHhhccCCCccEEEeccCC
Confidence            33344557888888754               455555544 34678887766543


No 216
>KOG1879|consensus
Probab=40.62  E-value=32  Score=27.31  Aligned_cols=19  Identities=21%  Similarity=0.529  Sum_probs=16.3

Q ss_pred             hHHHHHHHHcCCeEEEEEe
Q psy2313           2 DLLENIAQELEFDFHLYIV   20 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~   20 (62)
                      |.+..||+++||+|+++..
T Consensus      1227 e~iP~mA~eYnFeyElv~Y 1245 (1470)
T KOG1879|consen 1227 ESIPHMAKEYNFEYELVQY 1245 (1470)
T ss_pred             HHHHHHHHHhCceEEEEEe
Confidence            4578899999999999963


No 217
>cd08432 PBP2_GcdR_TrpI_HvrB_AmpR_like The C-terminal substrate domain of LysR-type GcdR, TrPI, HvR and beta-lactamase regulators, and that of other closely related homologs; contains the type 2 periplasmic binding fold. This CD includes the C-terminal substrate domain of LysR-type transcriptional regulators involved in controlling the expression of glutaryl-CoA dehydrogenase (GcdH), S-adenosyl-L-homocysteine hydrolase, cell division protein FtsW, tryptophan synthase, and beta-lactamase. The structural topology of this substrate-binding domain is most similar to that of the type 2 periplasmic binding proteins (PBP2), which are responsible for the uptake of a variety of substrates such as phosphate, sulfate, polysaccharides, lysine/arginine/ornithine, and histidine. The PBP2 bind their ligand in the cleft between these domains in a manner resembling a Venus flytrap. After binding their specific ligand with high affinity, they can interact with a cognate membrane transport complex compris
Probab=40.60  E-value=53  Score=17.92  Aligned_cols=16  Identities=6%  Similarity=0.063  Sum_probs=12.7

Q ss_pred             HHHhhhcCCccEEEeC
Q psy2313          40 VVGDLVTGTAHMSFAA   55 (62)
Q Consensus        40 ~ig~l~~g~~D~av~~   55 (62)
                      .+.+|.+|++|+++..
T Consensus        38 ~~~~l~~g~~D~~i~~   53 (194)
T cd08432          38 RLVDFAREGIDLAIRY   53 (194)
T ss_pred             CccccccccccEEEEe
Confidence            4567889999999864


No 218
>cd08312 Death_MyD88 Death domain of Myeloid Differentation primary response protein MyD88. Death Domain (DD) of Myeloid Differentiation primary response protein 88 (MyD88). MyD88 is an adaptor protein involved in interleukin-1 receptor (IL-1R)- and Toll-like receptor (TLR)-induced activation of nuclear factor-kappaB (NF-kB) and mitogen activated protein kinase pathways that lead to the induction of proinflammatory cytokines. It is a key component in the signaling pathway of pathogen recognition in the innate immune system. MyD88 contains an N-terminal DD and a C-terminal Toll/IL-1 Receptor (TIR) homology domain that mediates interaction with TLRs and IL-1R. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and
Probab=40.50  E-value=14  Score=19.24  Aligned_cols=12  Identities=25%  Similarity=0.728  Sum_probs=10.9

Q ss_pred             HHHHHHHcCCeE
Q psy2313           4 LENIAQELEFDF   15 (62)
Q Consensus         4 l~~la~~l~f~~   15 (62)
                      ++.||+++||++
T Consensus        19 Wr~LA~~Lg~~~   30 (79)
T cd08312          19 WTALAEEMGFEY   30 (79)
T ss_pred             HHHHHHHcCCCH
Confidence            688999999997


No 219
>cd08311 Death_p75NR Death domain of p75 Neurotophin Receptor. Death Domain (DD) found in p75 neurotrophin receptor (p75NTR, NGFR, TNFRSF16). p75NTR binds members of the neurotrophin (NT) family including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and NT3, among others. It contains an NT-binding extracellular region that bears four cysteine-rich repeats, a transmembrane domain, and an intracellular DD. p75NTR plays roles in the immune, vascular, and nervous systems, and has been shown to promote cell death or survival, and to induce neurite outgrowth or collapse depending on its ligands and co-receptors. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptor
Probab=39.80  E-value=15  Score=19.26  Aligned_cols=15  Identities=20%  Similarity=0.299  Sum_probs=12.0

Q ss_pred             HHHHHHHcCCeEEEE
Q psy2313           4 LENIAQELEFDFHLY   18 (62)
Q Consensus         4 l~~la~~l~f~~~~~   18 (62)
                      ++.||++|||++.-+
T Consensus        18 W~~LA~~LG~~~~~I   32 (77)
T cd08311          18 WRSLAGELGYEDEAI   32 (77)
T ss_pred             HHHHHHHcCCCHHHH
Confidence            678999999998443


No 220
>PF14503 YhfZ_C:  YhfZ C-terminal domain; PDB: 2OZZ_B.
Probab=39.63  E-value=77  Score=20.16  Aligned_cols=29  Identities=10%  Similarity=0.062  Sum_probs=19.1

Q ss_pred             CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313          12 EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        12 ~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      |-+++++.               -....++..|.+|++|.++=.
T Consensus       136 gk~Ve~Ve---------------i~Y~q~~~~l~~g~IDA~IWN  164 (232)
T PF14503_consen  136 GKNVEFVE---------------IPYNQLLELLRSGEIDAAIWN  164 (232)
T ss_dssp             TS--EEEE-----------------HHHHHHHHHHTS--EEEEE
T ss_pred             CCceEEEE---------------ecHHHHHHHHHCCCccEEEEC
Confidence            55677776               368999999999999988744


No 221
>PRK14316 glmM phosphoglucosamine mutase; Provisional
Probab=39.36  E-value=1.2e+02  Score=20.51  Aligned_cols=50  Identities=18%  Similarity=0.142  Sum_probs=30.6

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|.+++|+++..+ ..+|+.+....+.  ...-..+...+...++|++++
T Consensus       188 ~~~~ll~~lg~~v~~in~~~dg~~~~~~~~--~~~~~~l~~~v~~~~adlGia  238 (448)
T PRK14316        188 LAPRLFADLGADVTVIGTSPDGLNINDGVG--STHPEALQELVVEKGADLGLA  238 (448)
T ss_pred             HHHHHHHHcCCeEEEEccCCCCCCCCCCCC--CCCHHHHHHHHhhcCCCEEEE
Confidence            5677888899887654 3345554322221  012345777778889999875


No 222
>PRK14320 glmM phosphoglucosamine mutase; Provisional
Probab=37.79  E-value=1.1e+02  Score=20.69  Aligned_cols=50  Identities=10%  Similarity=0.078  Sum_probs=30.7

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+.+++|+++..+ ..+|+.+-..++  .+.....+...+...++|++++
T Consensus       187 ~~~~ll~~lg~~v~~i~~~~dg~~~~~~~--~~~~l~~l~~~v~~~~adlGia  237 (443)
T PRK14320        187 NFEALLDKFGINYVSIASNPDGLNINVGC--GATCVSNIKKAVKEQKADLGIS  237 (443)
T ss_pred             HHHHHHHHcCCcEEEECCcCCCCCCCCCC--chHhHHHHHHHHHHcCCCEEEE
Confidence            5667888899876544 334555432221  1123556777777888999875


No 223
>PRK10116 universal stress protein UspC; Provisional
Probab=37.45  E-value=72  Score=17.35  Aligned_cols=21  Identities=0%  Similarity=-0.080  Sum_probs=17.3

Q ss_pred             cchhhHHHhhhcCCccEEEeC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ..+..++.......+|+++.+
T Consensus        89 ~~~~~I~~~a~~~~~DLiV~g  109 (142)
T PRK10116         89 ELSEHILEVCRKHHFDLVICG  109 (142)
T ss_pred             CHHHHHHHHHHHhCCCEEEEc
Confidence            357889988888999998865


No 224
>PF00800 PDT:  Prephenate dehydratase Caution this is only a partial structure.;  InterPro: IPR001086  Prephenate dehydratase (4.2.1.51 from EC, PDT) catalyses the decarboxylation of prephenate to phenylpyruvate. In microorganisms it is part of the terminal pathway of phenylalanine biosynthesis. In some bacteria such as Escherichia coli PDT is part of a bifunctional enzyme (P-protein) that also catalyses the transformation of chorismate into prephenate (chorismate mutase, IPR002701 from INTERPRO, 5.4.99.5 from EC) while in other bacteria it is a monofunctional enzyme. The sequence of monofunctional PDT aligns well with the C-terminal part of P-proteins [].; GO: 0004664 prephenate dehydratase activity, 0009094 L-phenylalanine biosynthetic process; PDB: 3MWB_B 2QMX_A 2QMW_A 3LUY_A.
Probab=36.89  E-value=34  Score=20.34  Aligned_cols=23  Identities=17%  Similarity=0.358  Sum_probs=20.6

Q ss_pred             cchhhHHHhhhcCCccEEEeCCc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .+++..+.++..+++|+++-|+-
T Consensus        30 ~s~~~v~~av~~~~~d~~vvPiE   52 (181)
T PF00800_consen   30 DSFEEVFDAVEEGEADYGVVPIE   52 (181)
T ss_dssp             SSHHHHHHHHHCTSSSEEEEEEE
T ss_pred             CCHHHHHHHHHcCCCceEEEeEe
Confidence            47999999999999999998874


No 225
>PRK14324 glmM phosphoglucosamine mutase; Provisional
Probab=36.84  E-value=1.4e+02  Score=20.37  Aligned_cols=50  Identities=14%  Similarity=0.087  Sum_probs=30.2

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++..+ ..+|+.+....+.  ...-+.+...+...++|++++
T Consensus       190 ~~~~ll~~lG~~v~~i~~~~dg~~~~~~~~--~~~~e~l~~~v~~~~adlGia  240 (446)
T PRK14324        190 VAPTVFSELGADVIVINDEPNGFNINENCG--ALHPENLAQEVKRYRADIGFA  240 (446)
T ss_pred             HHHHHHHHcCCeEEEECCCCCCCCCCCCCC--CCCHHHHHHHHHhCCCCEEEE
Confidence            4667778899876544 3455544322210  112345777788889999875


No 226
>PRK09590 celB cellobiose phosphotransferase system IIB component; Reviewed
Probab=36.78  E-value=76  Score=17.45  Aligned_cols=17  Identities=12%  Similarity=-0.013  Sum_probs=13.9

Q ss_pred             HHHHHHHHcCCeEEEEE
Q psy2313           3 LLENIAQELEFDFHLYI   19 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~   19 (62)
                      -++++++..|+++++..
T Consensus        20 k~k~~~~e~gi~~~i~a   36 (104)
T PRK09590         20 KTTEYLKEQGKDIEVDA   36 (104)
T ss_pred             HHHHHHHHCCCceEEEE
Confidence            35788899999999875


No 227
>PF01784 NIF3:  NIF3 (NGG1p interacting factor 3);  InterPro: IPR002678 This family contains several NIF3 (NGG1p interacting factor 3) protein homologues. NIF3 interacts with the yeast transcriptional coactivator NGG1p which is part of the ADA complex, the exact function of this interaction is unknown [][].; PDB: 1NMO_F 1NMP_B 2GX8_C 2FYW_B 2NYD_A 3LNL_A 2YYB_A 3RXY_F.
Probab=36.57  E-value=1.1e+02  Score=19.08  Aligned_cols=52  Identities=10%  Similarity=0.033  Sum_probs=32.0

Q ss_pred             hHHHHHHHHcCCeE-EEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           2 DLLENIAQELEFDF-HLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l~f~~-~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++++.+.+.++.+. .+.-.++....+.--.  .|+-..++.+.....+|+-+++
T Consensus       146 el~~~vk~~l~~~~vr~~g~~~~~v~rVav~--~GsG~~~i~~a~~~g~D~~ITG  198 (241)
T PF01784_consen  146 ELAERVKEKLGLPGVRVVGDPDKKVKRVAVC--GGSGGSFIEEAAEAGADVYITG  198 (241)
T ss_dssp             HHHHHHHHHTTSS-EEEESCTTSEEEEEEEE--CSSSGGGHHHHHHTTSSEEEES
T ss_pred             HHHHHHHHHcCCCcEEecCCCCCcccEEEEE--cccCccHHHHHHhCCCeEEEEc
Confidence            67889999998854 4432233322222111  2555588888888889987764


No 228
>PRK14314 glmM phosphoglucosamine mutase; Provisional
Probab=36.34  E-value=1.4e+02  Score=20.30  Aligned_cols=50  Identities=12%  Similarity=0.070  Sum_probs=29.8

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|+++..+ ..+|+.+....+.  ......+...+...++|++++
T Consensus       192 ~~~~il~~lg~~v~~~~~~~dg~~~~~~~~--~~~~~~l~~~v~~~~adlGia  242 (450)
T PRK14314        192 VAPAVFEELGAEVICIGVEPNGLNINAGCG--SLHPEVIAKAVIEHGADLGIA  242 (450)
T ss_pred             HHHHHHHHcCCeEEEeccCCCCCCCCCCCC--CCCHHHHHHHHHhcCCCeEEE
Confidence            4566778899876533 2345444322221  123456777777889999875


No 229
>PF13189 Cytidylate_kin2:  Cytidylate kinase-like family; PDB: 3FDI_A.
Probab=36.27  E-value=31  Score=20.33  Aligned_cols=13  Identities=23%  Similarity=0.675  Sum_probs=7.0

Q ss_pred             HHHHHHHHcCCeE
Q psy2313           3 LLENIAQELEFDF   15 (62)
Q Consensus         3 ll~~la~~l~f~~   15 (62)
                      +.+.||++||++|
T Consensus        15 Ia~~LA~~Lg~~~   27 (179)
T PF13189_consen   15 IAERLAEKLGYPY   27 (179)
T ss_dssp             HHHHHHHHCT--E
T ss_pred             HHHHHHHHcCCcc
Confidence            5566666666655


No 230
>PF11761 CbiG_mid:  Cobalamin biosynthesis central region;  InterPro: IPR021745  Members of this family are involved in cobalamin synthesis. The gene encoded by P72862 from SWISSPROT has been designated cbiH but in fact represents a fusion between cbiH and cbiG. As other multi-functional proteins involved in cobalamin biosynthesis catalyse adjacent steps in the pathway, including CysG, CobL (CbiET), CobIJ and CobA-HemD, it is therefore possible that CbiG catalyses a reaction step adjacent to CbiH. In the anaerobic pathway such a step could be the formation of a gamma lactone, which is thought to help to mediate the anaerobic ring contraction process []. 
Probab=36.08  E-value=22  Score=18.28  Aligned_cols=14  Identities=29%  Similarity=0.394  Sum_probs=8.6

Q ss_pred             cchhhHHHhhhcCC
Q psy2313          35 DKWNGVVGDLVTGT   48 (62)
Q Consensus        35 ~~w~g~ig~l~~g~   48 (62)
                      ..|+.+..+|.+|+
T Consensus        19 ~~~k~vsaalv~g~   32 (93)
T PF11761_consen   19 EAVKRVSAALVNGE   32 (93)
T ss_pred             HHHHHHHHHHHCCC
Confidence            35666666666664


No 231
>cd08802 Death_UNC5B Death domain found in Uncoordinated-5B. Death Domain (DD) found in Uncoordinated-5B (UNC5B). UNC5B is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5B signaling is involved in the netrin-1-induced proliferation and migration of renal proximal tubular cells. It is also required for vascular patterning during embryonic development, and its activation inhibits sprouting angiogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activatio
Probab=35.92  E-value=19  Score=19.34  Aligned_cols=11  Identities=36%  Similarity=0.495  Sum_probs=9.9

Q ss_pred             HHHHHHHcCCe
Q psy2313           4 LENIAQELEFD   14 (62)
Q Consensus         4 l~~la~~l~f~   14 (62)
                      ++.||++|||.
T Consensus        23 W~~LAekL~ld   33 (84)
T cd08802          23 WRLLAQKLSMD   33 (84)
T ss_pred             HHHHHHHcCch
Confidence            67899999998


No 232
>PF09568 RE_MjaI:  MjaI restriction endonuclease;  InterPro: IPR019068 There are four classes of restriction endonucleases: types I, II,III and IV. All types of enzymes recognise specific short DNA sequences and carry out the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. They differ in their recognition sequence, subunit composition, cleavage position, and cofactor requirements [, ], as summarised below:   Type I enzymes (3.1.21.3 from EC) cleave at sites remote from recognition site; require both ATP and S-adenosyl-L-methionine to function; multifunctional protein with both restriction and methylase (2.1.1.72 from EC) activities. Type II enzymes (3.1.21.4 from EC) cleave within or at short specific distances from recognition site; most require magnesium; single function (restriction) enzymes independent of methylase. Type III enzymes (3.1.21.5 from EC) cleave at sites a short distance from recognition site; require ATP (but doesn't hydrolyse it); S-adenosyl-L-methionine stimulates reaction but is not required; exists as part of a complex with a modification methylase methylase (2.1.1.72 from EC). Type IV enzymes target methylated DNA.   Type II restriction endonucleases (3.1.21.4 from EC) are components of prokaryotic DNA restriction-modification mechanisms that protect the organism against invading foreign DNA. These site-specific deoxyribonucleases catalyse the endonucleolytic cleavage of DNA to give specific double-stranded fragments with terminal 5'-phosphates. Of the 3000 restriction endonucleases that have been characterised, most are homodimeric or tetrameric enzymes that cleave target DNA at sequence-specific sites close to the recognition site. For homodimeric enzymes, the recognition site is usually a palindromic sequence 4-8 bp in length. Most enzymes require magnesium ions as a cofactor for catalysis. Although they can vary in their mode of recognition, many restriction endonucleases share a similar structural core comprising four beta-strands and one alpha-helix, as well as a similar mechanism of cleavage, suggesting a common ancestral origin []. However, there is still considerable diversity amongst restriction endonucleases [, ]. The target site recognition process triggers large conformational changes of the enzyme and the target DNA, leading to the activation of the catalytic centres. Like other DNA binding proteins, restriction enzymes are capable of non-specific DNA binding as well, which is the prerequisite for efficient target site location by facilitated diffusion. Non-specific binding usually does not involve interactions with the bases but only with the DNA backbone [].   This entry includes the MjaI (recognises CTAG but cleavage site unknown) restriction endonuclease. ; GO: 0003677 DNA binding, 0009036 Type II site-specific deoxyribonuclease activity, 0009307 DNA restriction-modification system
Probab=35.70  E-value=22  Score=21.66  Aligned_cols=24  Identities=29%  Similarity=0.613  Sum_probs=18.9

Q ss_pred             HHHHHHHHcCCeEEEEEecCCccc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYG   26 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G   26 (62)
                      +++.||+.+|.+|+.-.+++..+|
T Consensus        97 I~~~la~~~~~~~~~A~~eee~~~  120 (170)
T PF09568_consen   97 ILKKLAEELNVKYRLATPEEESYG  120 (170)
T ss_pred             HHHHHHhhcCCceeECccHHHHcC
Confidence            678999999999999876654443


No 233
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional
Probab=35.54  E-value=1.2e+02  Score=19.49  Aligned_cols=38  Identities=8%  Similarity=0.041  Sum_probs=22.7

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhh----cCCccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLV----TGTAHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~----~g~~D~av~~   55 (62)
                      ++....++.|++++++.               +.+..++..+.    +..+|+++++
T Consensus        52 ii~~Fe~~~gikV~~~~---------------~~s~~~~~kl~~~~~~~~~DVv~~~   93 (349)
T PRK15046         52 VFPAFTKATGIKVNYVE---------------AGSGEVVNRAAKEKSNPQADVLVTL   93 (349)
T ss_pred             HHHHHHhhhCcEEEEEe---------------CChHHHHHHHHhhhcCCCCCEEEeC
Confidence            45555566688777764               33445555443    3578987654


No 234
>cd08513 PBP2_thermophilic_Hb8_like The substrate-binding component of ABC-type thermophilic oligopeptide-binding protein Hb8-like import systems, contains the type 2 periplasmic binding fold. This family includes the substrate-binding domain of an ABC-type oligopeptide-binding protein Hb8 from Thermus thermophilius and its closest homologs from other bacteria. The structural topology of this substrate-binding domain is similar to those of DppA from Escherichia coli and OppA from Salmonella typhimurium, and thus belongs to the type 2 periplasmic binding fold protein (PBP2) superfamily. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. The type 2 periplasmic binding proteins are soluble ligand-binding components of ABC or tripartite ATP-independent transporter
Probab=35.49  E-value=1.1e+02  Score=20.35  Aligned_cols=38  Identities=8%  Similarity=0.057  Sum_probs=22.4

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHh-hhcCCccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGD-LVTGTAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~-l~~g~~D~av~~l   56 (62)
                      +..-.+++|+++++...               .|..+... +..|+.|+++.+.
T Consensus       357 i~~~l~~iGi~v~~~~~---------------~~~~~~~~~~~~~~~d~~~~~~  395 (482)
T cd08513         357 IQQQLAKIGIDVEIENV---------------PASVFFSDDPGNRKFDLALFGW  395 (482)
T ss_pred             HHHHHHHcCCEEEEeeC---------------CHHHHhhhcccCCceeEEEEcc
Confidence            34444568999998763               35555443 2345677766443


No 235
>PRK14318 glmM phosphoglucosamine mutase; Provisional
Probab=35.25  E-value=1.4e+02  Score=20.20  Aligned_cols=50  Identities=14%  Similarity=0.074  Sum_probs=30.5

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|+++... ..+|+.+....+.  ...-..+...+....+|++++
T Consensus       190 ~~~~ll~~lG~~v~~in~~~dg~~~~~~~~--~~~l~~l~~~v~~~~adlGia  240 (448)
T PRK14318        190 VAPEAYRAAGADVIAINADPDGLNINDGCG--STHLEQLQAAVVAHGADLGLA  240 (448)
T ss_pred             HHHHHHHHcCCEEEEeccCCCCCCCCCCCC--CCCHHHHHHHHHhcCCCEEEE
Confidence            5667788899986543 3345554322210  123456777778888999875


No 236
>PRK10677 modA molybdate transporter periplasmic protein; Provisional
Probab=35.21  E-value=1.1e+02  Score=19.04  Aligned_cols=38  Identities=13%  Similarity=0.186  Sum_probs=21.4

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCC-ccEEEeC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGT-AHMSFAA   55 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~-~D~av~~   55 (62)
                      +.+...++.|+++++..-              ++ ..+...+..|. +|+.+++
T Consensus        44 l~~~Fe~~~g~~v~~~~~--------------~S-g~l~~qi~~g~~~Dv~~~a   82 (257)
T PRK10677         44 IAAQYKKEKGVDVVSSFA--------------SS-STLARQIEQGAPADLFISA   82 (257)
T ss_pred             HHHHHHhhhCCeEEEEec--------------cc-HHHHHHHHcCCCCCEEEEC
Confidence            334444555777776642              11 24555666665 8888765


No 237
>PRK10216 DNA-binding transcriptional regulator YidZ; Provisional
Probab=34.57  E-value=1.2e+02  Score=19.08  Aligned_cols=17  Identities=12%  Similarity=0.419  Sum_probs=14.3

Q ss_pred             hHHHhhhcCCccEEEeC
Q psy2313          39 GVVGDLVTGTAHMSFAA   55 (62)
Q Consensus        39 g~ig~l~~g~~D~av~~   55 (62)
                      .....|.+|++|+++..
T Consensus       136 ~~~~~l~~g~~D~~i~~  152 (319)
T PRK10216        136 DSLDAITRGEVDIGFTG  152 (319)
T ss_pred             chHHHHhcCCccEEEec
Confidence            36889999999999863


No 238
>cd08506 PBP2_clavulanate_OppA2 The substrate-binding domain of an oligopeptide binding protein (OppA2) from the biosynthesis pathway of the beta-lactamase inhibitor clavulanic acid contains the type 2 periplasmic binding fold. Clavulanic acid (CA), a clinically important beta-lactamase inhibitor, is one of a family of clavams produced as secondary metabolites by fermentation of Streptomyces clavuligeru. The biosynthesis of CA proceeds via multiple steps from the precursors, glyceraldehyde-3-phosphate and arginine. CA possesses a characteristic (3R,5R) stereochemistry essential for reaction with penicillin-binding proteins and beta-lactamases. Two genes (oppA1 and oppA2) in the clavulanic acid gene cluster encode oligopeptide-binding proteins that are required for CA biosynthesis. OppA1/2 is involved in the binding and transport of peptides across the cell membrane of Streptomyces clavuligerus.  Most of other periplasmic binding proteins are comprised of only two globular subdomains cor
Probab=34.44  E-value=1.4e+02  Score=19.85  Aligned_cols=38  Identities=8%  Similarity=0.039  Sum_probs=23.3

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcC---CccEEEeCC
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTG---TAHMSFAAL   56 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g---~~D~av~~l   56 (62)
                      +..-.+++|+++++...               .|+.+...+..+   +.|+++...
T Consensus       338 i~~~l~~iGI~v~i~~~---------------~~~~~~~~~~~~~~~~~d~~~~~w  378 (466)
T cd08506         338 LQASLARAGIDVTLKPI---------------DSATYYDTIANPDGAAYDLFITGW  378 (466)
T ss_pred             HHHHHHHcCCeEEEEEc---------------chHHHHHHhcCCCccccCeEeecc
Confidence            33444668999888753               455666655554   467766544


No 239
>cd08804 Death_ank2 Death domain of Ankyrin-2. Death Domain (DD) of Ankyrin-2 (ANK-2) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-2, also called ankyrin-B (for broadly expressed), is required for proper function of the Na/Ca ion exchanger-1 in cardiomyocytes, and is thought to function in linking integral membrane proteins to the underlying cytoskeleton. Human ANK-2 is associated with "Ankyrin-B syndrome", an atypical arrythmia disorder with risk of sudden cardiac death. It also plays key roles in the brain and striated muscle. Loss of ANK-2 is associated with significant nervous system defects and sarcomere disorganization. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other
Probab=34.18  E-value=21  Score=18.87  Aligned_cols=15  Identities=27%  Similarity=0.408  Sum_probs=11.6

Q ss_pred             HHHHHHHcCCeEEEE
Q psy2313           4 LENIAQELEFDFHLY   18 (62)
Q Consensus         4 l~~la~~l~f~~~~~   18 (62)
                      ++.+|++|||++.=+
T Consensus        18 Wk~LAr~Lg~se~dI   32 (84)
T cd08804          18 WTELARELDFTEEQI   32 (84)
T ss_pred             HHHHHHHcCCCHHHH
Confidence            678999999987433


No 240
>COG1109 {ManB} Phosphomannomutase [Carbohydrate transport and metabolism]
Probab=33.73  E-value=1.6e+02  Score=20.20  Aligned_cols=52  Identities=13%  Similarity=0.179  Sum_probs=31.8

Q ss_pred             HHHHHHHHcCCeE-EEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDF-HLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~-~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+.+.+|..+ .+...+|+.+...+|+-+...-..+...+....+|++++
T Consensus       193 ~~~~ll~~lG~~vv~~~~~pDg~fp~~~p~p~~~~~~~l~~~v~~~~aDlgia  245 (464)
T COG1109         193 VAPRLLKELGAEVVSINCDPDGLFPNINPNPGETELLDLAKAVKEHGADLGIA  245 (464)
T ss_pred             HHHHHHHHcCCEEEEecCCCCCCCCCCCCCCCCccHHHHHHHHHhcCCCEEEE
Confidence            5677788888543 333467888755444322222235666667778998875


No 241
>cd08803 Death_ank3 Death domain of Ankyrin-3. Death Domain (DD) of the human protein ankyrin-3 (ANK-3) and related proteins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. ANK-3, also called anykyrin-G (for general or giant), is found in neurons and at least one splice variant has been shown to be essential for propagation of action potentials as a binding partner to neurofascin and voltage-gated sodium channels. It is required for maintaining axo-dendritic polarity, and may be a genetic risk factor associated with bipolar disorder. ANK-3 may also play roles in other cell types. Mutations affecting ANK-3 pathways for Na channel localization are associated with Brugada syndrome, a potentially fata arrythmia. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by se
Probab=33.55  E-value=21  Score=18.95  Aligned_cols=12  Identities=33%  Similarity=0.637  Sum_probs=10.2

Q ss_pred             HHHHHHHcCCeE
Q psy2313           4 LENIAQELEFDF   15 (62)
Q Consensus         4 l~~la~~l~f~~   15 (62)
                      ++.||+.|||++
T Consensus        18 W~~LA~eLg~s~   29 (84)
T cd08803          18 WTELARELNFSV   29 (84)
T ss_pred             HHHHHHHcCCCH
Confidence            567999999988


No 242
>PF04509 CheC:  CheC-like family;  InterPro: IPR007597 The precise function of these proteins is unclear, but some of them are involved in flagella motor switch []. The region represented in this entry is found in the CheC, CheX, CheA and FliY proteins. In some cases, this region is repeated in multiple copies.; GO: 0016787 hydrolase activity; PDB: 3QTA_A 1XKO_B 1SQU_B 3HZH_B 2F9Z_B 1XKR_A.
Probab=33.28  E-value=54  Score=14.72  Aligned_cols=17  Identities=6%  Similarity=0.155  Sum_probs=12.8

Q ss_pred             HHHHHHHcCCeEEEEEe
Q psy2313           4 LENIAQELEFDFHLYIV   20 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~   20 (62)
                      +..|++.+|++.++..|
T Consensus        18 ~~als~~~~~~i~is~P   34 (38)
T PF04509_consen   18 ATALSEMLGLEIDISPP   34 (38)
T ss_dssp             HHHHHHHHTS-EEEEEE
T ss_pred             HHHHHHHhCCceEcCCC
Confidence            46788889998888765


No 243
>PF01379 Porphobil_deam:  Porphobilinogen deaminase, dipyromethane cofactor binding domain;  InterPro: IPR022417 Tetrapyrroles are large macrocyclic compounds derived from a common biosynthetic pathway []. The end-product, uroporphyrinogen III, is used to synthesise a number of important molecules, including vitamin B12, haem, sirohaem, chlorophyll, coenzyme F430 and phytochromobilin [].   The first stage in tetrapyrrole synthesis is the synthesis of 5-aminoaevulinic acid ALA via two possible routes: (1) condensation of succinyl CoA and glycine (C4 pathway) using ALA synthase (2.3.1.37 from EC), or (2) decarboxylation of glutamate (C5 pathway) via three different enzymes, glutamyl-tRNA synthetase (6.1.1.17 from EC) to charge a tRNA with glutamate, glutamyl-tRNA reductase (1.2.1.70 from EC) to reduce glutamyl-tRNA to glutamate-1-semialdehyde (GSA), and GSA aminotransferase (5.4.3.8 from EC) to catalyse a transamination reaction to produce ALA.     The second stage is to convert ALA to uroporphyrinogen III, the first macrocyclic tetrapyrrolic structure in the pathway. This is achieved by the action of three enzymes in one common pathway: porphobilinogen (PBG) synthase (or ALA dehydratase, 4.2.1.24 from EC) to condense two ALA molecules to generate porphobilinogen; hydroxymethylbilane synthase (or PBG deaminase, 2.5.1.61 from EC) to polymerise four PBG molecules into preuroporphyrinogen (tetrapyrrole structure); and uroporphyrinogen III synthase (4.2.1.75 from EC) to link two pyrrole units together (rings A and D) to yield uroporphyrinogen III.     Uroporphyrinogen III is the first branch point of the pathway. To synthesise cobalamin (vitamin B12), sirohaem, and coenzyme F430, uroporphyrinogen III needs to be converted into precorrin-2 by the action of uroporphyrinogen III methyltransferase (2.1.1.107 from EC). To synthesise haem and chlorophyll, uroporphyrinogen III needs to be decarboxylated into coproporphyrinogen III by the action of uroporphyrinogen III decarboxylase (4.1.1.37 from EC) [].   Porphobilinogen deaminase (also known as hydroxymethylbilane synthase, 2.5.1.61 from EC) functions during the second stage of tetrapyrrole biosynthesis. This enzyme catalyses the polymerisation of four PBG molecules into the tetrapyrrole structure, preuroporphyrinogen, with the concomitant release of four molecules of ammonia. This enzyme uses a unique dipyrro-methane cofactor made from two molecules of PBG, which is covalently attached to a cysteine side chain. The tetrapyrrole product is synthesized in an ordered, sequential fashion, by initial attachment of the first pyrrole unit (ring A) to the cofactor, followed by subsequent additions of the remaining pyrrole units (rings B, C, D) to the growing pyrrole chain []. The link between the pyrrole ring and the cofactor is broken once all the pyrroles have been added. This enzyme is folded into three distinct domains that enclose a single, large active site that makes use of an aspartic acid as its one essential catalytic residue, acting as a general acid/base during catalysis [, ]. A deficiency of hydroxymethylbilane synthase is implicated in the neuropathic disease, Acute Intermittent Porphyria (AIP) [].  This entry represents the N-terminal domains 1 and 2 of porphobilinogen deaminase, an enzyme involved in tetrapyrrole biosynthesis. The structure of this domain consists of a duplication of two similar intertwined domains with three layers of (a/b/a) each. Porphobilinogen deaminase has a three-domain structure. Domains 1 (N-terminal) and 2 are duplications with the same structure, resembling the transferrins and periplasmic binding proteins. The dipyrromethane cofactor is covalently linked to domain 3 (C-terminal), but is bound by extensive salt-bridges and hydrogen-bonds within the cleft between domains 1 and 2, at a position corresponding to the binding sites for small-molecule ligands in the analogous proteins []. The enzyme has a single catalytic site, and the flexibility between domains is thought to aid elongation of the polypyrrole product in the active-site cleft of the enzyme.; GO: 0033014 tetrapyrrole biosynthetic process; PDB: 1GTK_A 1AH5_A 2YPN_A 1PDA_A 1YPN_A 3EQ1_B 3ECR_A.
Probab=32.58  E-value=42  Score=21.06  Aligned_cols=22  Identities=14%  Similarity=0.305  Sum_probs=15.9

Q ss_pred             cchh-hHHHhhhcCCccEEEeCC
Q psy2313          35 DKWN-GVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~-g~ig~l~~g~~D~av~~l   56 (62)
                      |-|. .+-.+|.+|++|+||-++
T Consensus        56 g~Ftkele~aLl~g~iDiAVHSl   78 (215)
T PF01379_consen   56 GLFTKELEEALLDGEIDIAVHSL   78 (215)
T ss_dssp             HCCCHHHHHHHHTTS-SEEEEEG
T ss_pred             cHHHHHHHHHHHcCCccEEEecc
Confidence            5554 355689999999999776


No 244
>cd08310 Death_NFkB-like Death domain of Nuclear Factor-KappaB precursor proteins. Death Domain (DD) of Nuclear Factor-KappaB (NF-kB) precursor proteins. The NF-kB family of transcription factors play a central role in cardiovascular growth, stress response, and inflammation by controlling the expression of a network of different genes. There are five NF-kB proteins, all containing an N-terminal REL Homology Domain (RHD). Two of these, NF-kB1 and NF-kB2 are produced from the processing of the precursor proteins p105 and p100, respectively. In addition to RHD, p105 and p100 contain ANK repeats and a C-terminal DD. NF-kBs are regulated by the Inhibitor of NF-kB (IkB) Kinase (IKK) complex through classical and non-canonical pathways, which differ in the IKK subunits involved and downstream targets. IKKs facilitate the release of NF-kB dimers from an inactive state, allowing them to migrate to the nucleus where they regulate gene transcription. The precursor proteins p105 and p100 function 
Probab=32.53  E-value=23  Score=18.24  Aligned_cols=13  Identities=23%  Similarity=0.322  Sum_probs=11.0

Q ss_pred             HHHHHHHcCCeEE
Q psy2313           4 LENIAQELEFDFH   16 (62)
Q Consensus         4 l~~la~~l~f~~~   16 (62)
                      ++.||+++||.+-
T Consensus        15 Wr~LA~~L~~~~~   27 (72)
T cd08310          15 WRELAQLLDLGHL   27 (72)
T ss_pred             HHHHHHHcCcHHH
Confidence            6889999999864


No 245
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional
Probab=32.24  E-value=41  Score=22.74  Aligned_cols=22  Identities=18%  Similarity=0.388  Sum_probs=19.7

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .+|..++.+|.+|++|++|-|+
T Consensus       137 ~s~~~v~~av~~g~~d~gVvPi  158 (386)
T PRK10622        137 AKFADIFNQVETGQADYAVLPI  158 (386)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEE
Confidence            4688899999999999999887


No 246
>COG1961 PinR Site-specific recombinases, DNA invertase Pin homologs [DNA replication, recombination, and repair]
Probab=31.98  E-value=1.2e+02  Score=18.32  Aligned_cols=47  Identities=17%  Similarity=0.162  Sum_probs=30.4

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      +.++..+...++...+....++..+..+.    ..+.-|+.++..|+ |..+
T Consensus        22 ~~l~~~~~~~g~~~~~~~~~sg~~~~~~R----p~l~~ll~~i~~g~-d~lv   68 (222)
T COG1961          22 EALEAYAKNKGCEIVFEDKDSGSSSGKNR----PGLQRLLEDIEEGK-DTLV   68 (222)
T ss_pred             HHHHHHHHhCCCEEEEEeecCCccCCCCC----HHHHHHHHHHHcCC-cEEE
Confidence            35677788889884444444444333212    35888999999998 7654


No 247
>PRK11898 prephenate dehydratase; Provisional
Probab=31.78  E-value=44  Score=21.53  Aligned_cols=22  Identities=14%  Similarity=0.288  Sum_probs=20.1

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .++...+.+|.+|++|+++-|+
T Consensus        34 ~s~~~v~~av~~~~~d~gvvPi   55 (283)
T PRK11898         34 DSIPDVLDAVEAGEVDYAVVPI   55 (283)
T ss_pred             CCHHHHHHHHHcCCCCEEEEEe
Confidence            4799999999999999999886


No 248
>PRK15104 oligopeptide ABC transporter substrate-binding protein OppA; Provisional
Probab=31.40  E-value=1.6e+02  Score=20.38  Aligned_cols=33  Identities=18%  Similarity=0.278  Sum_probs=22.2

Q ss_pred             HHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           9 QELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         9 ~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.+|+++++...               .|..+...+..|..|+.+.+.
T Consensus       410 ~~iGI~v~l~~~---------------~~~~~~~~~~~~~~d~~~~~~  442 (543)
T PRK15104        410 KNLGVNVKLENQ---------------EWKTFLDTRHQGTFDVARAGW  442 (543)
T ss_pred             HhcCceEEEEec---------------CHHHHHHHhhcCCccEeeccc
Confidence            347888888753               466666666777788766544


No 249
>PF04914 DltD_C:  DltD C-terminal region;  InterPro: IPR006998 The dlt operon (dltA to dltD) of Lactobacillus rhamnosus 7469 encodes four proteins responsible for the esterification of lipoteichoic acid (LTA) by D-alanine. These esters play an important role in controlling the net anionic charge of the poly (GroP) moiety of LTA. DltA and DltC encode the D-alanine-D-alanyl carrier protein ligase (Dcl) and D-alanyl carrier protein (Dcp), respectively. Whereas the functions of DltA and DltC are defined, the functions of DltB and DltD are unknown. In vitro assays showed that DltD bound Dcp for ligation with D-alanine by Dcl in the presence of ATP. In contrast, the homologue of Dcp, the Escherichia coli acyl carrier protein (ACP), involved in fatty acid biosynthesis, was not bound to DltD and thus was not ligated with D-alanine. DltD also catalyzed the hydrolysis of the mischarged D-alanyl-ACP. The hydrophobic N-terminal sequence of DltD was required for anchoring the protein in the membrane. It is hypothesized that this membrane-associated DltD facilitates the binding of Dcp and Dcl for ligation of Dcp with D-alanine and that the resulting D-alanyl-Dcp is translocated to the primary site of D-alanylation []. These sequences contain the C-terminal region of DltD.; PDB: 3BMA_C.
Probab=31.04  E-value=66  Score=18.50  Aligned_cols=20  Identities=30%  Similarity=0.464  Sum_probs=14.1

Q ss_pred             hHHHHHHHHcCCeEEEEEec
Q psy2313           2 DLLENIAQELEFDFHLYIVA   21 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~   21 (62)
                      +|+-.++++.|.++-++.+|
T Consensus        39 ~l~L~~~k~~g~~~lfVi~P   58 (130)
T PF04914_consen   39 QLLLDVCKELGIDVLFVIQP   58 (130)
T ss_dssp             HHHHHHHHHTT-EEEEEE--
T ss_pred             HHHHHHHHHcCCceEEEecC
Confidence            45667889999999999876


No 250
>PRK14498 putative molybdopterin biosynthesis protein MoeA/LysR substrate binding-domain-containing protein; Provisional
Probab=30.86  E-value=1.1e+02  Score=21.72  Aligned_cols=22  Identities=23%  Similarity=0.063  Sum_probs=18.8

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +....++..|.+|++|+++...
T Consensus       448 ~~s~~vl~~L~~GeiDlai~~~  469 (633)
T PRK14498        448 VGSMGGLMALKRGEADIAGIHL  469 (633)
T ss_pred             cCCHHHHHHHHcCCceEEEEcc
Confidence            5678999999999999999643


No 251
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism]
Probab=30.50  E-value=40  Score=21.40  Aligned_cols=13  Identities=23%  Similarity=0.585  Sum_probs=10.1

Q ss_pred             HHHHHHHHcCCeE
Q psy2313           3 LLENIAQELEFDF   15 (62)
Q Consensus         3 ll~~la~~l~f~~   15 (62)
                      +.+.||++|||.|
T Consensus        20 vak~lA~~Lg~~y   32 (222)
T COG0283          20 VAKILAEKLGFHY   32 (222)
T ss_pred             HHHHHHHHhCCCe
Confidence            4678888888876


No 252
>PF07833 Cu_amine_oxidN1:  Copper amine oxidase N-terminal domain;  InterPro: IPR012854 Amine oxidases (AO) are enzymes that catalyse the oxidation of a wide range of biogenic amines including many neurotransmitters, histamine and xenobiotic amines. There are two classes of amine oxidases: flavin-containing (1.4.3.4 from EC) and copper-containing (1.4.3.6 from EC). Copper-containing AO act as a disulphide-linked homodimer. They catalyse the oxidation of primary amines to aldehydes, with the subsequent release of ammonia and hydrogen peroxide, which requires one copper ion per subunit and topaquinone as cofactor []: RCH2NH2 + H2O + O2 = RCHO + NH3 + H2O2   Copper-containing amine oxidases are found in bacteria, fungi, plants and animals. In prokaryotes, the enzyme enables various amine substrates to be used as sources of carbon and nitrogen [, ]. In eukaryotes they have a broader range of functions, including cell differentiation and growth, wound healing, detoxification and cell signalling []. The copper amine oxidases occur as mushroom-shaped homodimers of 70-95 kDa, each monomer containing a copper ion and a covalently bound redox cofactor, topaquinone (TPQ). TPQ is formed by post-translational modification of a conserved tyrosine residue. The copper ion is coordinated with three histidine residues and two water molecules in a distorted square pyramidal geometry, and has a dual function in catalysis and TPQ biogenesis. The catalytic domain is the largest of the 3-4 domains found in copper amine oxidases, and consists of a beta sandwich of 18 strands in two sheets. The active site is buried and requires a conformational change to allow the substrate access. The two N-terminal domains share a common structural fold, its core consisting of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the stalk, of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other [, ].  This entry represents a domain found at the N-terminal of certain copper amine oxidases, as well as in related proteins such as cell wall hydrolase and N-acetylmuramoyl-L-alanine amidase. This domain consists of a five-stranded antiparallel beta-sheet twisted around an alpha helix [, ]. ; PDB: 1SPU_A 2WGQ_A 2WO0_A 1JRQ_A 1QAF_B 1D6U_B 1QAL_A 2WOF_A 1OAC_B 1QAK_A ....
Probab=30.37  E-value=53  Score=16.61  Aligned_cols=15  Identities=27%  Similarity=0.162  Sum_probs=11.6

Q ss_pred             HHHHHHHcCCeEEEE
Q psy2313           4 LENIAQELEFDFHLY   18 (62)
Q Consensus         4 l~~la~~l~f~~~~~   18 (62)
                      ++.+++.+|+++++-
T Consensus         9 l~~i~~~lg~~v~~d   23 (93)
T PF07833_consen    9 LRFIAEALGAKVSWD   23 (93)
T ss_dssp             HHHHHHHHT-EEEEE
T ss_pred             HHHHHHHcCCEEEEE
Confidence            578899999988884


No 253
>cd08777 Death_RIP1 Death Domain of Receptor-Interacting Protein 1. Death domain (DD) found in Receptor-Interacting Protein 1 (RIP1) and related proteins. RIP kinases serve as essential sensors of cellular stress. Vertebrates contain several types containing a homologous N-terminal kinase domain and varying C-terminal domains. RIP1 harbors a C-terminal DD, which binds death receptors (DRs) including TNF receptor 1, Fas, TNF-related apoptosis-inducing ligand receptor 1 (TRAILR1), and TRAILR2. It also interacts with other DD-containing adaptor proteins such as TRADD and FADD. RIP1 plays a crucial role in determining a cell's fate, between survival or death, following exposure to stress signals. It is important in the signaling of NF-kappaB and MAPKs, and it links DR-associated signaling to reactive oxygen species (ROS) production. Abnormal RIP1 function may result in ROS accumulation affecting inflammatory responses, innate immunity, stress responses, and cell survival. In general, DDs ar
Probab=29.53  E-value=39  Score=17.92  Aligned_cols=13  Identities=23%  Similarity=0.281  Sum_probs=10.7

Q ss_pred             HHHHHHHcCCeEE
Q psy2313           4 LENIAQELEFDFH   16 (62)
Q Consensus         4 l~~la~~l~f~~~   16 (62)
                      ++.+|++|||++.
T Consensus        16 Wk~lar~LG~s~~   28 (86)
T cd08777          16 WKRCARKLGFTES   28 (86)
T ss_pred             HHHHHHHcCCCHH
Confidence            6789999999863


No 254
>PF14399 Transpep_BrtH:  NlpC/p60-like transpeptidase
Probab=29.45  E-value=1.4e+02  Score=18.72  Aligned_cols=44  Identities=16%  Similarity=0.369  Sum_probs=31.1

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeC
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAA   55 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~   55 (62)
                      ++.+.+++.+|++++....++     .     ...|..+...|.+|+.=++..+
T Consensus        53 ~~~~~~~~~lG~~~~~~~~~~-----~-----~~~~~~l~~~l~~g~pv~~~~D   96 (317)
T PF14399_consen   53 DFEENLLERLGIKYEWREFSS-----P-----DEAWEELKEALDAGRPVIVWVD   96 (317)
T ss_pred             HHHHHHHHHCCceEEEEecCC-----H-----HHHHHHHHHHHhCCCceEEEec
Confidence            467789999999999765321     1     1468889999999975554443


No 255
>PF11057 Cortexin:  Cortexin of kidney;  InterPro: IPR020066 Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence []. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain []. This entry contains Cortexins 1, 2 and 3.; GO: 0031224 intrinsic to membrane
Probab=29.14  E-value=31  Score=18.39  Aligned_cols=20  Identities=20%  Similarity=0.388  Sum_probs=17.5

Q ss_pred             cchhhHHHhhhcCCccEEEe
Q psy2313          35 DKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~   54 (62)
                      .+|..-...+..|+.|.|++
T Consensus        62 StW~d~~eglekGqFdyaLa   81 (81)
T PF11057_consen   62 STWTDHKEGLEKGQFDYALA   81 (81)
T ss_pred             chhhhhhhhhhccccccccC
Confidence            68999999999999998763


No 256
>PF05687 DUF822:  Plant protein of unknown function (DUF822);  InterPro: IPR008540 This group of proteins contains members of the BZR1/LAT61 family of plant transcriptional repressors involved in controlling the response to Brassinosteroids (BRs). BRs are plant hormones that play essential roles in growth and development. BZR1 binds directly to DNA repressing the synthesis of genes involved in BR synthesis. Phosphorylation of BZR1 by BIN1 targets BZR1 to the 20S proteosome, while dephosphorylation leads to nuclear accumulation of BZR1 [].
Probab=28.91  E-value=48  Score=19.82  Aligned_cols=15  Identities=13%  Similarity=0.443  Sum_probs=12.6

Q ss_pred             hHHHHHHHHcCCeEE
Q psy2313           2 DLLENIAQELEFDFH   16 (62)
Q Consensus         2 dll~~la~~l~f~~~   16 (62)
                      |+|++|+++.|..++
T Consensus        49 eVLkALc~eAGw~Ve   63 (150)
T PF05687_consen   49 EVLKALCREAGWTVE   63 (150)
T ss_pred             HHHHHHHHhCCEEEc
Confidence            789999999998654


No 257
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=28.75  E-value=38  Score=19.25  Aligned_cols=47  Identities=19%  Similarity=0.316  Sum_probs=22.9

Q ss_pred             HHHHHHHcCCeEEEEEe-cCC---cccc--eeccCCCcchhhHHHhhhcCCcc
Q psy2313           4 LENIAQELEFDFHLYIV-ADG---LYGT--KVRENQKDKWNGVVGDLVTGTAH   50 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~-~~~---~~G~--~~~~~~~~~w~g~ig~l~~g~~D   50 (62)
                      ++++++.+|.+|--+-. -|.   +.|.  ......+..-..++..|.+|+++
T Consensus        52 lKe~e~~lgiSYPTvR~rLd~ii~~lg~~~~~~~~~~~~~~~IL~~L~~GeIs  104 (113)
T PF09862_consen   52 LKEMEKELGISYPTVRNRLDKIIEKLGYEEDEEEEEEDERKEILDKLEKGEIS  104 (113)
T ss_pred             HHHHHHHHCCCcHHHHHHHHHHHHHhCCCCCcccccchhHHHHHHHHHcCCCC
Confidence            56777888877743310 000   1222  00001123456677777777754


No 258
>PRK13626 transcriptional regulator SgrR; Provisional
Probab=28.08  E-value=1.8e+02  Score=20.22  Aligned_cols=38  Identities=0%  Similarity=0.131  Sum_probs=23.2

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      .++...++.|+++++...               .|......  .+++|+.+++..
T Consensus       422 ~iq~~l~~~GI~v~i~~~---------------~~~~~~~~--~~~~D~~l~~~~  459 (552)
T PRK13626        422 IMQQLLASHGVTLEIQEI---------------DYDQWHQG--EAESDIWLNSAN  459 (552)
T ss_pred             HHHHHHHHhCcEEEEEEe---------------eHHHHhcC--CCCCCEEEeccc
Confidence            345555667999998754               34443332  357888776643


No 259
>cd08318 Death_NMPP84 Death domain of Nuclear Matrix Protein P84. Death domain (DD) found in the Nuclear Matrix Protein P84 (also known as HPR1 or THOC1). HPR1/p84 resides in the nuclear matrix and is part of the THO complex, also called TREX (transcription/export) complex, which functions in mRNP biogenesis at the interface between transcription and export of mRNA from the nucleus. Mice lacking THOC1 have abnormal testis development and are sterile. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathways and can recruit other proteins into signaling complexes.
Probab=27.89  E-value=44  Score=17.61  Aligned_cols=12  Identities=25%  Similarity=0.324  Sum_probs=9.6

Q ss_pred             HHHHHHHcCCeE
Q psy2313           4 LENIAQELEFDF   15 (62)
Q Consensus         4 l~~la~~l~f~~   15 (62)
                      ++.||++|||+-
T Consensus        21 Wk~Lar~LGls~   32 (86)
T cd08318          21 WKTLAPHLEMKD   32 (86)
T ss_pred             HHHHHHHcCCCH
Confidence            678899999873


No 260
>COG4143 TbpA ABC-type thiamine transport system, periplasmic component [Coenzyme metabolism]
Probab=27.59  E-value=1.2e+02  Score=20.50  Aligned_cols=42  Identities=12%  Similarity=0.188  Sum_probs=26.6

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      +.++..++.+++++|+...|+.          .-.+.++-+=.+-+||++++
T Consensus        46 vk~~FE~~~~~~v~fV~~~d~v----------~llnRl~leg~~~~ADvvvG   87 (336)
T COG4143          46 VKKAFEAEYGCKVNFVALGDGV----------ELLNRLILEGKNPKADVVVG   87 (336)
T ss_pred             HHHHHHHHhCceEEEEEcCcHH----------HHHHHHHHcCCCCCCcEEEe
Confidence            4667778889999999765321          12344444444557888774


No 261
>PF13847 Methyltransf_31:  Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A ....
Probab=26.76  E-value=97  Score=17.32  Aligned_cols=39  Identities=10%  Similarity=0.127  Sum_probs=22.8

Q ss_pred             hHHHHHHHHcCCe-EEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           2 DLLENIAQELEFD-FHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         2 dll~~la~~l~f~-~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.++..+++++++ ++++.               +.+.. +.....+++|++++.-
T Consensus        42 ~~a~~~~~~~~~~ni~~~~---------------~d~~~-l~~~~~~~~D~I~~~~   81 (152)
T PF13847_consen   42 EYAKKRAKELGLDNIEFIQ---------------GDIED-LPQELEEKFDIIISNG   81 (152)
T ss_dssp             HHHHHHHHHTTSTTEEEEE---------------SBTTC-GCGCSSTTEEEEEEES
T ss_pred             HHhhcccccccccccceEE---------------eehhc-cccccCCCeeEEEEcC
Confidence            4566667777876 66664               33444 2221117899888764


No 262
>PF01976 DUF116:  Protein of unknown function DUF116;  InterPro: IPR002829 These archaeal and bacterial proteins have no known function. Members of this family contain seven conserved cysteines and may also be an integral membrane protein.
Probab=26.65  E-value=1.5e+02  Score=17.59  Aligned_cols=35  Identities=6%  Similarity=-0.051  Sum_probs=22.1

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEE
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSF   53 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av   53 (62)
                      -+.++|+++|+++-++.               | .+-+...+...+.|.++
T Consensus        77 ~l~~lae~~g~~v~i~~---------------G-gt~ar~~ik~~~p~~ii  111 (158)
T PF01976_consen   77 DLKKLAEKYGYKVYIAT---------------G-GTLARKIIKEYRPKAII  111 (158)
T ss_pred             HHHHHHHHcCCEEEEEc---------------C-hHHHHHHHHHhCCCEEE
Confidence            36789999999865542               2 34455556666666443


No 263
>COG2358 Imp TRAP-type uncharacterized transport system, periplasmic component [General function prediction only]
Probab=26.51  E-value=94  Score=20.75  Aligned_cols=38  Identities=13%  Similarity=0.198  Sum_probs=22.8

Q ss_pred             HHHHHHH-HcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQ-ELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~-~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      |.+.+.+ ..+++++.+..             .++-.. +..+.+|++|+|+.
T Consensus        46 ia~~~~~~~~~i~~~v~~t-------------ggSv~N-l~~i~~Ge~d~alv   84 (321)
T COG2358          46 LAQLLNKDEKGIECSVVPT-------------GGSVEN-LKLLASGEADLALV   84 (321)
T ss_pred             HHHHHhccCCCeEEEEeec-------------cchHHH-HHhHhcCccchhhh
Confidence            4455555 56666665542             233333 44778999999864


No 264
>PLN02307 phosphoglucomutase
Probab=26.41  E-value=1.7e+02  Score=21.01  Aligned_cols=29  Identities=21%  Similarity=0.139  Sum_probs=19.3

Q ss_pred             HHHHHH-HHcCCeE--EEEEecCCcccceecc
Q psy2313           3 LLENIA-QELEFDF--HLYIVADGLYGTKVRE   31 (62)
Q Consensus         3 ll~~la-~~l~f~~--~~~~~~~~~~G~~~~~   31 (62)
                      ++..+- +++|++.  .+...+|+.|+...|+
T Consensus       239 ~~~~lL~~~lG~~~~~~i~~~pDg~Fp~~~Pn  270 (579)
T PLN02307        239 YAKRIFVEELGAPESSLLNCVPKEDFGGGHPD  270 (579)
T ss_pred             HHHHHHHHhcCCCceeeecCccCCCCCCCCCC
Confidence            455666 6889865  4666788888754443


No 265
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed
Probab=25.71  E-value=1.9e+02  Score=18.57  Aligned_cols=39  Identities=18%  Similarity=0.222  Sum_probs=24.7

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhc---CCccEEEe
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVT---GTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~---g~~D~av~   54 (62)
                      ++++...++.|+++++...              ++.+.++..|..   +.+|++..
T Consensus        41 ~i~~~Fe~~~gi~V~~~~~--------------~s~~~~~~kl~a~~~~~~Dvv~~   82 (348)
T PRK09501         41 GLLEQFTKETGIKVIYSTY--------------ESNETMYAKLKTYKDGAYDLVVP   82 (348)
T ss_pred             HHHHHHHHHHCCeEEEEec--------------CCHHHHHHHHhcCCCCCceEEEe
Confidence            4677788888988887642              234455555443   45788764


No 266
>COG1110 Reverse gyrase [DNA replication, recombination, and repair]
Probab=25.70  E-value=1.5e+02  Score=23.34  Aligned_cols=41  Identities=15%  Similarity=0.174  Sum_probs=29.1

Q ss_pred             hHHHHHHHH---cCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           2 DLLENIAQE---LEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         2 dll~~la~~---l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      |..++|++.   .||+.+.+..              + -...+.....|++|+.++--+
T Consensus       349 e~aeel~e~Lr~~Gi~a~~~~a--------------~-~~~~le~F~~GeidvLVGvAs  392 (1187)
T COG1110         349 EKAEELAEYLRSHGINAELIHA--------------E-KEEALEDFEEGEVDVLVGVAS  392 (1187)
T ss_pred             HHHHHHHHHHHhcCceEEEeec--------------c-chhhhhhhccCceeEEEEecc
Confidence            445566644   5899988863              2 267788889999998876543


No 267
>cd08519 PBP2_NikA_DppA_OppA_like_20 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most s
Probab=25.61  E-value=2.1e+02  Score=19.10  Aligned_cols=22  Identities=14%  Similarity=0.256  Sum_probs=15.4

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ..|+.+...+..++.|+++...
T Consensus       364 ~~~~~~~~~~~~~~~d~~~~~~  385 (469)
T cd08519         364 VEWTTYYKQLSKGAYPVYLLGW  385 (469)
T ss_pred             cchHHHHHHHhcCCCCEEEEec
Confidence            3567777777788888876543


No 268
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein. This model finds the thiamine (and thiamine pyrophosphate) ABC transporter periplasmic binding protein ThiB in proteobacteria. Completed genomes having this protein (E. coli, Vibrio cholera, Haemophilus influenzae) also have the permease ThiP, described by TIGRFAMs equivalog model TIGR01253.
Probab=25.47  E-value=1.8e+02  Score=18.22  Aligned_cols=38  Identities=8%  Similarity=0.178  Sum_probs=24.4

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhc----CCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVT----GTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~----g~~D~av~   54 (62)
                      +++...++.|++++++..              ++=..++..|..    .++|++++
T Consensus        22 ~~~~Fe~~~gi~V~~~~~--------------~s~~~l~~kl~~e~~~~~~DVv~~   63 (309)
T TIGR01276        22 VKKAFEADCNCELKLVAL--------------EDGVSLLNRLRLEGKNSKADVVLG   63 (309)
T ss_pred             HHHHHHHHHCCEEEEEec--------------CcHHHHHHHHHHcCCCCCCCEEEe
Confidence            567777888999988742              111225555543    57898765


No 269
>cd08509 PBP2_TmCBP_oligosaccharides_like The substrate binding domain of a cellulose-binding protein from Thermotoga maritima contains the type 2 periplasmic binding fold. This family represents the substrate-binding domain of a cellulose-binding protein from the hyperthermophilic bacterium Thermotoga maritima (TmCBP) and its closest related proteins. TmCBP binds a variety of lengths of beta-1,4-linked glucose oligomers, ranging from two sugar rings (cellobiose) to five (cellopentose). TmCBP is structurally homologous to domains I and III of the ATP-binding cassette (ABC)-type oligopeptide-binding proteins and thus belongs to the type 2 periplasmic binding fold protein (PBP2) superfamily.  The type 2 periplasmic binding proteins are soluble ligand-binding components of ABC or tripartite ATP-independent transporters and chemotaxis systems. Members of the PBP2 superfamily function in uptake of a variety of metabolites in bacteria such as amino acids, carbohydrate, ions, and polyamines. L
Probab=25.43  E-value=2.2e+02  Score=19.36  Aligned_cols=33  Identities=12%  Similarity=0.216  Sum_probs=21.0

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCcc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAH   50 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D   50 (62)
                      ++..-.+++|+++++...               .|+.+...+..++.|
T Consensus       371 ~lq~~l~~iGi~v~i~~~---------------~~~~~~~~~~~~~~d  403 (509)
T cd08509         371 IIAEQLKEFGIDVTVKTP---------------DFGTYWAALTKGDFD  403 (509)
T ss_pred             HHHHHHHhcCeEEEEecC---------------CHHHHHHHhccCCCc
Confidence            344455668999998753               455665666666664


No 270
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily. The model describes thiamine ABC transporter, periplasmic protein in bacteria and archae. The protein belongs to the larger ABC transport system. It consists of at least three components: the thiamine binding periplasmic protein; an inner membrane permease; an ATP-binding subunit. It has been experimentally demonstrated that the mutants in the various steps in the de novo synthesis of the thiamine and the biologically active form, namely thiamine pyrophosphate can be exogenously supplemented with thiamine, thiamine monophosphate (TMP) or thiamine pyrophosphate (TPP).
Probab=25.36  E-value=1.8e+02  Score=18.20  Aligned_cols=38  Identities=5%  Similarity=0.133  Sum_probs=23.1

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhh----cCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLV----TGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~----~g~~D~av~   54 (62)
                      +.+...++-|++++++..              +....++..+.    ++++|++++
T Consensus        22 i~~~Fe~~~gi~V~~~~~--------------~~~~~~~~~l~~~~~~~~~Dv~~~   63 (304)
T TIGR01254        22 VEKAFEADCNCKVKFVAL--------------EDAGELLNRLRLEGKNPKADVVLG   63 (304)
T ss_pred             HHHHHhhhcCcEEEEEEC--------------CCHHHHHHHHHhcCCCCCCCEEEE
Confidence            445556677888887652              23445655554    257898863


No 271
>cd05802 GlmM GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of UDP-N-acetylglucosamine, an essential precursor to components of the cell envelope.  In order to be active, GlmM must be phosphorylated, which can occur via autophosphorylation or by the Ser/Thr kinase StkP. GlmM functions in a classical ping-pong bi-bi mechanism with glucosamine-1,6-diphosphate as an intermediate.  Other members of the alpha-D-phosphohexomutase superfamily include phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphomannomutase ManB, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrally located active site formed by four loops, one from each domain. All four domains are included in this alignment model.
Probab=25.21  E-value=2.2e+02  Score=19.16  Aligned_cols=50  Identities=14%  Similarity=0.123  Sum_probs=29.9

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|.+++|+++... ..+|+.+....+.  ...-..+...+....+|++++
T Consensus       184 ~~~~ll~~lg~~v~~in~~~dg~~~~~~~~--~~~~~~l~~~v~~~~adlGia  234 (434)
T cd05802         184 VAPEVFRELGAEVIVINNAPDGLNINVNCG--STHPESLQKAVLENGADLGIA  234 (434)
T ss_pred             HHHHHHHHcCCeEEEecCCCCCCCCCCCCC--ccCHHHHHHHHHhcCCCEEEE
Confidence            4677888899887544 2345444322221  122345667777888999875


No 272
>cd03088 ManB ManB is a bacterial phosphomannomutase (PMM) that catalyzes the conversion of mannose 6-phosphate to mannose-1-phosphate in the second of three steps in the GDP-mannose pathway, in which GDP-D-mannose is synthesized from fructose-6-phosphate. In Mycobacterium tuberculosis, the causative agent of tuberculosis, PMM is involved in the biosynthesis of mannosylated lipoglycans that participate in the association of mycobacteria with host macrophage phagocytic receptors. ManB belongs to the the alpha-D-phosphohexomutase superfamily which includes several related enzymes that catalyze a reversible intramolecular phosphoryl transfer on their sugar substrates. Other members of this superfamily include the phosphoglucomutases (PGM1 and PGM2), phosphoglucosamine mutase (PNGM), phosphoacetylglucosamine mutase (PAGM), the bacterial phosphoglucosamine mutase GlmM, and the bifunctional phosphomannomutase/phosphoglucomutase (PMM/PGM). Each of these enzymes has four domains with a centrall
Probab=25.19  E-value=2.3e+02  Score=19.34  Aligned_cols=51  Identities=10%  Similarity=-0.053  Sum_probs=29.9

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCC-cchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQK-DKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~-~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++.... .+..++...|.... .....+...+...++|++++
T Consensus       180 ~~~~ll~~lG~~v~~l~-~~~~~~~~~~~~~~~~~l~~l~~~v~~~~adlGia  231 (459)
T cd03088         180 LLVRILEALGAEVVPLG-RSDTFIPVDTEAVRPEDRALAAAWAAEHGLDAIVS  231 (459)
T ss_pred             HHHHHHHHcCCeEEEeC-CCCCCCCCCCCcCCHHHHHHHHHHHHhcCCCEEEE
Confidence            46677788999875442 12233332221000 23566777788889999885


No 273
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2. This small protein is found in three archaeal species so far (Methanococcus jannaschii, Archeoglobus fulgidus, and Methanobacterium thermoautotrophicum) as well as in Anabaena PCC7120. It is homologous to thioredoxins, glutaredoxins, and protein disulfide isomerases, and shares with them a redox-active disulfide. The redox active disulfide region CXXC motif resembles neither thioredoxin nor glutaredoxin. A closely related protein found in the same three Archaea, described by redox_disulf_1, has a glutaredoxin-like CP[YH]C sequence; it has been characterized in functional assays as redox-active but unlikely to be a thioredoxin or glutaredoxin.
Probab=25.19  E-value=1e+02  Score=15.37  Aligned_cols=19  Identities=21%  Similarity=0.240  Sum_probs=15.7

Q ss_pred             HHHHHHHHcCCeEEEEEec
Q psy2313           3 LLENIAQELEFDFHLYIVA   21 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~   21 (62)
                      .+++++++++..++++...
T Consensus        19 ~~~~~~~e~~~~~~~~~v~   37 (76)
T TIGR00412        19 NVKKAVEELGIDAEFEKVT   37 (76)
T ss_pred             HHHHHHHHcCCCeEEEEeC
Confidence            4688999999999988764


No 274
>PRK15118 universal stress global response regulator UspA; Provisional
Probab=25.14  E-value=1.3e+02  Score=16.43  Aligned_cols=21  Identities=5%  Similarity=-0.089  Sum_probs=16.9

Q ss_pred             chhhHHHhhhcCCccEEEeCC
Q psy2313          36 KWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        36 ~w~g~ig~l~~g~~D~av~~l   56 (62)
                      ..+.++......++|+++.+-
T Consensus        91 p~~~I~~~a~~~~~DLIV~Gs  111 (144)
T PRK15118         91 LGQVLVDAIKKYDMDLVVCGH  111 (144)
T ss_pred             HHHHHHHHHHHhCCCEEEEeC
Confidence            467888888889999988653


No 275
>PRK15329 chaperone protein SicP; Provisional
Probab=25.08  E-value=78  Score=18.69  Aligned_cols=16  Identities=13%  Similarity=0.395  Sum_probs=12.9

Q ss_pred             hHHHHHHHHcCCeEEE
Q psy2313           2 DLLENIAQELEFDFHL   17 (62)
Q Consensus         2 dll~~la~~l~f~~~~   17 (62)
                      +|+..+++++|.+.++
T Consensus         6 ~lL~~~~~~lGLpL~f   21 (138)
T PRK15329          6 EWLAALGEALGLPLTF   21 (138)
T ss_pred             HHHHHHHHHhCCceEE
Confidence            6889999999995554


No 276
>PF00766 ETF_alpha:  Electron transfer flavoprotein FAD-binding domain;  InterPro: IPR014731 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems. They can be functionally classified into constitutive, "housekeeping" ETFs, mainly involved in the oxidation of fatty acids (Group I), and ETFs produced by some prokaryotes under specific growth conditions, receiving electrons only from the oxidation of specific substrates (Group II) [].  ETFs are heterodimeric proteins composed of an alpha and beta subunit, and contain an FAD cofactor and AMP [, , , , ]. ETF consists of three domains: domains I and II are formed by the N- and C-terminal portions of the alpha subunit, respectively, while domain III is formed by the beta subunit. Domains I and III share an almost identical alpha-beta-alpha sandwich fold, while domain II forms an alpha-beta-alpha sandwich similar to that of bacterial flavodoxins. FAD is bound in a cleft between domains II and III, while domain III binds the AMP molecule. Interactions between domains I and III stabilise the protein, forming a shallow bowl where domain II resides. This entry represents the C-terminal domain of the alpha subunit of both Group I and Group II ETFs.; PDB: 1O96_D 3CLR_D 1O97_D 3CLT_D 3CLU_D 3CLS_D 2A1U_A 2A1T_R 1EFV_A 1EFP_C ....
Probab=24.90  E-value=72  Score=17.23  Aligned_cols=19  Identities=21%  Similarity=0.288  Sum_probs=14.1

Q ss_pred             ChHHHHHHHHcCCeEEEEE
Q psy2313           1 MDLLENIAQELEFDFHLYI   19 (62)
Q Consensus         1 idll~~la~~l~f~~~~~~   19 (62)
                      ++++++||+.+|..+=..-
T Consensus        23 ~~l~~~LA~~lga~vg~SR   41 (86)
T PF00766_consen   23 FELIEELAEALGAAVGASR   41 (86)
T ss_dssp             CHHHHHHHHHHT-EEEE-H
T ss_pred             HHHHHHHHHHhCCchhccH
Confidence            4689999999999887763


No 277
>COG0181 HemC Porphobilinogen deaminase [Coenzyme metabolism]
Probab=24.88  E-value=53  Score=21.84  Aligned_cols=22  Identities=14%  Similarity=0.296  Sum_probs=16.2

Q ss_pred             cchhh-HHHhhhcCCccEEEeCC
Q psy2313          35 DKWNG-VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g-~ig~l~~g~~D~av~~l   56 (62)
                      |-|.- +=.+|.+|++|+||-+|
T Consensus        58 GlFtkEle~all~g~~DiAVHSl   80 (307)
T COG0181          58 GLFTKELEQALLEGEIDIAVHSL   80 (307)
T ss_pred             EEEHHHHHHHHHcCCCCEEEeec
Confidence            55543 44478899999999876


No 278
>PF00035 dsrm:  Double-stranded RNA binding motif;  InterPro: IPR001159 The DsRBD domain is found in a variety of RNA-binding proteins with different structures and exhibiting a diversity of functions []. It is involved in localisation of at least five different mRNAs in the early Drosophila embryo and by interferon-induced protein kinase in humans, which is part of the cellular response to dsRNA.; GO: 0003725 double-stranded RNA binding, 0005622 intracellular; PDB: 1EKZ_A 1STU_A 1QU6_A 2L2M_A 3ADJ_A 1WHN_A 3LLH_B 2B7V_A 2L3J_A 1UHZ_A ....
Probab=24.82  E-value=92  Score=14.65  Aligned_cols=19  Identities=21%  Similarity=0.310  Sum_probs=15.3

Q ss_pred             hHHHHHHHHcCCeEEEEEe
Q psy2313           2 DLLENIAQELEFDFHLYIV   20 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~   20 (62)
                      .+|++++++.++.++++..
T Consensus         3 ~~L~e~~~~~~~~~~~~~~   21 (67)
T PF00035_consen    3 SRLNEYCQKNKFPPPYYYI   21 (67)
T ss_dssp             HHHHHHHHHCTSSEEEEEE
T ss_pred             HHHHHHHHHcCCCCCEEEE
Confidence            4688899999988888754


No 279
>PF04111 APG6:  Autophagy protein Apg6;  InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells. In yeast, 15 Apg proteins coordinate the formation of autophagosomes. No molecule involved in autophagy has yet been identified in higher eukaryotes []. The pre-autophagosomal structure contains at least five Apg proteins: Apg1p, Apg2p, Apg5p, Aut7p/Apg8p and Apg16p. It is found in the vacuole []. The C-terminal glycine of Apg12p is conjugated to a lysine residue of Apg5p via an isopeptide bond. During autophagy, cytoplasmic components are enclosed in autophagosomes and delivered to lysosomes/vacuoles. Auotphagy protein 16 (Apg16) has been shown to be bind to Apg5 and is required for the function of the Apg12p-Apg5p conjugate []. Autophagy protein 5 (Apg5) is directly required for the import of aminopeptidase I via the cytoplasm-to-vacuole targeting pathway []. Apg6/Vps30p has two distinct functions in the autophagic process, either associated with the membrane or in a retrieval step of the carboxypeptidase Y sorting pathway [].; GO: 0006914 autophagy; PDB: 3Q8T_A 3VP7_A 4DDP_A.
Probab=24.64  E-value=95  Score=20.38  Aligned_cols=17  Identities=35%  Similarity=0.716  Sum_probs=11.8

Q ss_pred             HHHHHHHHcCCe---EEEEE
Q psy2313           3 LLENIAQELEFD---FHLYI   19 (62)
Q Consensus         3 ll~~la~~l~f~---~~~~~   19 (62)
                      ||..||++++|+   |.+++
T Consensus       181 LL~~la~~l~~~f~~y~l~P  200 (314)
T PF04111_consen  181 LLQTLAKKLNFKFQRYRLVP  200 (314)
T ss_dssp             HHHHHHHHCT---SSEEEE-
T ss_pred             HHHHHHHHhCCCcccceeEe
Confidence            688999999999   66665


No 280
>PLN02317 arogenate dehydratase
Probab=24.62  E-value=68  Score=21.91  Aligned_cols=22  Identities=5%  Similarity=0.087  Sum_probs=19.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .++...+.+|..|++|++|-|+
T Consensus       124 ~sf~~vf~AVe~g~ad~gVvPI  145 (382)
T PLN02317        124 EQFEAAFQAVELWLADRAVLPI  145 (382)
T ss_pred             CCHHHHHHHHHCCCCCEEEEEE
Confidence            4789999999999999999887


No 281
>cd08317 Death_ank Death domain associated with Ankyrins. Death Domain (DD) associated with Ankyrins. Ankyrins are modular proteins comprising three conserved domains, an N-terminal membrane-binding domain containing ANK repeats, a spectrin-binding domain and a C-terminal DD. Ankyrins function as adaptor proteins and they interact, through ANK repeats, with structurally diverse membrane proteins, including ion channels/pumps, calcium release channels, and cell adhesion molecules. They play critical roles in the proper expression and membrane localization of these proteins. In mammals, this family includes ankyrin-R for restricted (or ANK1), ankyrin-B for broadly expressed (or ANK2) and ankyrin-G for general or giant (or ANK3). They are expressed in different combinations in many tissues and play non-overlapping functions. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-associati
Probab=24.58  E-value=55  Score=16.98  Aligned_cols=12  Identities=25%  Similarity=0.271  Sum_probs=10.0

Q ss_pred             HHHHHHHcCCeE
Q psy2313           4 LENIAQELEFDF   15 (62)
Q Consensus         4 l~~la~~l~f~~   15 (62)
                      ++.||++|||+.
T Consensus        18 W~~LAr~Lg~~~   29 (84)
T cd08317          18 WPQLARELGVSE   29 (84)
T ss_pred             HHHHHHHcCCCH
Confidence            577899999886


No 282
>TIGR01455 glmM phosphoglucosamine mutase. This model describes GlmM, phosphoglucosamine mutase, also designated in MrsA and YhbF E. coli, UreC in Helicobacter pylori, and femR315 or FemD in Staphlococcus aureus. It converts glucosamine-6-phosphate to glucosamine-1-phosphate as part of the pathway toward UDP-N-acetylglucosamine for peptidoglycan and lipopolysaccharides.
Probab=24.42  E-value=2.3e+02  Score=19.15  Aligned_cols=50  Identities=14%  Similarity=0.139  Sum_probs=29.4

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..+-+++|+++..+ ..+|+.+....+.  ...-..+...+...++|++++
T Consensus       187 ~~~~ll~~lg~~v~~in~~~d~~~~~~~~~--~~~l~~l~~~v~~~~adlGia  237 (443)
T TIGR01455       187 VAPHVFRELGAEVIAIGVEPDGLNINDGCG--STHLDALQKAVREHGADLGIA  237 (443)
T ss_pred             HHHHHHHHcCCEEEEEccCCCCCCCCCCCC--CCCHHHHHHHHhhcCCCEEEE
Confidence            4667788889876433 2345554322211  122355666777788999875


No 283
>PRK10887 glmM phosphoglucosamine mutase; Provisional
Probab=24.20  E-value=2.4e+02  Score=19.15  Aligned_cols=50  Identities=14%  Similarity=0.139  Sum_probs=30.0

Q ss_pred             HHHHHHHHcCCeEEEE-EecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           3 LLENIAQELEFDFHLY-IVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         3 ll~~la~~l~f~~~~~-~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++..|-+++|+++..+ ..+|+.+..+.+.  ...-..+...+...++|++++
T Consensus       186 ~~~~ll~~lG~~v~~~n~~~dg~~~~~~~~--~~~l~~l~~~v~~~~adlGia  236 (443)
T PRK10887        186 IAPNVFRELGAEVIAIGCEPNGLNINDECG--ATDPEALQAAVLAEKADLGIA  236 (443)
T ss_pred             HHHHHHHHhCCeEEEEeccCCCCCCCCCCC--CCCHHHHHHHHHhcCCCeeeE
Confidence            4667778889876543 3345544322221  123456777777889999874


No 284
>TIGR02706 P_butyryltrans phosphate butyryltransferase. Members of this family are phosphate butyryltransferase, also called phosphotransbutyrylase. In general, this enzyme is found in butyrate-producing anaerobic bacteria, encoded next to the gene for butyrate kinase. Together, these two enzymes represent what may be the less common of two pathways for butyrate production from butyryl-CoA. The alternative is transfer of the CoA group to acetate by butyryl-CoA:acetate CoA transferase. Cutoffs for this model are set such that the homolog from Thermotoga maritima, whose activity on butyryl-CoA is only 30 % of its activity with acetyl-CoA, scores in the zone between trusted and noice cutoffs.
Probab=24.09  E-value=2.1e+02  Score=18.49  Aligned_cols=17  Identities=35%  Similarity=0.378  Sum_probs=14.3

Q ss_pred             HHHhhhcCCccEEEeCC
Q psy2313          40 VVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        40 ~ig~l~~g~~D~av~~l   56 (62)
                      .+..|.+|++|..+++.
T Consensus        79 a~~lv~~G~aD~~vsg~   95 (294)
T TIGR02706        79 AVRLVSTGKADMLMKGL   95 (294)
T ss_pred             HHHHHHCCCCCEEEeCC
Confidence            36688999999999877


No 285
>PF09140 MipZ:  ATPase MipZ;  InterPro: IPR015223 Cell division in bacteria is facilitated by a polymeric ring structure, the Z ring, composed of tubulin-like FtsZ protofilaments. Correct positioning of the division plane is a prerequisite for the generation of daughter cells with a normal chromosome complement. In Caulobacter crescentus MipZ, an essential protein, coordinates and regulates the assembly of the FtsZ cytokinetic ring during cell division. MipZ, forms a complex with the partitioning protein ParB near the origin of replication and localizes with the duplicated origin regions to the cell poles. MipZ also directly interferes with FtsZ polymerisation, thereby restricting FtsZ ring formation to mid-cell, the region of lowest MipZ concentration.   In eukaryotes members of this entry belong to the Mrp/NBP35 ATP-binding protein family, and specifically the NUBP2/CFD1 subfamily. This includes the cytosolic Fe-S cluster assembly factor Cfd1, which is a component of the cytosolic iron-sulphur (Fe/S) protein assembly machinery. This protein is required for maturation of extra-mitochondrial Fe/S proteins. It may bind and transfer a labile 4Fe-4S cluster to target apoproteins. Cfd1 is also required for biogenesis and export of both ribosomal subunits, suggesting a role in assembly of the Fe/S clusters in RLI1, a protein which performs rRNA processing and ribosome export. ; PDB: 2XIT_B 2XJ4_A 2XJ9_A.
Probab=23.94  E-value=62  Score=21.06  Aligned_cols=17  Identities=18%  Similarity=0.344  Sum_probs=12.2

Q ss_pred             hHHHHHHHHcCCeEEEE
Q psy2313           2 DLLENIAQELEFDFHLY   18 (62)
Q Consensus         2 dll~~la~~l~f~~~~~   18 (62)
                      +.+++|||+.||+.---
T Consensus       195 ~~l~~ls~rigfr~~~G  211 (261)
T PF09140_consen  195 EALEELSKRIGFRVAPG  211 (261)
T ss_dssp             HHHHHHHHHHT-EEEE-
T ss_pred             HHHHHHHHhhCceeCCC
Confidence            46889999999987543


No 286
>PF06506 PrpR_N:  Propionate catabolism activator;  InterPro: IPR010524 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain found at the N terminus of several sigma54- dependent transcriptional activators including PrpR, which activates catabolism of propionate. In Salmonella enterica subsp. enterica serovar Typhimurium, PrpR acts as a sensor of 2-methylcitrate (2-MC), an intermediate of the 2-methylcitric acid cycle used by this bacterium to convert propionate to pyruvate []. ; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0005524 ATP binding, 0000160 two-component signal transduction system (phosphorelay); PDB: 2Q5C_A 2PJU_A.
Probab=23.68  E-value=1.7e+02  Score=17.18  Aligned_cols=43  Identities=14%  Similarity=0.216  Sum_probs=26.6

Q ss_pred             HHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           4 LENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      +..+++.+|++..++...+           .......+..+...-+|+.+++..
T Consensus        92 ~~~~~~ll~~~i~~~~~~~-----------~~e~~~~i~~~~~~G~~viVGg~~  134 (176)
T PF06506_consen   92 LESIEELLGVDIKIYPYDS-----------EEEIEAAIKQAKAEGVDVIVGGGV  134 (176)
T ss_dssp             HHHHHHHHT-EEEEEEESS-----------HHHHHHHHHHHHHTT--EEEESHH
T ss_pred             HHHHHHHhCCceEEEEECC-----------HHHHHHHHHHHHHcCCcEEECCHH
Confidence            4567777888877776431           134566677777777999998864


No 287
>TIGR00083 ribF riboflavin kinase/FMN adenylyltransferase. multifunctional enzyme: riboflavin kinase (EC 2.7.1.26) (flavokinase) / FMN adenylyltransferase (EC 2.7.7.2) (FAD pyrophosphorylase) (FAD synthetase).
Probab=23.52  E-value=64  Score=20.95  Aligned_cols=43  Identities=12%  Similarity=0.045  Sum_probs=26.3

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEE
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMS   52 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~a   52 (62)
                      +.|+.+++..+|.+.+..+.  ..+.+      -+-+.+-..|..|+++.|
T Consensus       119 ~~L~~~~~~~g~~v~~~~~~--~~~~~------ISST~IR~~l~~G~i~~A  161 (288)
T TIGR00083       119 LLLQLFGNTTIFCVIVKQLF--CQDIR------ISSSAIRQALKNGDLELA  161 (288)
T ss_pred             HHHHHhccccCcEEEEeccc--cCCCe------ECHHHHHHHHHcCCHHHH
Confidence            56788888888877666443  22321      234556667777776644


No 288
>PF09379 FERM_N:  FERM N-terminal domain ;  InterPro: IPR018979  This domain is the N-terminal ubiquitin-like structural domain of the FERM domain.  The FERM domain (F for 4.1 protein, E for ezrin, R for radixin and M for moesin) is a widespread protein module involved in localising proteins to the plasma membrane []. FERM domains are found in a number of cytoskeletal-associated proteins that associate with various proteins at the interface between the plasma membrane and the cytoskeleton. The FERM domain is located at the N terminus of the majority of FERM-containing proteins [, ], which includes:    Band 4.1, which links the spectrin-actin cytoskeleton of erythrocytes to the plasma membrane. Ezrin, a component of the undercoat of the microvilli plasma membrane. Moesin, which is probably involved in binding major cytoskeletal structures to the plasma membrane. Radixin, which is involved in the binding of the barbed end of actin filaments to the plasma membrane in the undercoat of the cell- to-cell adherens junction. Talin, a cytoskeletal protein concentrated in regions of cell-substratum contact and, in lymphocytes, of cell-cell contacts. Filopodin, a slime mold protein that binds actin and which is involved in the control of cell motility and chemotaxis. Merlin (or schwannomin). Protein NBL4. Unconventional myosins X, VIIa and XV, which are mutated in congenital deafness. Focal-adhesion kinases (FAKs), cytoplasmic protein tyrosine kinases involved in signalling through integrins. Janus tyrosine kinases (JAKs), cytoplasmic tyrosine kinases that are non-covalently associated with the cytoplasmic tails of receptors for cytokines or polypeptidic hormones. Non-receptor tyrosine-protein kinase TYK2. Protein-tyrosine phosphatases PTPN3 and PTPN4, enzyme that appear to act at junctions between the membrane and the cytoskeleton. Protein-tyrosine phosphatases PTPN14 and PTP-D1, PTP-RL10 and PTP2E.  Caenorhabditis elegans protein phosphatase ptp-1.   Ezrin, moesin, and radixin are highly related proteins (ERM protein family), but the other proteins in which the FERM domain is found do not share any region of similarity outside of this domain. ERM proteins are made of three domains, the FERM domain, a central helical domain and a C-terminal tail domain, which binds F-actin. The amino-acid sequence of the FERM domain is highly conserved among ERM proteins and is responsible for membrane association by direct binding to the cytoplasmic domain or tail of integral membrane proteins. ERM proteins are regulated by an intramolecular association of the FERM and C-terminal tail domains that masks their binding sites for other molecules. For cytoskeleton-membrane cross-linking, the dormant molecules becomes activated and the FERM domain attaches to the membrane by binding specific membrane proteins, while the last 34 residues of the tail bind actin filaments. Aside from binding to membranes, the activated FERM domain of ERM proteins can also bind the guanine nucleotide dissociation inhibitor of Rho GTPase (RhoDGI), which suggests that in addition to functioning as a cross-linker, ERM proteins may influence Rho signalling pathways. The crystal structure of the FERM domain reveals that it is composed of three structural modules (F1, F2, and F3) that together form a compact clover-shaped structure []. The FERM domain has also been called the amino-terminal domain, the 30kDa domain, 4.1N30, the membrane-cytoskeletal-linking domain, the ERM-like domain, the ezrin-like domain of the band 4.1 superfamily, the conserved N-terminal region, and the membrane attachment domain [].; PDB: 1EF1_B 1SGH_A 1E5W_A 2KC2_A 2KMA_A 3IVF_A 1H4R_B 3U8Z_A 1ISN_A 3BIN_A ....
Probab=23.41  E-value=61  Score=16.15  Aligned_cols=13  Identities=38%  Similarity=0.728  Sum_probs=10.7

Q ss_pred             hHHHHHHHHcCCe
Q psy2313           2 DLLENIAQELEFD   14 (62)
Q Consensus         2 dll~~la~~l~f~   14 (62)
                      ||++.+++++|..
T Consensus        21 ~l~~~v~~~l~l~   33 (80)
T PF09379_consen   21 DLLEQVCDKLGLK   33 (80)
T ss_dssp             HHHHHHHHHHTTS
T ss_pred             HHHHHHHHHcCCC
Confidence            6889999998764


No 289
>TIGR00246 tRNA_RlmH_YbeA rRNA large subunit m3Psi methyltransferase RlmH. This protein, in the SPOUT methyltransferase family, previously designated YbeA in E. coli, was shown to be responsible for a further modification, a methylation, to a pseudouridine base in ribosomal large subunit RNA.
Probab=22.80  E-value=1.3e+02  Score=17.72  Aligned_cols=13  Identities=23%  Similarity=0.381  Sum_probs=8.4

Q ss_pred             Ccc--EEEeCCcccc
Q psy2313          48 TAH--MSFAALSVSS   60 (62)
Q Consensus        48 ~~D--~av~~ltit~   60 (62)
                      ++|  +++++||.+.
T Consensus       114 ~a~~~lSLS~mTfpH  128 (153)
T TIGR00246       114 AAEQSWSLSKLTLPH  128 (153)
T ss_pred             hcCceEEeecCCCcH
Confidence            455  6777777654


No 290
>PF04459 DUF512:  Protein of unknown function (DUF512);  InterPro: IPR007549 This is a domain of uncharacterised prokaryotic proteins. It is often found C-terminal to the radical SAM domain (IPR007197 from INTERPRO).
Probab=22.58  E-value=2e+02  Score=17.79  Aligned_cols=51  Identities=10%  Similarity=0.225  Sum_probs=30.9

Q ss_pred             HHHHHHHHc----CCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCc-cEEE
Q psy2313           3 LLENIAQEL----EFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTA-HMSF   53 (62)
Q Consensus         3 ll~~la~~l----~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~-D~av   53 (62)
                      .++.+++++    |.+++++.+++.-||....-.+=-+-..++.+|..... |..+
T Consensus       111 ~l~~~~~~l~~~~~~~v~V~~V~N~fFG~~ItVaGLLTg~Dii~~L~~~~~~d~ll  166 (204)
T PF04459_consen  111 FLKPLVEKLNRIPGLEVEVVPVKNRFFGGTITVAGLLTGQDIIEQLKGKELGDLLL  166 (204)
T ss_pred             HHHHHHHHHhccCCCeEEEEEeecCCCCCCeEEeeCccHHHHHHHhCcCCCCCEEE
Confidence            456666666    99999999999999975431100122345566654433 5444


No 291
>COG4002 Predicted phosphotransacetylase [General function prediction only]
Probab=22.40  E-value=62  Score=20.75  Aligned_cols=33  Identities=24%  Similarity=0.202  Sum_probs=23.6

Q ss_pred             HHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEe
Q psy2313           9 QELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFA   54 (62)
Q Consensus         9 ~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~   54 (62)
                      ++.++.++++..+             ..-.-++..|.+|++|-|+-
T Consensus        37 ~~~~~dvelV~~k-------------dp~k~lve~Lv~g~~daaVR   69 (256)
T COG4002          37 KEEGIDVELVDNK-------------DPEKVLVEKLVDGEIDAAVR   69 (256)
T ss_pred             hhcCCceEEecCC-------------ChhHHHHHHHHccchhHHHh
Confidence            3568888887543             23356889999999997764


No 292
>cd08508 PBP2_NikA_DppA_OppA_like_1 The substrate-binding component of an uncharacterized ABC-type nickel/dipeptide/oligopeptide-like import system contains the type 2 periplasmic binding fold. This CD represents the substrate-binding domain of an uncharacterized ATP-binding cassette (ABC) type nickel/dipeptide/oligopeptide-like transporter. The oligopeptide-binding protein OppA and the dipeptide-binding protein DppA show significant sequence similarity to NikA, the initial nickel receptor. The DppA binds dipeptides and some tripeptides and is involved in chemotaxis toward dipeptides, whereas the OppA binds peptides of a wide range of lengths (2-35 amino acid residues) and plays a role in recycling of cell wall peptides, which precludes any involvement in chemotaxis. Most of other periplasmic binding proteins are comprised of only two globular subdomains corresponding to domains I and III of the dipeptide/oligopeptide binding proteins. The structural topology of these domains is most si
Probab=22.26  E-value=2.5e+02  Score=18.78  Aligned_cols=17  Identities=12%  Similarity=0.268  Sum_probs=11.5

Q ss_pred             HHHHHHHcCCeEEEEEe
Q psy2313           4 LENIAQELEFDFHLYIV   20 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~   20 (62)
                      ++.-.+++|+++++...
T Consensus       345 l~~~l~~~Gi~v~~~~~  361 (470)
T cd08508         345 VQAQLAEAGINLEIDVV  361 (470)
T ss_pred             HHHHHHhcCcEEEEEEc
Confidence            44445667999888754


No 293
>PRK08190 bifunctional enoyl-CoA hydratase/phosphate acetyltransferase; Validated
Probab=22.16  E-value=1.9e+02  Score=19.95  Aligned_cols=19  Identities=11%  Similarity=-0.031  Sum_probs=15.2

Q ss_pred             hHHHhhhcCCccEEEeCCc
Q psy2313          39 GVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus        39 g~ig~l~~g~~D~av~~lt   57 (62)
                      ..+.+|..|++|..+++..
T Consensus       241 ~a~~lv~~G~aD~~v~G~~  259 (466)
T PRK08190        241 RAVALARAGEVEALMKGSL  259 (466)
T ss_pred             HHHHHHHCCCCCEEEeCCC
Confidence            3557888999999998854


No 294
>PRK04021 hypothetical protein; Reviewed
Probab=22.14  E-value=1.2e+02  Score=16.44  Aligned_cols=17  Identities=12%  Similarity=0.268  Sum_probs=14.1

Q ss_pred             hHHHHHHHHcCCeEEEE
Q psy2313           2 DLLENIAQELEFDFHLY   18 (62)
Q Consensus         2 dll~~la~~l~f~~~~~   18 (62)
                      +|++.||+.++...+++
T Consensus        50 ali~~LAk~l~~~I~I~   66 (92)
T PRK04021         50 ELVKFFSKLLGAEVEII   66 (92)
T ss_pred             HHHHHHHHHhCCCEEEE
Confidence            57899999999876665


No 295
>PF02621 VitK2_biosynth:  Menaquinone biosynthesis;  InterPro: IPR003773 This entry describes proteins of unknown function, which appear to be putative periplasmic binding proteins.; PDB: 3A3U_A 2CZL_A 1ZBM_A 2NXO_C 2I6E_E.
Probab=22.06  E-value=1.7e+02  Score=18.29  Aligned_cols=22  Identities=9%  Similarity=0.054  Sum_probs=15.9

Q ss_pred             cchhhHHHhhhcCCccEEEeCC
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      +.=+.+-..+.+|++|++..+.
T Consensus        31 ~~P~~Ln~~l~~g~~Dv~~iSs   52 (251)
T PF02621_consen   31 GVPSELNQMLLEGELDVALISS   52 (251)
T ss_dssp             E-HHHHHHHHHTTS-SEEEEEH
T ss_pred             CCHHHHHHHHHcCCCCEEEcCH
Confidence            3456788899999999987654


No 296
>PRK10222 PTS system L-ascorbate-specific transporter subunit IIB; Provisional
Probab=22.03  E-value=1.4e+02  Score=15.67  Aligned_cols=16  Identities=6%  Similarity=0.198  Sum_probs=12.5

Q ss_pred             HHHHHHHcCCeEEEEE
Q psy2313           4 LENIAQELEFDFHLYI   19 (62)
Q Consensus         4 l~~la~~l~f~~~~~~   19 (62)
                      ++.+.+++|+++++.-
T Consensus         7 Ik~~L~e~Gi~~~ve~   22 (85)
T PRK10222          7 VDQFLTQSNIDHTVNS   22 (85)
T ss_pred             HHHHHHHcCCCeEEEE
Confidence            5678889999988763


No 297
>cd08799 Death_UNC5C Death domain found in Uncoordinated-5C. Death Domain (DD) found in Uncoordinated-5C (UNC5C). UNC5C is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5C plays a critical role in the development of spinal accesory motor neurons. Methylation of the UNC5C gene is associated with early stages of colorectal carcinogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN.
Probab=21.94  E-value=60  Score=17.39  Aligned_cols=11  Identities=27%  Similarity=0.507  Sum_probs=9.9

Q ss_pred             HHHHHHHcCCe
Q psy2313           4 LENIAQELEFD   14 (62)
Q Consensus         4 l~~la~~l~f~   14 (62)
                      ++.||++|||.
T Consensus        23 Wr~LAekLgl~   33 (84)
T cd08799          23 WRMLAHKLNLD   33 (84)
T ss_pred             HHHHHHHcCCH
Confidence            68899999998


No 298
>cd00560 PanC Pantoate-beta-alanine ligase. PanC  Pantoate-beta-alanine ligase, also known as pantothenate synthase, catalyzes the formation of pantothenate from pantoate and alanine.  PanC  belongs to a large superfamily of nucleotidyltransferases that includes , ATP sulfurylase (ATPS), phosphopantetheine adenylyltransferase (PPAT), and the amino-acyl tRNA synthetases. The enzymes of this family are structurally similar and share a dinucleotide-binding domain.
Probab=21.73  E-value=97  Score=20.09  Aligned_cols=18  Identities=6%  Similarity=0.292  Sum_probs=16.1

Q ss_pred             hHHHHHHHHcCCeEEEEE
Q psy2313           2 DLLENIAQELEFDFHLYI   19 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~   19 (62)
                      ++++.+++.++|.++++.
T Consensus       156 ~~Lk~~~~dl~~~v~ii~  173 (277)
T cd00560         156 AVIRRMVRDLNLPVEIVG  173 (277)
T ss_pred             HHHHHHHHHcCCeEEEEc
Confidence            689999999999999984


No 299
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=21.65  E-value=84  Score=16.58  Aligned_cols=13  Identities=31%  Similarity=0.560  Sum_probs=11.0

Q ss_pred             HHHHHHHHcCCeE
Q psy2313           3 LLENIAQELEFDF   15 (62)
Q Consensus         3 ll~~la~~l~f~~   15 (62)
                      +.+.|++++|+.+
T Consensus        15 ~a~~La~~~~~~~   27 (121)
T PF13207_consen   15 LAKELAERLGFPV   27 (121)
T ss_dssp             HHHHHHHHHTCEE
T ss_pred             HHHHHHHHHCCeE
Confidence            6789999999875


No 300
>PF13369 Transglut_core2:  Transglutaminase-like superfamily
Probab=21.49  E-value=1.4e+02  Score=17.10  Aligned_cols=21  Identities=14%  Similarity=0.082  Sum_probs=16.9

Q ss_pred             HHHHHHHHcCCeEEEEEecCC
Q psy2313           3 LLENIAQELEFDFHLYIVADG   23 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~   23 (62)
                      |...+|+++|+..+.+..|..
T Consensus        73 ly~~va~rlGl~~~~v~~Pgh   93 (152)
T PF13369_consen   73 LYLEVARRLGLPAEPVNFPGH   93 (152)
T ss_pred             HHHHHHHHcCCeEEEEecCCE
Confidence            467899999999998876544


No 301
>TIGR00251 conserved hypothetical protein TIGR00251.
Probab=20.90  E-value=1.4e+02  Score=15.96  Aligned_cols=17  Identities=12%  Similarity=0.321  Sum_probs=13.6

Q ss_pred             hHHHHHHHHcCCeEEEE
Q psy2313           2 DLLENIAQELEFDFHLY   18 (62)
Q Consensus         2 dll~~la~~l~f~~~~~   18 (62)
                      .|++.||+.++.+++++
T Consensus        49 ali~~La~~l~v~I~i~   65 (87)
T TIGR00251        49 ELIKFFGEIFGVDVEIV   65 (87)
T ss_pred             HHHHHHHHHhCceEEEE
Confidence            47889999999966665


No 302
>cd08478 PBP2_CrgA The C-terminal substrate binding domain of LysR-type transcriptional regulator CrgA, contains the type 2 periplasmic binding domain. This CD represents the substrate binding domain of LysR-type transcriptional regulator (LTTR) CrgA. The LTTRs are acting as both auto-repressors and activators of target promoters, controlling operons involved in a wide variety of cellular processes such as amino acid biosynthesis, CO2 fixation, antibiotic resistance, degradation of aromatic compounds, nodule formation of nitrogen-fixing bacteria, and synthesis of virulence factors, to name a few. In contrast to the tetrameric form of other LTTRs, CrgA from Neisseria meningitides assembles into an octameric ring, which can bind up to four 63-bp DNA oligonucleotides. Phylogenetic cluster analysis further showed that the CrgA-like regulators form a subclass of the LTTRs that function as octamers. The CrgA is an auto-repressor of its own gene and activates the expression of the mdaB gene wh
Probab=20.78  E-value=62  Score=17.89  Aligned_cols=14  Identities=14%  Similarity=0.233  Sum_probs=10.8

Q ss_pred             hhhcCCccEEEeCC
Q psy2313          43 DLVTGTAHMSFAAL   56 (62)
Q Consensus        43 ~l~~g~~D~av~~l   56 (62)
                      ++.+|++|+++...
T Consensus        44 ~l~~~~~D~~i~~~   57 (199)
T cd08478          44 DLIERKTDVAIRIG   57 (199)
T ss_pred             cchhccccEEEEec
Confidence            46789999998743


No 303
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional
Probab=20.72  E-value=2.4e+02  Score=17.92  Aligned_cols=39  Identities=8%  Similarity=0.140  Sum_probs=24.2

Q ss_pred             hHHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhh----cCCccEEEe
Q psy2313           2 DLLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLV----TGTAHMSFA   54 (62)
Q Consensus         2 dll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~----~g~~D~av~   54 (62)
                      ++++...++.|++++++...              +=..++..+.    ++++|++++
T Consensus        42 ~i~~~Fe~~tgikV~~~~~~--------------s~~~~~~kl~~e~~~~~~DV~~~   84 (330)
T PRK11205         42 AVKKAFEAECGCELKFVALE--------------DGVSLLNRLRLEGKNSKADVVLG   84 (330)
T ss_pred             HHHHHHHHHHCCEEEEEecC--------------cHHHHHHHHHhcCCCCCCCEEEE
Confidence            36677777789998887421              1123555444    467898764


No 304
>PF12727 PBP_like:  PBP superfamily domain;  InterPro: IPR024370 This entry represents members of the periplasmic binding domain superfamily []. It is often associated with a helix-turn-helix domain.
Probab=20.68  E-value=2.1e+02  Score=17.21  Aligned_cols=24  Identities=21%  Similarity=0.242  Sum_probs=17.3

Q ss_pred             cchhhHHHhhhcCCccEEEeCCccc
Q psy2313          35 DKWNGVVGDLVTGTAHMSFAALSVS   59 (62)
Q Consensus        35 ~~w~g~ig~l~~g~~D~av~~ltit   59 (62)
                      |+..|+. .|.+|++|+|...+...
T Consensus        19 gS~~gl~-~L~~g~~~iAg~h~~~~   42 (193)
T PF12727_consen   19 GSRAGLS-ALARGEADIAGIHLPDP   42 (193)
T ss_pred             CCHHHHH-HHHCCCceEEEecCCCC
Confidence            5665554 55799999998877543


No 305
>PF12953 DUF3842:  Domain of unknown function (DUF3842);  InterPro: IPR024208  This family of proteins has no known function. 
Probab=20.46  E-value=39  Score=19.75  Aligned_cols=53  Identities=13%  Similarity=0.315  Sum_probs=27.3

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccc--eeccCCCcchhhHHHh----hhcCCccEEEeCCcc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGT--KVRENQKDKWNGVVGD----LVTGTAHMSFAALSV   58 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~--~~~~~~~~~w~g~ig~----l~~g~~D~av~~lti   58 (62)
                      +.+.|.+.+.=..+++-..-+..-.  -.+   .|.=.|-.|+    ...+++|++++|+.|
T Consensus        16 iv~~lr~~~~~~~eI~AlGTNa~AT~~MlK---aGA~~gATGENaIv~n~~~aDiIvGpigI   74 (131)
T PF12953_consen   16 IVEKLRKELPEEVEIIALGTNAIATSAMLK---AGANEGATGENAIVVNARKADIIVGPIGI   74 (131)
T ss_pred             HHHHHHHhCCCCcEEEEEehhHHHHHHHHH---cCCCCcccccchheeccCCCCEEECcHHH
Confidence            5677777777777777653221100  000   0111111111    235689999999875


No 306
>PF11823 DUF3343:  Protein of unknown function (DUF3343);  InterPro: IPR021778  This family of proteins are functionally uncharacterised. This protein is found in bacteria and archaea. Proteins in this family are typically between 78 to 102 amino acids in length. 
Probab=20.22  E-value=1.3e+02  Score=15.04  Aligned_cols=20  Identities=10%  Similarity=0.079  Sum_probs=16.3

Q ss_pred             HHHHHHHcCCeEEEEEecCC
Q psy2313           4 LENIAQELEFDFHLYIVADG   23 (62)
Q Consensus         4 l~~la~~l~f~~~~~~~~~~   23 (62)
                      ++.+.+..|++++++..|..
T Consensus        17 ~ek~lk~~gi~~~liP~P~~   36 (73)
T PF11823_consen   17 AEKLLKKNGIPVRLIPTPRE   36 (73)
T ss_pred             HHHHHHHCCCcEEEeCCChh
Confidence            56788899999999977654


No 307
>cd08306 Death_FADD Fas-associated Death Domain protein-protein interaction domain. Death domain (DD) found in FAS-associated via death domain (FADD). FADD is a component of the death-inducing signaling complex (DISC) and serves as an adaptor in the signaling pathway of death receptor proteins. It modulates apoptosis as well as non-apoptotic processes such as cell cycle progression, survival, innate immune signaling, and hematopoiesis. FADD contains an N-terminal DED and a C-terminal DD. Its DD interacts with the DD of the activated death receptor, FAS, and its DED recruits the initiator caspases, caspase-8 and -10, to the DISC complex via a homotypic interaction with the N-terminal DED of the caspase. DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain),
Probab=20.22  E-value=76  Score=16.70  Aligned_cols=11  Identities=18%  Similarity=0.428  Sum_probs=8.2

Q ss_pred             HHHHHHHcCCe
Q psy2313           4 LENIAQELEFD   14 (62)
Q Consensus         4 l~~la~~l~f~   14 (62)
                      ++.+|++|||+
T Consensus        16 Wk~laR~LGls   26 (86)
T cd08306          16 WRKLARKLGLS   26 (86)
T ss_pred             HHHHHHHcCCC
Confidence            56778888865


No 308
>PF02310 B12-binding:  B12 binding domain;  InterPro: IPR006158  The cobalamin (vitamin B12) binding domain can bind two different forms of the cobalamin cofactor, with cobalt bonded either to a methyl group (methylcobalamin) or to 5'-deoxyadenosine (adenosylcobalamin). Cobalamin-binding domains are mainly found in two families of enzymes present in animals and prokaryotes, which perform distinct kinds of reactions at the cobalt-carbon bond. Enzymes that require methylcobalamin carry out methyl transfer reactions. Enzymes that require adenosylcobalamin catalyse reactions in which the first step is the cleavage of adenosylcobalamin to form cob(II)alamin and the 5'-deoxyadenosyl radical, and thus act as radical generators. In both types of enzymes the B12-binding domain uses a histidine to bind the cobalt atom of cobalamin cofactors. This histidine is embedded in a DXHXXG sequence, the most conserved primary sequence motif of the domain [, , ]. Proteins containing the cobalamin-binding domain include:    Animal and prokaryotic methionine synthase (2.1.1.13 from EC), which catalyse the transfer of a methyl group from methyl-cobalamin to homocysteine, yielding enzyme-bound cob(I)alamin and methionine. Animal and prokaryotic methylmalonyl-CoA mutase (5.4.99.2 from EC), which are involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.  Prokaryotic lysine 5,6-aminomutase (5.4.3.4 from EC).  Prokaryotic glutamate mutase (5.4.99.1 from EC) [].  Prokaryotic methyleneglutarate mutase (5.4.99.4 from EC).  Prokaryotic isobutyryl-CoA mutase (5.4.99.13 from EC).    The core structure of the cobalamin-binding domain is characterised by a five-stranded alpha/beta (Rossmann) fold, which consists of 5 parallel beta-sheets surrounded by 4-5 alpha helices in three layers (alpha/beta/alpha) []. Upon binding cobalamin, important elements of the binding site appear to become structured, including an alpha-helix that forms on one side of the cleft accommodating the nucleotide 'tail' of the cofactor. In cobalamin, the cobalt atom can be either free (dmb-off) or bound to dimethylbenzimidazole (dmb-on) according to the pH. When bound to the cobalamin-binding domain, the dimethylbenzimidazole ligand is replaced by the active histidine (His-on) of the DXHXXG motif. The replacement of dimethylbenzimidazole by histidine allows switching between the catalytic and activation cycles []. In methionine synthase the cobalamin cofactor is sandwiched between the cobalamin-binding domain and an approximately 90 residues N-terminal domain forming a helical bundle comprising two pairs of antiparallel helices []. In methionine synthase, there is a second, adjacent domain involved in cobalamin binding that forms a 4-helical bundle cap (IPR003759 from INTERPRO); in the conversion to the active conformation of this enzyme, the 4-helical cap rotates to allow the cobalamin cofactor to bind the activation domain (IPR004223 from INTERPRO) [].; GO: 0031419 cobalamin binding, 0046872 metal ion binding; PDB: 1Y80_A 3BUL_A 1K7Y_A 1BMT_A 3IV9_A 1K98_A 3IVA_A 3KP1_A 3KOW_A 3KOZ_A ....
Probab=20.20  E-value=1.6e+02  Score=15.60  Aligned_cols=41  Identities=7%  Similarity=0.002  Sum_probs=27.5

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCC
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAAL   56 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~l   56 (62)
                      .+..+.++.|+++.+....             ..-+.+...+...++|++.-+.
T Consensus        19 ~la~~l~~~G~~v~~~d~~-------------~~~~~l~~~~~~~~pd~V~iS~   59 (121)
T PF02310_consen   19 YLAAYLRKAGHEVDILDAN-------------VPPEELVEALRAERPDVVGISV   59 (121)
T ss_dssp             HHHHHHHHTTBEEEEEESS-------------B-HHHHHHHHHHTTCSEEEEEE
T ss_pred             HHHHHHHHCCCeEEEECCC-------------CCHHHHHHHHhcCCCcEEEEEc
Confidence            3455667779988887431             3347778888888999865443


No 309
>cd02065 B12-binding_like B12 binding domain (B12-BD). Most of the members bind different cobalamid derivates, like B12 (adenosylcobamide) or methylcobalamin or methyl-Co(III) 5-hydroxybenzimidazolylcobamide. This domain is found in several enzymes, such as glutamate mutase, methionine synthase and methylmalonyl-CoA mutase. Cobalamin undergoes a conformational change on binding the protein; the dimethylbenzimidazole group, which is coordinated to the cobalt in the free cofactor, moves away from the corrin and is replaced by a histidine contributed by the protein. The sequence Asp-X-His-X-X-Gly, which contains this histidine ligand, is conserved in many cobalamin-binding proteins. Not all members of this family contain the conserved binding motif.
Probab=20.18  E-value=1.6e+02  Score=15.61  Aligned_cols=42  Identities=10%  Similarity=-0.067  Sum_probs=28.8

Q ss_pred             HHHHHHHHcCCeEEEEEecCCcccceeccCCCcchhhHHHhhhcCCccEEEeCCc
Q psy2313           3 LLENIAQELEFDFHLYIVADGLYGTKVRENQKDKWNGVVGDLVTGTAHMSFAALS   57 (62)
Q Consensus         3 ll~~la~~l~f~~~~~~~~~~~~G~~~~~~~~~~w~g~ig~l~~g~~D~av~~lt   57 (62)
                      ++..+.+..||...+.-.             +.....++..+...++|+..-+.+
T Consensus        18 ~~~~~l~~~G~~v~~l~~-------------~~~~~~~~~~i~~~~pdiV~iS~~   59 (125)
T cd02065          18 IVAIALRDNGFEVIDLGV-------------DVPPEEIVEAAKEEDADVVGLSAL   59 (125)
T ss_pred             HHHHHHHHCCCEEEEcCC-------------CCCHHHHHHHHHHcCCCEEEEecc
Confidence            345566778888776532             245678888888889997664443


Done!